PK!<mdc/__init__.py__version__ = "1.2.1" PK!v3!! mdc/mdc.pyimport argparse import atexit from collections import defaultdict import importlib.resources import os import shutil import subprocess import sys from tempfile import NamedTemporaryFile, TemporaryDirectory from mdc import __version__ as mdc_version import mdc.resources import mdc.templates __all__ = ["build_pandoc_cmd", "run_compile"] DEFAULT_FROM = "markdown-markdown_in_html_blocks-native_divs" AVAILABLE_TEMPLATES = [ "iclr", "icml", "neurips", "note", "simple", "standalone", "stylish", ] DEFAULT_TEMPLATE = "simple" TEMPLATE_RESOURCES = defaultdict( list, { "iclr": ["iclr.bst", "iclr.sty"], "icml": ["icml.bst", "icml.sty"], "neurips": ["neurips.sty"], "simple": [ "ebgaramond12-regular.otf", "ebgaramond12-italic.otf", "ebgaramondcaps12-regular.otf", "lmmono10-regular.otf", "lmmono10-italic.otf", "lmmonocaps10-regular.otf", ], "stylish": [ "ebgaramond12-regular.otf", "ebgaramond12-italic.otf", "ebgaramondcaps12-regular.otf", "futurabook-regular.ttf", "futurabook-italic.ttf", "futuramedium-regular.ttf", "lmmono10-regular.otf", "lmmono10-italic.otf", "lmmonocaps10-regular.otf", ], }, ) DEFAULT_BIBTYPE = "natbib" DEFAULT_META = [ "figPrefix=Figure", "eqnPrefix=Equation", "tblPrefix=Table", "lstPrefix=List", "secPrefix=Section", ] DEFAULT_PANDOC = "pandoc" DEFAULT_LATEXMK = "latexmk" DEFAULT_CROSSREF = "pandoc-crossref" DEFAULT_IMG_EXT = "pdf" DEFAULT_VERBOSE = False def build_pandoc_cmd( input_file, from_=DEFAULT_FROM, template=DEFAULT_TEMPLATE, bibliography=None, bib_type=DEFAULT_BIBTYPE, crossref=DEFAULT_CROSSREF, include=None, meta=DEFAULT_META, pandoc=DEFAULT_PANDOC, ): """Build required pandoc command from given arguments.""" cmd = [pandoc] cmd.append(f"--from={from_}") cmd.append("--to=latex") if template in AVAILABLE_TEMPLATES: template_context = importlib.resources.path( mdc.templates, f"{template}.tex" ) template = template_context.__enter__() atexit.register( lambda c: c.__exit__(None, None, None), template_context ) cmd.append(f"--template={template}") if bibliography is not None: cmd.append(f"--bibliography={bibliography}") cmd.append(f"--{bib_type}") if crossref is not None: cmd.append(f"--filter={crossref}") if include: for f in include: cmd.append(f"--include-before-body={f}") if meta: for m in meta: cmd.append(f"--metadata={m}") cmd.append(f"--default-image-extension={DEFAULT_IMG_EXT}") cmd.append(input_file) return cmd def run_compile( pandoc_cmd, template, output_file=None, latexmk=DEFAULT_LATEXMK, verbose=DEFAULT_VERBOSE, ): """Run pandoc command to generate tex/pdf output.""" if TEMPLATE_RESOURCES[template]: # Create and populate resources directory if not os.path.exists("resources"): os.mkdir("resources") for resc in TEMPLATE_RESOURCES[template]: if not os.path.exists(os.path.join("resources", resc)): with importlib.resources.path(mdc.resources, resc) as resc_path: shutil.copyfile(resc_path, os.path.join("resources", resc)) if output_file is None: subprocess.run(pandoc_cmd).check_returncode() elif output_file.endswith(".tex"): pandoc_cmd.append(f"--output={output_file}") subprocess.run(pandoc_cmd).check_returncode() elif output_file.endswith(".pdf"): # Generate tex, then compile with latexmk with NamedTemporaryFile(dir="") as temp_file: pandoc_cmd.append(f"--output={temp_file.name}") subprocess.run(pandoc_cmd).check_returncode() with TemporaryDirectory() as temp_dir: latexmk_cmd = [ latexmk, "-pdf", "-lualatex", f"-output-directory={temp_dir}", f"{temp_file.name}", ] if not verbose: latexmk_cmd.append("-quiet") subprocess.run(latexmk_cmd).check_returncode() # Copy generated output file tf_only_name = os.path.basename(temp_file.name) shutil.copyfile( os.path.join(temp_dir, f"{tf_only_name}.pdf"), f"{output_file}", ) else: raise ValueError("output file extension must be .tex/.pdf") def main(): """Entry point.""" def _meta_arg(string): """Argument type for passing meta variables.""" if "=" not in string: raise argparse.ArgumentTypeError( "meta var should be passed as " "`key=val`" ) k, v = string.split("=") return f"{k}:{v}" arg_parser = argparse.ArgumentParser() arg_parser.add_argument("input_file", type=argparse.FileType("r")) arg_parser.add_argument( "-V", "--version", action="version", version=f"%(prog)s {mdc_version}" ) arg_parser.add_argument( "-v", "--verbose", action="store_true", help="make latexmk verbose" ) arg_parser.add_argument( "-o", "--output-file", type=str, default=None, help="write output to this file (default stdout)", ) arg_parser.add_argument( "-f", "--from", type=str, dest="from_", metavar="FROM", default=DEFAULT_FROM, help=f"pandoc input format (default {DEFAULT_FROM})", ) template_parser = arg_parser.add_mutually_exclusive_group(required=False) template_parser.add_argument( "-t", "--builtin-template", type=str, dest="template", choices=AVAILABLE_TEMPLATES, help=f"use one of the built-in templates (default {DEFAULT_TEMPLATE})", ) template_parser.add_argument( "-T", "--custom-template", type=str, dest="template", metavar="CUSTOM_TEMPLATE", help="use a custom template", ) arg_parser.set_defaults(template=DEFAULT_TEMPLATE) arg_parser.add_argument( "-b", "--bibliography", type=argparse.FileType("r"), default=None, help="bibliography argument for pandoc", ) arg_parser.add_argument( "-B", "--bib-type", type=str, choices=["natbib", "biblatex"], default=DEFAULT_BIBTYPE, help=f"bibliography type sent to pandoc (default {DEFAULT_BIBTYPE})", ) arg_parser.add_argument( "-i", "--include", type=argparse.FileType("r"), nargs="*", help="files to include before body", ) arg_parser.add_argument( "-m", "--meta", type=_meta_arg, nargs="*", default=DEFAULT_META, help="additional meta variables to pass to pandoc", ) arg_parser.add_argument( "--pandoc", type=str, default=DEFAULT_PANDOC, help=f"path to pandoc executable (default {DEFAULT_PANDOC})", ) arg_parser.add_argument( "--latexmk", type=str, default=DEFAULT_LATEXMK, help=f"path to latexmk executable (default {DEFAULT_LATEXMK})", ) arg_parser.add_argument( "--crossref", type=str, default=DEFAULT_CROSSREF, help=f"path to crossref executable (default {DEFAULT_CROSSREF})", ) args = arg_parser.parse_args() try: pandoc_cmd = build_pandoc_cmd( args.input_file.name, args.from_, args.template, args.bibliography.name if args.bibliography is not None else None, args.bib_type, args.crossref, [i.name for i in args.include] if args.include is not None else [], args.meta, args.pandoc, ) run_compile( pandoc_cmd, args.template, args.output_file, args.latexmk, args.verbose, ) except ValueError as e: print(f"ERROR: {e}", file=sys.stderr) return 1 except subprocess.CalledProcessError as e: print(f"ERROR: {e.cmd[0]} failed with return code {e.returncode}") return e.returncode PK!mdc/resources/__init__.pyPK!ݭ6[  %mdc/resources/ebgaramond12-italic.otfOTTO PCFF .]AFFTM#*eGDEFࢫGPOSdީ`J@GSUBIG̼NOS/2A@`cmap9headk6hhea d $hmtxe'Pmaxp P8name+8Rpostu2@ R_< hڏhڏ"OZ{B"Zd P 2=1 PdPfEd " >E @7n 7$6` 6 667       *  &F "n 46* 6{ 6 *6  6Created by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)Created by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)EB Garamond 12EB Garamond 12ItalicItalicSorts Mill Tools 2.1.0_alpha1 : EB Garamond 12 Italic : 8-4-2014Sorts Mill Tools 2.1.0_alpha1 : EB Garamond 12 Italic : 8-4-2014EB Garamond 12 ItalicEB Garamond 12 ItalicVersion 0.016 Version 0.016 EBGaramond12-ItalicEBGaramond12-ItalicCopyright (c) 2010-2013, Georg A. Duffner (<http://www.georgduffner.at/ebgaramond|g.duffner@gmail.com>). This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.Copyright (c) 2010-2013, Georg A. Duffner (). This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.http://scripts.sil.org/OFLhttp://scripts.sil.org/OFLEB GaramondEB Garamond12 Italic12 ItalicEB Garamond 12 ItalicEB Garamond 12 ItalicItalicItalic22~37EPTY\v 3<>EQWt~_pw.1:<CIMRX[ehjEMWY[]}   " & * 7 : > D I W ` q !!!!! !"!'!+!!!"""""&"6"<"A"`"k"o""#$%&&*v,}'1 &7EPTX[u#9>@QWt~pt,03<>GMOV[ahj HPY[]_  $ * 2 9 < D G W ` p t !!!!! !"!&!*!`!!"""""#"6"<"A"`"j"n""#$t%&&*t,|&1}wtg]ZWV>+$tfVS; ec"! ^[PNEDA? {lgcE<:9 ~y^^%>    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_#pbcg%vnifthqeuNjz7alk{(` !85]01$w"ox2EBGaramond12-Italic? z { | }z rE[{YmY<$+28>ELRXcnx $+2=HLPV\cjpv} !$'.5;AN[agnu{&-8CNY_eoy~ %,3:AHOV]dkry %0;BIPW^elsz ")07>ELSZahov} %,3:AHOV]fov &-4;BIU\cjqx    ' . 3 @ J S _ g p |    & 0 < D M a f j o t {     " ) 0 4 : A H O V ] d k r y    ! ( / 6 = D K R Y ` g n u |      $ + 2 9 @ G N U \ c j q x    '.5<CJQX_fmt{#*18?FMT[bipw~ &-4;BIPW^elsz ")07>ELSZahov} %,3:AHOV]dkry !(/6=DKRY`gnu| $+29@GNU\cjqx  '.5<CJQX_fmt{#*18?FMT[bipw~ $+29@GNU\cjqx  '.5<CJQX_fmt{#*18?FMT[bipw~ &-4;BIPW^elsz ")07>ELSZahov} %,3:AHOV]dkry !(/6=DKRY`gnu|$+8?EKRY`gpw~ &-4;BIPW^elsz      $ + 2 9 @ G N U \ c j q x  !!!!!!$!+!0!7!>!E!L!S!Z!a!h!o!v!}!!!!!!!!!!!!!!!!!!"" """"&"-"4";"B"I"P"W"^"e"l"s"z"""""""""""""""""""## ###"#)#0#7#>#E#L#S#Z#a#h#o#v#}##################$$$$$$*$7$D$O$\$i$p${$$$$$$$$$$$$$$$$$$$%% %%%!%1%@%O%`%p%%%%%%%%%&&&"&1&?&M&[&^&a&d&g&j&q&x&&&&&&&&&&&&&&'''!'1'?'N'['d'n'y'''''''''''''(( (((,(3(9(?(E(K(Q(W(](c(i(o(u({((((((((((((((((()))')-)3)9)?)E)K)Q)W)])c)i)o)u){))))))))))))))))******5*A*L*Z*e*r***********+ +++$+,+6+?+H+P+Z+d+m+w+++++++++++++++++,,, ,,,,$,*,0,6,<,B,H,N,T,d,r,,,,,,,,,,,,,,,,,--- ----$-*-0-6-<-B-H-V-^-m-|----------....+.;.I.X.e.n.x............../ ///)/6/=/C/I/O/U/[/a/g/m/s/y//////////////////000'01070=0C0I0O0U0[0a0g0m0s0y000000000000000001111)141?1K1V1d1o1|11111111112222&2.262@2I2R2Z2d2n2w2222222222222222233 3333"3(3.343:3@3F3L3R3X3^3n3|333333333333333344 4444"4(4.444:4@4F4L4R4`4h4w444444444445 555)575C5P5[5b5j5s5|5555555555555555666 666666#6'6+6/63676;6?6C6G6K6O6S6W6[6_6c6g6k6o6}6666666666666666666666777 777777#7/757B7O7\7c7n7y7777777777788 88 818;8J8[8j8s8|88888888888899999'909>9G9S9^9g9p9y9999999999999::::*:3:<:J:V:\:e:n:w:::::::::::::; ;;;%;/;8;A;O;];j;w;;;;;;;;;;;;;<< <> >>&>6>;>@>I>R>\>f>o>x>>>>>>>>>>>>>?? ???(?1?:?B?J?Z?j?t?~??????????@@@ @@@@!@.@;@H@U@b@g@l@u@@@@@@@@@@@@@@@@@@@@@@AAAA AAAAA A$A(A,A0A4A8A?@|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abgdfj}srx{      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:oAuiwvpqtyklc      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y #&DX}*CWfw =Ln#Wk %7FUgvv#2BN^lx$;~*S  4 T d t   9 P i  ) E ` r j X4X|eGe6\e(m ] 8k4Z3 -_-g > b !!/!Q!n!!!""@"""##5#_###$$>$f$$%7%\%%&.&P&t'(o(((())6)S)|))))**,*P*}****++X+v++,-]-{----..3/</T////0-0a122U2w223 3,3g3334=4p445515S5v6k7K7j77778888`88889919O9999::E:e::::;;#;7<:>>>>>>??6?V???@*@c@@AA=AABBBBC7CYCCCDDNEcEEEFF]FFFGGUGHHMIKiKKLLNLLLMM;M`M}MMNN%NPNNNOOBOfOOOPP1PWPyPPQQ>QqQQR+RuRRRS/SNSSSTKTU3UVTWWVWX/YYZBZ[\=\L\`\u\\]@]N]]]^^^,^>^P^h^z^^^^_K_`aaa(a:aWafaraaaaaabbb)bAbbbc/cccccd#dQddddee%e4eHebeteeeefEfWfif~ffffffg1ghgghhh4hEhkhzhhhhhii#i5i^iiiijj`jtjjk<kWkfkxlFlUlgltllmnn$nAo%o8oIqLq\qnqqqrr9r_rrsstFttuuuuvww1wxbx~y&y^yz:z{|5|]} }7}_}}}~&EVy3!UWyIo~u5+?* $M{,?PSc8LY{KqP/JUj<Ji| * : *R)'hz=b.1L2e~6cCw>p=g/y$3ETpUlE).F0n9LZm&E{Q8eGx E:y Kt±CmÓû0RsēĻ:\ŀŞ @bƑƱ'Edǖ%EqȏȺ!?ZxɔɵHʑ!\˒0g̓Rqͻ%E~Ω UϏXВг;^Ѥ 9YxҩRnӝӷ0PtԝԹ3ZխLhֺ֙ 7bע<`cfQTvٺ'[ڰ8pcܕlݟ$zޮAߚNy.i+i4TEoKI@k7b 8X%UNpNY<q N5stQ&\1r@d(lI gJwIe<rUBHjIMv$V-j4p6lb  }  s  i  ~   O  q.y=L%kbp.<lD3w [;_LO'Ps0i>|.Lo  >  !?!!"C"b""""##K#_##$$q$$% %C%g%z%%%%%%%%%%%%%%%%%%%%%&&&;&R&m&&&&&&''f'v''''''(((.(S(\(e(((();)|)))*!*+Q+,A,X,--$-2-I-W-e..@./4/0011111122223I3346667,7[888>8k8899999::/:=:Y:}::::;;*;?;a;};;< <7>&>5>>>>?v?@)@@@AAAA)AAAABBB2BOBoBBBBBBC CCCCQCyCCDDIDDDEEZEEFFXFFGG^GGHH1HbHHHII6IeIIIJ7JuJJKKZKKL&L[LLLM(MMMNNNNwNNNO9OOOPP:PfPPPQ<QjS T>TTTUUUUUVYYZ[e\n]]^_M_N_z_``aaabzc2dCdfdeef9fWfgXghhhiiCj kIl$m7mno3oPoopq)qrQrsLstatuqvv,vw-wwxYxz{|}~f=w,;Wer)?\q.<K`t+;Pm.M}$5Ej  1Abv &AQl0CRby%9J_s2^U&4CV{!6Fg -Iau  3[} 6DVduLc~*>Ui-E\"hN^m| 2Yo #4V~;Sh~)Qs 1@Rar"Rj :Pi!7SlJHx*8I]%6N_(Jf~(AU}$5F]l~1O!8Qk.EUl<V ;h(/JYk1QkxHj)9Li<^-8Zt )<Ys,NtMar:ct 0EZv!Pc /QvOeœ`æ$IvĞ,^iōŭ0,nǓǸ<lɂɹ<}Af˓˻I{̟#Ggb·ά#HnϠ6fЖ%Puњ`Ҥ"dӦ(\Ԑ8jդ 8^քֱ>`~ל׸>c؈؛$Sـ٭Cjڑڰ3Ufwۈ۴@vܬJ~ݴTއ޺ _ߞ0\ <[z@l'Kj(2Z =RWj}[h>ua2-+F)=.T?,H#  O      " 2 B Q h      1@Qap .>P`}@Sk    !!!A!V!k!{!!!!!!!!""")":"{""""""""# ##.#C#Q#a#{######$ $$+$$%%%%%%&2&&(c(())()W)|)))*"+B,,./m//01a1鋽 $m$; 02}򅭰 "p!  P|g" # ]\Pw0)$ I% p& ' xD( Z) S** }w+ , yp- , yp- j$=v׿Ͷ㷸. / 0 1 xP|^g# Uw 2 Tw3 H>v֬wZ/4 Lvz5 06 >t>7 S}8 g\9 |o2: m; G< = MV[[r~1> ? @ 4v{cwжA B C OV~HD z|MfE xF vG ~dzH I OCJ devΧBK QjL (};nM 8 X&$N O LvyP L# Q Y?Q Lv]~R 1}LL)S T U V n7%Y} B˸W C}{yX Y zZ Nҧknr[ 8\ ] ^ _ ` l}N}a jMMb &c pd kwz!e wzmhf }}F` g h hi D\2j k i,l v`m n `o 1p }kx,q gr 8zt1s t ̴y=l}{;d:qDw{z~|7@ǨntbmR9~#zإ37"G]1NZjko/h u }Ītpv w x y }vtv?ݖjz { | yݮ=} }~   6 Qr z̵Q L\ܨ !^\ J\ܨFR  Jy )Ukɭ{ }wDG5ӳK ) B& 3\ Z V~ ->s> 5  c - 8 &Da &(&  L+  Lt:p~ewL=w{Zctmjwo\zƪr\JKHwF F빤ܖvin\Z^bsl{vkqiw|wx|ngyQ_oz|wocQ7!Vr IvOwë!  W$GCGu  v r*@ zƄ  K!~[iZ~w}p\-~bqrzsd™5ӪT xj F d\ Y Qvbww |~{է擥nrnr{|QURURS܉ƌl%K7i'3 tbww v d*خp~ewL=w{[ctmiwo\zƪr\JKHwPvb"w|~zզ擥nrnr{|QURURSމƌl%K '3+ 빤ܘcn\Z^bsl{vkqiw|wx|fdyQ\|ox|wny3r3nw-!ႈ$\i "YBM׀"Y7F&5Ƌz9dzƏ|s@!֒ ْÅ2_/*GhmY9:X2xUeҦ\\ާ{>?\!\ͳ6#}欷-2;M E*~ }欷-;M *~ }欯'E "~ }欺'a ] ~ Q謷-0;6M X dh݋>90L}!!" {{Yca{Y{}{}\X}\jyZt~w_wwՆ:OQX]dNq[miiskimi|~vuuuezzxȣ΋͋YM216^e1s&t"Zk.dz9}h`Y}wwxwsd> !-+΋beS(Lkn}YDG2ՐN{ g  Ȁ   }QDG!Nr D  Ȁ   }WDGJxGus|{~u|w zdJ4V4 {Hum|ouL~|hPi =Ci }qV{( | H ( P0 hѼ{ xri }҂P"  h{ hi }OПҫU  hmh i dlgқ!  [ hꪺ" $i } \-2j GXi xl$   [ D\WfE pj +TW ! ˨1& k ٻ=E8& %  v9) i䪷-;M \l .}d p* N/ iˮ& ~xl .R& 0x iQMePg/BuemvWlo#l .}YMm% ;6 i)m l .}8 8 iwrեSL}\_xZt~"+ċmdj\CIa\;y& 9 1FZ# Tp }ֵWϤ$ - }ֵMY% L5 1tEm`/T_{szjpouw‹7xő{Rq^ {|{hX8|_|THvCy~~dly)m # [v w x y tzWv$ p }{J*- ;3ݖ M =z v{ | }⹼QĊ˒!$r rK ȱ в }{J*ֆ4ݖ sE 5z v{ | }⹻WĊޤ$ r0 ȱ в y{J*F̈́ݖ$  ^`z >`{ ^`| qƄƃĊ'  d b d }{J*֫Yݖ # z v{ | }⹻WĊs$$ j ȱ в yxݮ=̈́=)  d2\}  qf'  h^< yݮƤ# d}  }M(~% 8: ye=azI%}[jtZt}w_wJI%dۋI-m3"{9}~snhdyYoAËkyҒI3m~{} }Z-ċ< foҰ{uzxzpx 85eȋr$Ǎvymp{ituwb|}gy{vB(ٽ؋|}}}A i F~ }V| (  X }Ѽ4L u~ } a }^4 ~ }ͼП Z }欺gߵ  O~ }֧Ӱ  # }欷-R;p;(M 0  *~ }Q!m!(Tr 0 XN d :~ dO!  gvE 5  Z}W|O 2? Q謯E 9 ƀWȧۤ (k  ͻ Q謺 ] H z̵-<;BM O rieQ.!S r vY  z̵2p"  rie#呷  vM  z̵# = rieW $ v   1n, wzmhf }kݠM- nr }۳m. Pn }ٴo/ 0 }۳r1 }ݮt~ͽO3!*@!2{||zafG}ǪI @f@@~=v82 1v82 2 ajq̵oM5n# = !b &c Jd iejWdMቨ$ Lh  h !jb &c d ie|hWsV$ X4  4 %  \-2j Fl  w  ?l xl}  ? p\-g2j `p ww  p xֵQ  ~ A=Q# Y zZ }WDGN$ <  Ȁ   h# i }9Wɤ$ Um }pc(/# KFq gr }W,$  K }FZ# ~ }Wڤ $  }欺ﵼ'Tf *0 ] ~ }ﴷD; *[6 + N }欺 '~p'* *K} ] ~ };F)3 ,7 + N }欺'I W3# * ] ~ }}4r̠(4 *8S + N }欺';pj5 *} ] ~ };~Β6 *O + N 1ﵼT(^ T0 ] Y zZ }ﴷ/DG2{||zafG}ǪI @f@@~rW$ {8 +TWH$  ajq̵oM0Y !b &c Ld iejVMቨL@  #jb &c d ie|hsVXp>@ p '  }}殭-;UM cGg btQ$TI!@r Y  ր 倚  *S "gĀ 1Ⱳ-2;M u\p }ֵY{ XW 1 Vpgߵ* f"  AY zZ }Χ䧔 DG&}pDNs@ * p+9 :        #pmp-;C M 0Q `  `  h 0  ͂c͹Q!Or .3 {I  }-;nM F "݀))5@:>3r3nw-$\ "YB@׀"Y@@&@z9dzƏs@!֒@ْÀ2_/@GmY9:X@@x@@\\{>@\!\ͳ@#}QK! (r 9@ڀ@f*R @@E@Q @)0T *'R q@Q 3)@{'m@Wۋ 3@*@5@Н .-W;*D.-;e;PM ` 'SY zZ }YrG < rv ©{J*pݖ& /`l%z `{ /`| »ƂĊ & 4 2 4 y˦ݮ& {}  & 8Y _s# 4fh }!07  1" ?Y zZ }DG YN 6  Ȁ   kf̈́  ye bpJQƄ''  y 3$ }ﵼQT~; %0 ] Ȁq gr }ﴷDd; $[6 + z K }ľkXD  $-5 %Nq gr }mĿl  M= "> ? Āj6 K }" g#q gr }@^(  K }sq6 "&2" g#q gr }︷ Wb? "2  K QѼ , ƀȧ_Q s  ˻ + @ Q}w2jba|^kIl}\aڋv]{}}lyvksgCcXYti\Cuke;}ok4;ANxh܋/n+uBS>M`z{w|{fxG}vݷ~zx>sxzÍkuY׋Pg+2@;dj"}Xin+GWc_z{w|{fxH}Kzub\[bxwZ~' h3;FSxhыIs;i}rp}}ypj|ZI }![4ʽ}ۋkllyf[rؘvs}{twœpksfM Wg3Rxffw  ˥tVAS?uJ Y} Q! I Hv&w|{`+}xTI+&!x}.H,}x < K ۳\w|{ jY zZ r*@ kQF! m e (QJz!( 1h hnQJ{!P i }qQPw!kkP m+q gr nQ4!P \P @QS!P TDQ m}Q0FZrӥZ^!"Z@\ @  + VR Y zZ Nҧqnr[ 8\ ] ^ _ ` ;S yLu~i$(yp ySHSOpkzu~zmnol\hhcd}|kf!e z̵Q h }ѹvy#QR$9`4=HY$6a33TH$)QRW?$ Y.? |uw}}wasfoe~w~{}}|hi k @ }`m n `o 1p Pv̽wN!Y"?~r|}lprosbxooe~Ma|s\thpiߚҌyvpgfuZ6A{t~Þy}O~|xyh;~s}y}kx,q gr 3޳oJT U V W 8zt1s t .v*Cv15zɋ‡yZwipXZ^9AG~otmgFEN(9Gkq|pċƊɫ~{~{aVk^XC,byݮ=} ԽP uԪ3 l5"+ǪzSnY[}X&yЍ7ZIK((1ȋ;L;s~uOգk,|'/+ {Yca{Y{}( t ͑ GP+GZrgK8xMg!i}\jyZt~wOOs i.C6CKwR:JB& k=‹6 0X ŬתQ h ] oi ԽO ] BP 0}UЋQx!H } }Y ccZ U[ \ <}Qi!} '] ^ _ }Q6!H( OM` m}Qp!(W} |R }~Q03,Ͳ3!%@f  @4  + ,a b 0}UПwUY ccZ \[ \ v_dH5JE\XJ ʋԋij.Ҵ׶ZX64ejcm_|_]1nXbɋhA#O["0bqN}It jzsًNj7|s+(~ c SZ[jZk+)XOdMvj/@Eo}ĜԖ&Fd}ű¸sw0:Jkte:Q̋ (ۊ^y?melfnCC9{{ --7<}i] ^ _ |s}v|mr^eioum^׷{]/O[Wecg #vbdaHny|0wwq߀N5c2ShmeccLcN{}Yk.@6[c|M`+=;Th͋͋z{{WM\p}|kn߀Q'kdhqͱ1ϋq\:C\`dŚQ}^f g v{yi|uy}*kMlpjo}|~}| }n4K=Kn|sV'N3˜h i PTj k F!HŻra#EZxw^KiZluyy|nnn|ugwk}J^y~psWFa5:B! nFL9Jkt*⩎af7vĶ}n4K=Kn|(||iqo}|~}|}w5q[lÝb@'@dAy Jr}~||3@X&B}2[r)!2@(v?y@\)[ˎqEn~ pQ\M?vW NmBNыJYfl8ܸ4ξMH;%2A`5woG:G(JwfecmNmso܏$.'zbЕw,al m n } _o p q g²ө+zyyyyyyz{Vhz{kv~{rwusLd}{kyxrnigetJdVJc3f:x89@MZKkϋvvpkZYsV\p|}܎YCqqH}c d %l9e ԽP WQK!P~ w4P ԽO ] BP Tv:-KQfQ0O,%&h7}umtg+afDX:myNm{xx +laX4y >XS>q<fRQV[\3m?abɋ )v/Kg1" Rwx3J_twZAЯ;=.݀WsnSI|՚i)brQM /@Hbej[svxsne^}~szsVhr|ctigeou{z{zto~~Yiw}ƈjNfj{oxiq{iiy@wbrx~~rwtp{{cdw?`vqzYHs;0;cɋ^ŋȋv9) sV'N3˜h i PTj k kf-;a N ^e kf黧p , ] (e wXܰpՈ\oO4uhwW+Mbm?*{9}~sn\dyYoAËky[}[jtZt}w_wZ޹I7;櫱-V;\D pS l}N}udL[VL [ɵzuSpIY]ok~rx10toam}Ρ|{{W:Y=*#*}{J*ݖjz { | hi hꪺj ] Zi D\2j wFod1r d<,U 4s a{Y{}цw}\Z> lbVuotwo]usrj`ysNj``t~}\X}\jyZt~ċ=2=}jp[r Xċ=2=}={Yja|Y{}rgQRT{YdfY{}{}]X|[|yZt~wcuM{QR~`luat~솦ٳpՖ̋WYi[ttZt}w_wP@MVm?6{9}~snhdyYoAËky[}[jtZt}w_wymz[-;C t hu ꪷ-I;M v `j謲Aw hx '`ثp&4s-q}߼㚋w_X{Yt\a{Y{}y}\X}\s~Ys^X{Yt\a{Y{}y}\Xp}\r{Zt}Y zZ Sاv$(;G}Hhf{srsaW|{|{|[V|[_yZt~y Nҧqnr[ 8\ ] ^ _ ` ;S γo},Qt`~}\X}\xYhc`nqY|}Hxq}߶㯋k,q}z ߶j_X{Yca{Y{}цw}\Z>ta^kf!e ymz[{ `| } (~ }Խ`vU     v ꪲLALw R>v ymz[gt hu wG޳owNj``~}\XP}\jyZt~w_vX{ s a{Y{}цw}\Z> lbVuotwo]usrj`ys}`m n `o h }kx,q gr 3޳oJT U V W 8zt1s t l}N}a yݮ=} `j>x uԪ3 l5"+ǪzS@@}@X'yЀ7ZI@((1;L;svO@,|@/@{Yca{Y{}( ̀@ @GP+GZgK@xMg@̀}\jyZt~wO@π i.C6@Kw@:J@&個@6 oި,pEkcX{Yt\a{Y{}y}\X}\s~Ys^X{Yt\a{Y{}y}\X pcs,q}hz p߶T= oި`w_X{Yt\a{Y{}y}\X}\s~Y^X{Yt\a{Y{}y}\X}\t~Y^X{Yt\a{Y{}y}\X `oި,pe^X{Yt\a{Y{}y}\X}\t~Y^X{Yt\a{Y{}y}\X p_s,q}hz p߶kcX{Yt\a{Y{}y}\X}\s~Yاo7J5&EC!id:y|[V|[_yZt~$(;G}"ؘ{YcUdyYoAËT٧vy ] Q"i SاvJ5&EC!ieǒ]{Yca{Y||{|[V|[_yZt~$3;=}}p}  ܈z }qrSG?\83FW8s=Xf}\jyZt~w_vrjjj""\Gm1"1#T7Rv{Yc`|Y{}{}\ymês! O K`}[fi~h_/qhoeVo[z|ŲɧꧬGkt|\kyZt~w_vX{YcaoejEH, {xLWA~}DGc\vwqfۻ{p}\wlt@q0IQq6xNVЋhScYu~~|yh;LuC\t{zw]|nfGDbo.)` VLhyO{Xq}}~o}pmZwg{V{ԋɟ͚X@xoċŎxfvj{qkjdqmmi)uidb\\v#\wsx6~|bo~Puojwl5{~<wdzPxdebxx{~}n\cpv|s}~jxyui{~onj{~onj{~z2+  XF?MtAuC[ɋߋ͠џeOwlW{W|[n_bb™R`rwHyOPet2"{|~x֋͡ѝwLe]o|urjxlBO0u_#htpvM{|vvvoo#uD'tMrn-rv~ywqr{jzh}\s}m`t  vu1y~E'5~YR>zbЁ,al m n }l [ tz } } sV'N3˜h i PTj k zbЁ,al m n MJxMSƋËuwyr]zvrqE?Ot@}  [vde2ܫugz{pV.da}wr[1{|~"ЎJLSdr}~nJEZZPQDpq{wxJ>Dmmi|zzr@iV8 xگߵ?  Y zZ wi簷G0b &c dd }sV]q] f  Yޮj1" Tyb &c 4d Tثh2V2L zo  ;j)A  Tb &c 4d NvZsV" v _  j̈́  R-b &c 2d JeֵJeV~  u]J  d֮j"d Tb &c 4d W$V* g  kfԼpf:5  %g " e b|J ;D΅ 6 D #g bt $TƲ*XL @  @ @  *S "g@ " Wh }i0J l Y1" Rh Tش Z 2L I I ] [Ph }W4 +  ̈́  pdh q^Ƅ^'  d W{Q% _^h Пߴܲ(  " hJ |MN ti ^V lY;Hg|  H 6 [ hꪺ-n;- *? ] ^i }Y;ҌF"3 L7 +  -;M ,Rk v="Q!%   Y1" k T=Y2L B  ;>V  ck N =" +2  iY1" =Ql .T^2L P iYѼ ^" `=Ql .T^׮$R &zL H i;:R  ml .N4Q" P idخ$3d l .Wa* `V }诲-I;OM `m n `o }ֵQa!r += }诵?}" `tm n `o }ֵV  Yנ$1" 05m Pn 0o Tֵvv2L >g 1Ⱶ" y1p }ֵ ' 1Y1" 7xp Tֵ2L WV 1;v  p Nֵ" F 1dخ`od p WֵM * +N }ĝ kopo* $7 %Nq gr }mĽ;#˒3 Q.= "> ? j6 K }ĸe33jJ7 ] "Vb Ȁ%Nq gr }mgw @d + = "> ? Āj6 K }ƼTpf{5 "%g 5q gr } ;D΋6 $paݖ" @J* 0+Iz s0{ 0| } Ċˈp2{ ">* r1 ı Ȳ }{J*֫Y< (8"  # Pz sP{ P| }⹰4Ċs̈m "_d4 f  ı Ȳ Yש{J*ҭ;9ݖ@" _" Zz :{ Z| Tػ}Ċˇ L d b d yݮ+Bi" "U}  }3(% L yYݮT1" T}  Ta2L hv y;ݮ  _p}  N0"M" hf ydئݮͤd }  W* pVn R׳f1 ] ~ X + +  Jf.N q~ ^V H|  H 0 dϳM\d ~ We8* N }ĝ Aop* (7 F~ }mĽ;wj B3 Q.= $> ? : }Ѽ46 ] (2 u~ }r + (]D a i D }VZh| (  @ YZ1" l TZ2L  -;(M ( Z}Y ,{ U -;M ( Z}Q0!Or 2 v ] 2 Z}8  + AW "  Z}%] $j YZd1"  ZT]]2L - 欸" 1 }Q塥  ĸ 欸X ] * }QM[ +  ¸ Q謺&d" O ƀȧÄ 6  ͻ z̵E G rieWz{  v"  zY̵v1" ( rTĿer82L > ^ z;̵1  l rNe{" ;W [ N" C9  } W,g +  Z}ԧ 簚/   ƀѧȧil  @Q @ @ }Ƨ6DGGGGG @? - M      Y&E " Y zZ TWڅG ? @` ~      Y7ۯ, " Y zZ TżПڅG=NȐ H {L Ri$ R b R b  kYfu;1" c{e bT׽J0\2L v# 3$ kfrpȪK @T e b|J%0&"H +1 3$ kfE i Ce b|JV S|    K 3$ kf$X4@  @ ge b|J3b;UD+3 (Z I 3$ kfx4`$  o@ ge b|J3b;UT |6 X I 3$ kf9$u0   ge b|J3UDȌa ZN I 3$ kfR  4 ge b|J3mU>=y= > ? - @I 3$ kYfu$E B" xc{e bT׽JW0\~ lL s# 3$ hꪻ䴒 uqi }I@Gff0fs@H h hY1" i TlG2L tb [ Y׮1" Aq gr Tةj*2L tZ K }󯰠ǴK q gr }00,("H  K }B}4  $@ rq gr }3b;UJ13 $(Z  K }4` "o@ rq gr }3b;UT6 $X  K }9BB " rq gr }3UJ˃a $ZN  K }Bp $v4 rq gr }3mU>7 = >  ? "- Ā K Y׮E Z" iAq gr TةWj*u lL jZ K }-;ݠnM s+- nr }۳QK! r %. Pn }-b;ݠM 3+- nr }۳YՕ{ .. Pn }󯰠ǴݠK u- nr }۳00,"H . Pn }kpݠ(i G- nr }۳V Y|    P/. Pn Y׮ݠ1" - nr Tة۳j*2L {. Pn Y׳1" ~ T  2L :V }欻v t~ }0"H L }ٴo-;]M 1/ 0 }۳Q!r 1 }ٴo-8;M 1/ 0 }۳YC{ 1 }ٴov 8/ 0 }۳0"H 1 }ٴoA; i e / 0 }۳V| (  l1 Y׳ٴos1" dpM/ T0 T۳  2L 1 Q謷-;vM  ƀYȧ]{   ͻ QY4r1" Z XƀȧPz^DL z@   Q謻: 5+ ƀzȧt0k"H   ͻ Qi  ƀVȧo ;|    ŀu  ŀ 0}UЋǤ" K v@>Y ccZ V[ \ 0}UЋǣ s s @Y ccZ S[ \ 0}UЋǠY(,99 @   @^;Y ccZ Q@[ @\ 0}UЋǠY(&9k@   @.k;Y ccZ Q@[ @\ 0}UЋǠQ7,9!t9 @   @^;Y ccZ Q@[ @\ 0}UЋǠQ7&9!zk@   @.k;Y ccZ Q@[ @\ 0}UЋǠ ٻV^99 @@\ @ @  + ^;Y ccZ P[ \ 0}UЋǠ ٻVb9k@ʔ@\ @ @  + .k;Y ccZ P[ \ V(J Y zZ  || ,Y zZ BY(Ռ ( T *Y zZ BY(( P *Y zZ BQ7!I ( T *Y zZ BQ7!( P *Y zZ  ٻV  ,    b+ yMY zZ  ٻV ,    `+ CMY zZ <}ɤi&%l&@wiiqwt{ #j@ @cjs^׌N@@D] ^ _ <}ɣ ip!@ Vp] ^ _ <}ɠY(i> Ա @; O@] ^ _ <}ɠY(i901 q @] ^ _ <}ɠQ7i>! ű @J O@] ^ _ <}ɠQ7i90!1  @] ^ _ kԤۧ9J ݦe k oW e kY(LՌ    `"e kY(L7   e kQ7L!I    `"e kQ7L!   e }ɤ6< v@` }ɣ 6s֌J4s  @` }ɠY(6p9Ǻ9 ~@ ( ` }ɠY(6j9kǺx@ ( k` }ɠQ76p9!Ǻ9 o@ ( ` }ɠQ76j9!kǺi@ ( k` }ɠ ٻV9<9 @^    0@+ ` }ɠ ٻV9k<@^    0+ k` /J h ף sw4w 32h Y(PzՌ  ) h Y(Pz ( h Q7Pz!I  ) h Q7Pz! ( h נ sVw ,   0+ hh נ sVw,   0+ Jhh m}̤'@ R m}̣ #4@ )JR m}̠Y(Yda囟  ) dR m}̠Y(Ta ( R m}̠Q7Y!da囟 x ) dR m}̠Q7T!as ( R m}̠ ٻVdZ囟 \    0)+ dR m}̠ ٻVZ\    0U+ R m]/J ?i j& swhw i hIY(P{Ռ $ R MVi hIY(P{$ P Vi hIQ7P{!I $ R MVi hIQ7P{!$ P Vi & sVw ,    a+  yi 冨& sVw,    `+ yi Q}Ǥ^$k v@f g Q}ǣ s Js ;@f g Q}ǠY(]9 뺱@ ) Āf g Q}ǠY(W9(kDZΔ@ ( kf g Q}ǠQ7]9! 뺱@ ) Āf g Q}ǠQ7W9!kDZ@ ( kf g }`RkP/J q gr }) ywkhw *q gr }LY(VwՌ 8k$ R "q gr }LY(Vwծk$ P q gr }LQ7Vw!I 8k$ R "q gr }LQ7Vw!kk$ P q gr }~Ǥ  v@a b }~ǣ sJjs 6@a b }~ǠY(9Dz9  g@ @ a €b }~ǠY(9kDz a@  ka €b }~ǠQ79!Dz9  X@ @ a €b }~ǠQ79!kDz R@  ka €b }~Ǡ ٻVF뺲9 y@f    + @a @b }~Ǡ ٻVݔFk}@f   + @ka @b & ]h P IY%\$ H ۺP IQ4\!$ H ۺP & ]Vw,    `+ P +}ʤ[ Ǥ[yvF v@ o p q +}ʤ[ ǣ [&slJhs @@o @p @q +}ʤ[ ǠY([9Ռ DZ@e@    o p q +}ʤ[ ǠY([9kDZ@_@  k o  p q +}ʤ[ ǠQ7[9!I DZ@V@    o p q +}ʤ[ ǠQ7[9!FkDZ@P@  k o  p q +}ʤ[ Ǡ ٻV'F@9 DZw@\   + ( o Hp (q +}ʤ[ Ǡ ٻV+FkW{@\   + 0k o Pp 0q /תuJ Q  |rh yEQ Y(YR $ Q  Q Y(YR$ P Q Q7Y! $ Q  Q Q7Y!$ P Q < |Vw ,    `+ {Q 2 |Vw,    `+ {Q 0}UЋYf Ȧ YY ccZ V[ \ 0}UЋQ;! @} V Y ccZ V[ \ <}YiSBB E@)] ^ _ <}Qi{!|} '] ^ _ }Y6fY( YO` }Q6<;!$@  M` m}Yn-o0- ҀR m}Qf!(f} @R Q}YqfY覀 *Yf g Q}Q;! ű(@}  }f g }~YfY{ %YXa b }~Q;!@  Va b +}ʤ[ Y[ foYy Yo p q +}ʤ[ Q[H;! ű@}  o p q 03UЋǤm)"@K  O Qm@Y ccZ )[ Q\ 03UЋǣ m)s s RO Pm@Y ccZ ([ P\ 03UЋǠY(m),99  @  n~O PPm@Y ccZ (P[ PP\ 03UЋǠY(m)&9k @  =O PPm@Y ccZ (P[ PP\ 03UЋǠQ7m),9!t9  @  n~O PPm@Y ccZ (P[ PP\ 03UЋǠQ7m)&9!zk @  =O PPm@Y ccZ (P[ PP\ 03UЋǠ ٻVm)^99 @\   + @n~O P(m@Y ccZ (([ P(\ 03UЋǠ ٻVm)b9kʔ@\   + @=O P(m@Y ccZ (([ P(\ v3VmAO RmJ Y zZ v3 |AO xm ,Y zZ v3BY(ǒm AO m! ) @*Y zZ poY(e  (r O @YNY zZ poQ7$! QC *B O @YNY zZ poQ7$!C (O O @YNY zZ poVy Q     % O @YNY zZ poVy     $ O @YNY zZ b 6p̕8J eO iJ` bɣ 6zͻc O dJ` bɠ Y6ͻo  e @t/ )O bJ` bɠ Y6ͻ u/ 'O J` bɠ Q6ͻo ]!  @D- )O bJ` bɠ Q6ͻ! E- 'O J` bɠ V6ͥo @ @ @  )O a J` bɠ V6ͻw E      'O a@J` pyhJ (O _h pBժ k  O _h zpBY#w* 6  e @O d_h zpBY#wA  r O d_h HpBQw! 6  B @O d_h HpBQw!  O O d_h pBUmyw 6   @  O d_h pBUmyw    @O d_h +pʤ[ [`V4@6J O u Oo v p u q +pʤ[ ǣ `@ J  7O rPOo rp rPq +pʤ[ Ǡ Y[`ʹ ռL  t/  CO qDOo qp qDq +pʤ[ Ǡ Y[`Ռ|  u/  O qHOo qp qHq +pʤ[ Ǡ Q[`ʹ ]!:|  D-  CO qDOo qp qDq +pʤ[ Ǡ Q[`4!  E-  O qHOo qp qHq +pʤ[ Ǡ V[`͋w      CO pOo pp pq +pʤ[ Ǡ V[`ͼ%,      O pOo pp pq uQ(jJ *O TQQ u\ܬ>> O QQ )u\Ywʪ  $e @O IQQ )u\Ywʪ $r O IQQ u\Q !U  $B @O IQQ u\Q !U $O O IQQ du\VTwC      "@  O DQQ du\VTwC     " @O DQQ 0}UЋǼП5 M !"Y ccZ S[ \ 0}UЋǷj  Y ccZ U[ \ 0pUЋYD>@] HO R Y ccZ *[ R\ 0pUЋQD}!@} FO R Y ccZ *[ R\ 0}UЋV!x@n    Y ccZ R[ \ 0pUЋV&@ n @ @ 47O Q Y ccZ ) [ Q \ -# yY zZ >. Y zZ nY {Y zZ gQ! Y zZ 0|# IwJ =V`  ` a VZ2(p H ( 1 + bY6͘d' P<O iJ` bQ6ͻx!W  :O jJ` }V6Lp $  4>` bV6gL p    +O dJ` kY77 ^e kQF! m e /Y;z( :h (QJz!( 1h h *ǠY( P   *ǠQ7! P  Ǡ ٻV  (  + m}̼Пeʲ\6Wʫ: '\@gR m}̷<@\B0Y@@ R m}Y?FZrӥZ^"Z@e @ + VR m}Q0FZrӥZ^!"Z@\ @  + VR m}V=*hlKn (  hhR m}VFZr6Zr YZ     $S + VR hꪶ]3 i hǼPh Mhi huY;{P i hnQJ{!P i ǠY(P   ǠQ7!P  Ǡ ٻV  (  + }~ǼПj㖲Rjl 4a b }~ǷlF8 Gsa b }~Y?3o,Ͳ3@o  @W + ,a Āb }~Q03,Ͳ3!%@f  @4  + ,a b sV'NǤ3˜鉺@ v@h i ۀPTj ۀk sV'Nǣ 3s J@s 9@h i ٠PTj ٠k }~V!S߲ +@x    uGa b }~V36F,Ͳ38@    S + @,a @b Խ/ P Խʼ": P uY%P MP nQ4!P \P 8z& stk2 s t "Y?o՚ hW + .Q0!A h4  + Y  +pʤ[ Y[`~@ jHO u Oo v p u q +3ʤ[ Q[)mH;! ű@@} 5 O tmo u p tq +}ʤ[ V[!߱)@n   @T|o @p @q +pʤ[ V[`Mi n     @7O rOo sp rq }xYAwծkP ^"q gr }qQPw!kkP m+q gr GYDRP EMQ @QS!P TDQ ŬתQ aQ! M ++ $G[!$$->s> ->s> I M! oM! M!y}j8 % 0ǽý^]M !M <-6 VMq  X -6A 5 nM  9 n: : Y7.p"  p  p YY9w$&7 .  . ^  N  ^  pj S}8 } 8 x8 }  p8 x8 x8 xP|^g# {P|!g# W# GP|g# W# W# )Ukɭ{ dUkɭ  Ukɭp   \ \ }򅭰E򅭰[ "p! 1p "p! 2}BL짮)S T U V p "p! 08G k\ }LL~LL)S T U V ES T U V ;}LVW "p! "S T U V :}򅭰LL)S T U V 8p "p!  P|g# W# W# W# EŤ8=3p2q70ً{@zrɋy5wHwIj5NIҞɮŋ]Vs~z}iuyvk!{z~zzzyzvzybBBŌo/`|{ե擥nror{|7iBP'HNald}{m\s׃xMuCSwW}>,zSnoigudzĠByRkgopvNUs8wJ\ԋًٝŗOwct|hjRv_=Z C٘ ʨ pzpnjqlvPv9BGJzU~_k}jf|YvGillogiJZe۸РkPLe5 Vrr L# Q Y?Q A 2 @3 )ModeYqu}{m|i~zug |z~vhl%z{~HŤ]@8<3p2q70ً{@yr w?4@~\iZ~w}p]-~bqq{s|d:tq~ewL8~zyRH m͑I!}rt~z{PJ *#*6>5?$e\  ) 7 'T)?$e!n e  ) \L6>M  xl [ ӆu>B @ 0 $ grvE}t %F..~wfX^_wz}~{es΋܋ˋ؋ynwxmprm,u 9͋xcjw{s>.}} 'ӪT xj F Zp Pz} `  wh +y P ŬתQ }C\((g WD!8+G< g=f{}ouqiv|lWmt~\$k"a6 j  ːzWl|viqxorlakXk 1_ߵ  AY zZ hi i i 솨*i i i o@ i  n2i @ /ni i @ ni i i @ nlP ~'i 6  nlSi P Mnli i P i,l l}N}a jMMb &c pd }`m n `o }l [ }l}} [ % [ }l}}b [ % [ % [ }Tb !t [ } }TC [ h; s}T}( [ % [ h; X}T}}`y [ % [ % [ h; c}TQͥQ} a  [ }Q} и c}TQ [ T d H}TQ} [ % [ T d .}} 3|  }sV  }ֵ   )wX:PRc؆~c>RRPRjɣ@.jes[a 2vXyjRR>ĖyMs[egi@{{z.iYMV 2vwXhjesPRc؆~c>RRPRjɣiYMyjRR>yMs[egino|9;8~8;9|oȒȌɓȦ(j5Yy݋ۥގ~8q;9|oypȄ\MN)^'yx݌ۋqqދی݌yypNNZ{z\MNp('xo|9;q8ޥۋ݊yNNZ{zpS9  S9 F S9 w Vrr VxrS?Q^gdv^Murv_[urvcg\9 g\K|zK}r*@ &8 &-9 d  qp8  qi9 (   (};nM 8 r@  @ r@  @ r9 L# ,9 "Q Y?Q BvyP 7BP Bvgy  L 9 P L 9 R r*@ t*p f f  x V3 i<  K2 x 3 l= 6`2 V[x~r\3 O> ? @ *$2 'Ifcx3 pA B C W92 V~x ^3 D 2 |Mןxf3 G<E xF C-2 x 3 (G R2 ~xdz 3 rH I OCJ 2 evΧxBs3 K QjL Y2 O|yux6oz3 e: m; `<  K2 鈤x 3 i< 7<  K2 ?unx'j3 bl= b<  K2 V,[nxr3 O> ? @ HV<  K2 yI1cx3 pA B C Hg<  K2 V,kxT3 D P <  K2 |y驂@ןx(fG3 G<E xF Po<  K2 Euxp3 `(G <  K2 ;~p)x'dzf3 rH I OCJ `:W<  K2 eD̡wxEB13 K QjL P<  K2 ||nxo3 e: m; bp= 6`2 '}#@8 `j< }}&8 pg= -V![[rѸBF8 \> ? @ I&XcD8 cA B C /V!~H8 >D Z|nMf˴Bs8 TE xF }?[8 5uG y}dzNj8 ~[H I OCJ De9UΧB̥B]8 0MK QjL |n#uoA8 r: m; 0< y}#Q8 `j< `7< }#un8 4g= Hb< V!#[nrѸ@8 \> ? @ $V<  I&#cA"8 cA B C $g< V!#k1A8 >D ( < |n#驂@f˴@8 TE xF (o< }#u8 05uG H< }p)dzNj@8 O[H I OCJ 0:W< e9#̡w"B̥@8 0MK QjL (< 5|n&no@N8 r: m; 4p= }xDG2 A}x@3 J  )>2 8}ֵx c3 H c2 A}ֵx l3  c2 }xm 3  K h2 ||x3 29 Ir  /2 ||x3 1Tp   i $2 zx ~3 N Mn2 Y}x%Ċ 3  ı Ȳ 3%2 b}x !3 i %]2 7}x 3  ^}2 }x 3 ( 2 }x 3  2 }Qx13  ĸ X2 ƀx)h3   ǻ 52 iex3 s'  32  *j hi~b~baieev>__ mRySzbfٹǿ@l  ! 8 Xw} X 8@ A} G{ Z vzwtvlvxkv}|zx{~|yt{x||vwuzyv}! 8   @ 3 = 8 >_L_ RzSzbakǯpl Np{.p pNp p !p  p @p } {p  !p p p pw~v/p Np p p @ 3 g= pp{y|k unn`Q Y?Q yM 8 M 8 # 6Q Y?Q ?Q Y?Q r# Q Y?Q ?Q Y?Q ?Q Y?Q +\   ep`o (Ⱥȴ|häwqϖPttth  t( `y  t   t  r4Jr4 "Ep* Ep!@ Ep  qh  qh qh~yqh p$ epoNj (ttPҖqwï}x~Ⱥ"woزtxzx~}~noif~ppwniz%lNHKpZvzjpNjwuu%Aoouo%hZtnw%UmzhlyyrnznoQ|wew{}}}}mQ #}fOTol~qr{[r|yxbX{ \)ȋr~ksnktxxZq 'MCjqxm{utnssnOkOGS@Ib|qs:_|WIKy{yezmnu|qS<I|}ps $ehc}QwwaV ϱmp+|llAQY\<}͌~|*ixS`Y}wwxwsd\|Ë+jێiiiݽ)tu}}_`fXyZ_TK ,'iԿ܍xufn l ~ϱn{c*ttx{؎EHk{wgi3ۍqo}wEQA%FUt ~ϱn7s}zx{Ǔ~T[k@t{myADUt<}͌~|*ixS`Y}wwxwsdËվj/މ%𒝟puzvxWϱkmwy~"`J )` fn h` {c*ttx{؎EHk$`"` $ ` d` Wϱkmr$J * fn h %u5s}zx{Ǔ~T[k@t{myiVyZ_ e $  veUU}etR|}  쳉1foҰ{uzxzpxǍvymp ŋQ`B6:fg.Hlg(nihawq}unsuuӽl@6Zru(}Bسehq>ĊOCs._}FVGwmhB @ @ɋxG[{}!@ @ @  @ C@X@68M=XZuB\  bY zZ }7ݒp\  [q gr }/H\  9{vrmvo{| )3  U${|Xu>q1~_[0L &)<˴(.$280^ `Ϣ{w{thqo{ux}[-[; F G/lk; Wߴ|v PTn{Z_|flA[:fg.G~f" |||ËkW\puzvx%ws}zx{Ǔ~T[k@t{tWߴ|h T  |! " vQ# " ٴAph Ë l@5[˴ru}}^`fXyZ_|llA[:fg.Hlg(iRawq}unsuu||vO%ws}zx{Ǔ~T[k@t{tt K8:fg.Ukg(nihawq}unsuuӽl@4\puzvx}kNCx#DdyYoAËky[}[jtZt}w_w["Njqt!wd}u˳׭ts>JxGus|{~u|w zdJ4V4b{khw{hpU|cbd ^ FvU,=iR  L Duu~au{x}lusmzupx{TbrWjTzgsvɋSsCd %5fliE|y搽㋼~}kΏ}hc}UifhhlwS*ښk2 &yp{efwy˩ twvwoḶĚTW8:TWB}ZzTuDWr~|zҋ9t?yQqhJgp|tml{~w{nu-]3$ % & ewOg @q؋竱ɬ̩웿UhCXșⒽ=LM{v{~wq`V=}cr{msl$}Z}aKiYuz~~RxN|Zqjqzx~upcnѹ벒k ! qyt΋¨ ɋxG[{}  R  X@68M=XZu1}@[?t◑ojqm[k@\\ɱkmp{P~|*jDz`nxolAQY\<}͌~|*ixS`Y}wwxwsdJ|Ë+jێiiiɋlnoV^otjaZrek;X,i܍{|}ջR.rzrpkmazwx>zSbŬz{el}m~>zSbĬz{el~m&|~}}{~tRХvv8쎸M@MGf^{wzu}̋.tAuC^VNgr|nv}~p{{{~{ǩoBଲۜL]x8rppmazwx>{W^zelmgrvбx~ !.bo._nf\V_wz}~{esŋыˣؔrwxmlrq9$9ŋcjw{Hһ l=}{;diDw{z~|ȕՋ؋wIaUOg[]ﺀh|vqqe_"EAYMJ4Ozإ37"G]1NZjko'Z u p`]|dd|[}~:}^[ktpmrmmr}p!kyA  }п2 +g g + OxWያ6o0r:3PA<`ѥb~bVq{s|di䚺UdcSv}\'j{[q<.qyx~ipvzǎNj̋ŇnebrhcֲyOA'SY{Vimw~gtr|s~~{yvqkuCqg\pp|Myuy}{ʥ˩Ҫvu~pvḱ̕mPNCOmeoe4vVXwХБ׋TG)z}ѱ`g=ڽ׏N[Qy93SaZ{v}}w}wkXxT|qlDwJk!>bA~vӞҾ웿{zye[~}g}fKiYuz~~RxN|Zmjqzx~vpcmѹ벒kALS^b",^+h 59K~{yv|.}x08fgqtlr}m|nv~f]yQ{VXbWPwǞʝǪVF?+]t?s<]\Vq9ar9q6OڋԩkX_gә]}\zSubXh2#o0uCUˋpz}eZt˞ȚNjϋGr8hRI[[SS-PyΕ ]1ObrWyTzsy,u|x|nuumzup{{TovɋSsCd %5fliE|y搼㋼~}kΏ}hc}UiehhlwR*ښj2 &yp{efwy˩ vutsvḶĚTW8:TWB}ZzTuDWr~|zҋ9t?yQqhJgp|tml{~w{nu-]3$ % & ewOg :s؋諱ɬ̩웿UhCXșᒽ=LM{v|~wq`U=}cr{msl$}i}aKiYuz~~RxN|Zpjqzx~vpcm+ӻָ벒k JxGus|{~u|w zdJ4V4(bt{myADUt) ׏w-ko 3-𒝟puzvxt{myADUt) ?d}yݑuu!`̐ynnpr|]Ϟld[1RC,p رtaπ 3-𒝟puzvx׀5Perpg9XHaST_nix˳̰r}gtImQ[i8-lqgP;CB1~4t{myADUt<}͌~|*ixS`Y}wwxwsdËվj ~khJu$𒝟ru}}_`ADUt) ֏0foҰ{uzxzpxΛǍvymp{ituwb|}[aXnjazQtcg^s}ul~xxҋ٪!l{wgi3ۍqo}wEQA%FUt $~b jQ#  | Mt{tt K8:fg.Ukg(nihawq}unsuuӽl@4\puzww#vHnQ[i8-lqgP;CB1~4vG$6t{t <8:fg.Ukg(nihawq}unsuuӽl@4\puzwv!wd}u˳׭ts>JxGus|{~u|w zdJ4V4o=E5t{t @8:fg.Ukg(nihawq}unsuuӽl@4\puzwu!wd}yݑuu!`̐ynnpr|]Ϟ֋ld[1RC,p O΢lwhY6:fg.Hlg(nihawq}unsuuӽl@5[!ٴ`Aoaq]l:g.Qlg(j`nx>:XķËxu6fvyZ_|pxL[:fg.Hl `||Ë l@1_͢lxi } }l [  >`L_ RzSzbakǯpl Np{.p pNp p !p  p @p } {p  !p p p pw~v/p Np p p @ 3 g= pp{y|ep`o (Ⱥȴ|häwqϖPttth  t( `y  t   t  r4Jr4 "Ep* Ep!@ Ep  qh  qh qh~yqh p$ >__ nQySzbfٹǿ@l  ! 8 Xw} X 8@ A} G{ Z vzwtvlvxkv}|zx{~|yt{x|~|vwuzyv}! 8   @ 3 = 8 (][ a* &+ r _, <- گw4. 1d/ 0 1  2 o03 iQ4 v/-ڄ5 l6 {7 J-8 x9 {: ЂdV8v; cn< = ѱ> x?  - n;w5@ m:wh=A P0B ^vAC 32ƜD E F :oG zŤH yr I ~J  K viL  *M ~N ,}O vP }٘<* ʨ Q v9 #tR X:S 2ƜD cT =vwU ^ۯӯtV W =vw X VpN!Y =+ &mLxZ 3[ \ p~w] :^ 6{L-p_ l9` pa 7b l8"c 3dd de 5sF4ٙ|Jtf g D0h  ]Ad i Ȉ>98j dHk f0RBl qm <}pn `o `p ЕvJ ` v`Iq r Ts Kt /gu )}{`kv `w x ,y y~y~z `{ <}|  } F䫡wf a} iv2e ~   vȷ }  N; P K n9 :po M 9 ">T #l< VV >?eQ ) RRw ?# \> RNwKf o a騼 ? ?O nvXe>K  ;&Ln迄  p   GPw N : a, Z PUw $wi D  vY Lh xl F/ #  /"Seg > e4 xT!:n 6CX u @ ,r yv{)W ?SV $ݣr ]S J/}; NC J/}r; r@  @ =3v]o  g(F,  s=¯l@ ݇#|zgmjgov͋+h1?0 = yPyge`ZK88RPTkzyh|/\q'لwsxRm85z?4-U;'ٙ F @ff sg a騼Y/] 8 ?O \8  Y7.p"  p  p YY9w$&7 .  . ^  N  ^ {,5* &+ b 3, <- %wگ. 1d/ 0 1 /w|2 o03 iQ4 4~/-+5 l6 {7 J-8 x9 {: -nL8U; cn< x= ѱ> ?  - ^@ ]<A OB {) cC |2D xaaE ,5F 'i@G !5ŤcSH yr !'lXI !'~J !* *K !3۳iWL  *M !1twN !,,Q[O !.P !2٘ ʨ Q !:$fV ,R X:S D cT W'DŽU {KӯV W W'X D,p"Y =+ QtELZ 3[ \ 'jI] :^ f'{L-p}l_ l9` pa 7b - c (d de f'z?4lٙf |g ;'D0u]sh , ]8zi '>9 7j E'rNk EROl 'xm p'}DXn `o `p G/. ` /~`q r ,s Kt _'g#u  }{4Dv `w x ,y 1y1z `{ <}| %/} $䫍:@ ,5L} -e<~   Q+g ' '< |'i  8B 'D@ :o :Tmn :@Vs u** )?e%) ) 4+R>al ?# ;&>i .*R: o B&騼զ ?O L$Cp3  LB+  p  A$G<gj, &kNS : @5“ Z ;$PAje$ $fi* %D( A$Dp- *)L< xl 6#F  #  ]S9 > E$4h _(Tz! q&6C :)u @  +S -f  $ScȽ %ݣ :$Sk 8}Ȣ |N 8}[F r@  @ &ؠ1  F  H=¯±l  / f'z?4-7;ٙ  NZf sg B&騼Y,@ =% ?O E\  Y .p  p  p YY%& .  . ^  N  ^ {%1* &+ b , <- %(گ uL. 1d/ 0 1 6$2 o03 iQ4 ~/-95 l6 {7 J-8 x9 {: nL8; cn< x= ѱ> ?  f- ^?3M@ ]>UA WB { 2YC T2%D x E AF 'G !ŤH yr !I !~[J ! OK !۳iL  *M !(N !, O !. P !٘B ʨ Q !$ yR X:S J%D cT WR5U {ӯZV W W8X D'p9Y =+ Q$tE$Z 3[ \ j] :^ f{L-p_ l9` pa 7b I:c |d de fz?4ٙf |g ;D0h  ]"i >9j Ek EQRl Q m p}n `o `p G ` ~`2q r @ls Kt _gTu  }{v `w x ,y yOz `{ <}| %}e 䫍 } ev~   QJ a  | 84 Q 'r :4Q :VT :?] u ?e ) 4R> ?# ;> .R:~ o B騼`W ?O LCp3  L  p  AG< Nu : MD Z ;PA iQ Du AD *L xl 6F #  ]S > E4m7 _T! q6C.p :u @  3 fo  SSn %ݣB :Sp 8P}-SS N( 8P}S r@m  @ &  F,  Hħ=¯Mls  / fz?4-^;tٙ p ,xf sg B騼Y ;% ?O N\NP  )Y.px'  p  p YY%z&O .  . ^  N  ^ {DV* &+ bV d, <- %ȯگ=. 1d/ 0 1 Ag*2 o03 iQ4 <~/-jE5 l6 {7 J-8 x9 {: CnL8.; cn< x= ѱ> ? V d- ^ߟd@ ]ޟA WB {G cC 2V]D xOQE DFrF '%0G !;ŤH yr !II !I~AJ !F FK !=۳i@9L  *M !?P'N !D,O !B_=_P !>٘ ʨ Q !6$ DM,R X:S V]D cT WIU {ӯ,V W WINX DDXpY =+ QħtEZ 3[ \ IjA7] :^ fI{L-p0_ l9` pa 7b Czc Hd de fIz?4ٙ,f |g ;ID0(h D ]ȟi I>9j EI.k ERl Im pI}n `o `p GAv ` A~`q r Dq s Kt _IgMu  }{,v `w x ,y ?y?z `{ <}| %AA}V L䫍 D} Ce~   QEO{ I\ I |Ie 8ԟ> '0 :ԟ" :T  :ߩ uYݡg G?@eG ) 4ER> ?# ;J>G .FR: o BJ騼 ?O LLCp3b  LOE  p  ALG<#} J'N : ~ Z ;LPA&L L"i{ KDy ALD#~ *GL; xl 6MFg #  ]S > EL4$ _HT6!& qJ6HC_ :GuLO @  Ed* Cf  LS %ݣs* :LS'A 8}^ 8N 8} Pr@c  @ &C'  F  Hm=¯~l  / fIz?4-;tٙ 0 ,xf sg BJ騼Y ;% ?O +\  Y.p  p  p iYY%&C .  . ^  N  ^ }򅭰 "p! *P|g" # ]\<0)$ I% p& ' xD( Z) S** }+ , yp- , yp- $=ؠ¿Ͷ㷸. / 0 1 gP|^g# 0A 2 1@3 I)ݟZ/4 Le5 F6 >t>7 D}8 \9  |o2: m;  < = iV[[r~1> ? @ IfcжA B C lV~HD |MfE xF G ~dzH I OCJ evΧBK QjL 2};nM 8 F&$N O LyP L# Q Y?Q L]~R X}LL)S T U V 7%`v B˸W C}{yX Wo m 冨p\9ex 8  x  1 !oƯ   I V 솨tEC~6^ .  v ͆MC~`   ܁0foƯ<   6"3@ 9U 3   !i 7 j\ܨ ^\ g\ܨFR  Jy Ukɭ{ Wo mx~~||Y E^a\h`s~@ }vqo9|]y~Zt~w_t冨p\9ex 8  x  1 !wƯ   I V 솨tECw6^ .  v ͆MCw`   ܁0fwƯ<   6"3@ .zδ< = '@Xs@u Yb  v@β\ | q͋궋w'Cʈ>&ؽ׌cskY)(4@33)^Y~lN=; @ʌ ϻ(0E-1ܱ*΀OUY_hZۆ A 9fn|x{YkeY{}&c֜Ykh4@"Y}peiyvx{}yvq>9Uy_x{}yvqn|x{YkeY{}ybYkhl ' ]%}_kh}peiyvx{}yvqn|x{Yh3   !i 7 j.æ< &8 j.æ r@  @ H DH < }^ 3  g]E}t  x ֽ3 H iAŬ &&G i (F,  M + Zbu ) c 5ӳK ) B& 3\ Z V~ >s> F5  c - 8 0Da &(&  L+  scQ7!Vr HW$GCGu  v b*@ .Ƅ  *5ӪT xj F d\ Y XIg "YI  WpY E/ m WiQ! "& m WhW " m WVL0Z P 0 0 m Wb" + V m W  & m %rEC~=&> vv . rj:UhY{} @a" 2 f^a\h`0πR@5@L@o9|]y~Zt~@*>u!o۷Ƅ+H'  i Y i 솨tEC~YՆ 15E )  q 솨tEC~Q!" 1X< )  q 솨tEC~W" 2X *  r 솨tEC~囪S" + 1@ )@ @ q@ ?m_@ #R@@{Ycb|Y{} '@=}]jyZt~w_t vv . rj:UhY{} ]a! 2 fz^a\h`0πR@5@L@o9|]y~Zt~@*>u!o۷Ƅ+H'  i Y i 솨tEC~YՆ 15E )  q 솨tEC~Q!" 1X< )  q 솨tEC~W" 2X *  r 솨tEC~囪S" + 1@ )@ @ q@ ?m_( #R,?{Ycb|Y{} '@=}]jyZt~w_t!" +  )Sp d m WSp d m )~П|  W m W~П|  W m m! ( m Wm! ( m !oQ!A*    !oQ!A*    !oWƯp*    !oWƯp*    !ox8 +!   !ox8 +!   !oWdԯ2$ %   !oWdԯ2$ %   IW<$ ; V IW<$ ; V K; 2 V K; 2 V tEC~ 1 )  q 솨tEC~ 1 )  q tEC~ļПƲf  0# (  p 솨tEC~ļПƲf  0# (  p tEC~O0 1f )  q 솨tEC~O0 1f )  q ^ktEC~V ! _  Y 9 ktEC~V ! _  Y 9 tEC~W䤤*$ 1` )  q 솨tEC~W䤤*$ 1` )  q 0foWäu  oD   ܁0foWäu  oD   0foʼП:𯌫 @  ․c Ҁ  ܁0foʼП:𯌫 @  ․c Ҁ  0fol勯 , ao   ܁0fol勯 , ao   ư0fo)& : 6 : ư0fo)& : 6 : [6"3@Wl * 6"3@Wl * [6"3@Dת 4 6"3@Dת 4 6!V8F (  = 9W  ]+ ㆨ!W`3 ^ !W`3 ^ ㆨ!" +  LJQ! dp Q! dp LJ r  r LJWɤ$ l Wɤ$ l v+β\ |  ]رkmhi$`] )` fn h` " o_ #xG~oQ[i8-lqgP;CB1~4t{myiVyZ_` d|Ë+jWݱkmpcC*$`] )` fn h`  i #䍽xuzvx`-t{uyiNyZ_` d`|Ë+j=d}u˳"׭ts>JxGus|{~u|w zdJ+V4ɱkmwyL]  fn P /2zQtcg^s}ul~xxҋ٪!l    H|Ë+jqu?P-kmrE2`] 5` fn t` 7d}yݑuu!`̐ynnpr|]Ϟ֋ld[1RC, +t{0myiVyZ_` r` ;i0#䍽xuzwuSg Wkx>.]oasW{H'iԿ܍xufn~|*njDz`nxu0foҰ{uzxzpxǍvymp{ituwb|}[lXݽ)tu}}_`fXyZ_|llAQY\<}͌~|*ixS`Y}wwxwsdn|Ë+j]kv e M  ||ËkW\puzww#vHnQ[i8-lqgP;CB1~4WcU%~v   ~||ËkW\puzwv!wd}u˳׭ts>JxGus|{~u|w zdJ4V4ٴ\ph T  p! VF P=jTv t{tTn{Z_|flA[:fg.G~f" ||ËkW\puzwu!wd}yݑuu!`̐ynnpr|]Ϟ֋ld[1RC,p WezCfh QiXyZ_|llA[:fg.Hl n||Ë l@6Z̽ru}etR|}6 . 1foҰ{uzxzpxǍvymp ŋQ`} }  } a HAw ,JMOu^|}Hxq}߶㯋Xk,q}z ߶rj;pkzu~zmnoC|$(yp yS{Y@ ۻKD1GB)idƞǒdpkzu~zmnol\_`Zshtv~i$(yp ySG}y{ƌĉ=2=}}”w oKMurwfmoSfut}ċH)dKEI_|}psqwqzu 2jiʹywGv ;GNj狹{fn`guv}~XsE*~Zxǧꋹuy{ktqqh؋I"u}”w}p}}~wcj_x8\82jiʹywo3eurwfmoSfut}ċH)dKEI_^o|}psqwqzu 2nl }”w6'eaX1j<7ׄh $j6>㋹|}psqwqzu 2p窃(9" :~;q ]o欳|jM)$+YþJygѨ֨D ȋjiʹywoKMurwfmoSfut}ċH)dKEI_ ϋ6v1#*ʮQ 1?ꥋҒ짜xwi%5 vI;Y\|B@jxʧꋹuy{ktqq{oI'uNj狹{fzltqqhI"uNj狹{fn`guv}~XsՋE*~Zxʧ(ks {pU&v}!g~@Bqzzqiodl < ض80Q(yRqv=xq`ԌޅxwRy/yiWQWU*-\h نoƧ}Ucrn능I=(V+twƐ(@WW͑2oB ړXlJf狛ZnvFV|[kyZt~^5'؋ 8rϘ貋Ma-|q-ڢbM@)E3m}N}a jj`*Q|i7FA%d"Rǔ(>WW͑2oB ړXlJf狛Z=/pb-*a|{[rLt~ԋꄞwONwRadVwz!{~{{[V|[_yZt~$ċmdj\C9aFߋ~l{}xvr|p%0.hf{sraW|wzxsf ŵ}{ܮN}٢Y(i+wj_b^yzsnour‹`4WF=}Ɔ|`daThL ? dNF-toam}Ρ|{{W:nkVk@+D 3X{Yja|Y{rgQRT{YefY{{}]X|[|yZtwcuMQR~`luatw_X}\jyZtw_vX{Yc`|Y{{}\0\2{szropvvNj‹f-{Yi`}Y{~{|]<m*gN_?>w!A>VZ\P?T7c²ĝYۋLًY{~rpu`}O{Y܀Bo-Y{~{}]V|YuyZt.}q"'.لw_ۘʍ!awGHsmз6'+bV[uvuvxnlmdsjJ`׍Os(sA,}\_xZt~"+ċmdj\CIaZ{Yu]b~Y{|[v`ő~ofC}|hca'|zs ikljU1bHqyLtw_~$f}co|Q_s|\muPu~`o N {|{hX0|_|THyCy~~dlywQ{L}twRuy1epő{Rq^}k,q gr 䆨d.0\!:|ZoyZt~0 J"'.لw_&qQڠ7%`<;"!Q'{L@URah$Ë%?mwYrgE@Y?L!`You٪Nj~q !2$GC#0psjyjjf}dgYrC[b[DPG_JZMD;(R%Qq"0A !͎hwekOc%* my(Pf!}.@URah$F%8+:}Zt~0 J"'.لw_7>fۙXGHm Vu'+ͨԭuvuvxnlidwjJ- yMӂp!< .fNhS hb rI7ujH*0?*?QSkx}vtv:Ҭ'jz ~}o ŋFbm2ً¾ʷII|x򨼋{hwub`",@"QRNCVQVMXLرu[ɍNjyoq|}vut}wp qnuyazloe~wuy[}[jvZtw_w}ܬ{vrmp}o{~Y|Xu>q1~_[00 a{wqnipo{x|[FuPV"G/F}Wƒww$$ RڭP1hΘ¥z!H޸ƛȋ̈+wLe``yXOB΁q%L%ix)=(2E+|oz``~~=VT)hYX2Nh_Or.jrDnNxe*#tR KW߀膬]oru{[pq#!^{zef]Tl{g\`~|xw80TWCihtwkFB}+^bpo}wȅwkp}?s)Ŀ{r\g|[hpZtw_y(彿ƽ{vdemwo{_pi^Smi^Ztr~W9{wqnaeo{~KsToxp̵jދ򎖎~~]IUl]^]abfqBTMNFE>a^[pk|zan[~v}|sEU!"KNll[W} +$(rr} áϙ{u[gaOq{kyN/y}¯l\ˣ{lSbi\z{t]\e(sq| ~oZdbXs{}uuqttrr} áϙ{u[gaOq{kyN/y}¯ #Wy}¯\\ˣ{lSbi\z{t]\ݼ-;rwYrgE[^iQj"!:$G?# psjyjjfdgdYC[WN."h&,KUPO=5 KC4Qq.;RQ[\"uCuus|vqqe_3A@R#1#ywD_xouM-;;M EE m^i g Vo P" P ] Pߵ  M-;p;,M   L# M-;e;M  o-;;o Y1" R1 ] xߵ?  ̈́'   e8# dd Wo% lF; J^N ;   i9 :  p* ~ pG5 31( 57 c;t6 c;r3 S3U W44 dm`^= > `? lԲ BMY% OvYYǵ8&y)yitw̋ |vdtBiwuKKHQGQVtgZ/\X UO9S-H/(>s.mw;1=#n{zq`]mcYM8p]k{ڦ%݀z+;2/ Wg/Ieuõep|xssz{zYg99;/zyϋȸy|lpRhuu)nTfJrh@@}ycJDx@YT}Jn\Ċˁαj     ON c }TĊˁ>@ qy;@|@E@'X&fZqxh@@qke~ }{ @*@24s"@0 Q|lf7P;` )褀;@~@(Ā~NiguI\rtCVttx{< }KĊˁ4/@ e@y;`?@@@hv@.WFg9siN@Ѐ}@@zqkep }{@@ 824 "0@ %@|lf7P;@[ @@@M4s@}z}q$$31MKqu}} wn?eYH|x\u1khr_Ë,{ogĊOBgp5YxfuyzQ.q{oyZՔ͋z~eL{3,$TT\kRzxrruu  )X@68M=XZu_}FVGwmh)P   ɋx vV$=Wn>ĊOX`}1d}yݑuu!`̐ynnpr|]Ϟ֋ld[1RC,  zxrruu9`s{qs`llY7AM=XZu_}FVGwmhr 3`{zj|txr`wC pĦl$T0qmw\zb]ihtδы9M#]"WBsitpvuwz‹!LXp~a_7z|y|mYOuGlyo"*%2]cpv}rqxvrzn|`aFbɋڑ6j  "gwe_gvg-9.©ۤ{\jt$T0UX@lwJL+Eyۯ"] ŪȷvG_gj-0+nb]ihtδ@@@hnh@yo"*2]cpv}rqxvrzn|`aFbً薶|{jyċ􋟁zbIeg}D Xhxhyo"*%2]cnsf|{rqw}T@H $TX@|zb]ihtδ΋rtXyQPcg1[!l~@Oi-1yo"*2]c@pv}rqxvrzn|`aFb%lwJL'Eyׯ"Y@we_hwf=9©ۤO ݴfƔww=٧~9#zإ37"G]1NZjko/づl}{;d:qDw{z~|7 ,@݋(KYp~a_7z|y|kw^QKN|~UM#U"WBsiQiau  }Dwس.-W;iWyvoM ~l:9?a*R {SeUŋ‰ʶ|~j_rNS|T|dVh\Yg}n  wFw    }w  }v_ e 7v_  }O S   + Sv"f  >   < Sv"f  >  jY{ cQ!r jY{ cQ!r ! " fv ϴ 4` 49` dU^d©~dh`rIrfYSj҂ + -s -s -s  ! o! jY{ cQ!r bWH  xwٲ   !0"H   cQ!m!r  bW$  < u' cSv"f  c>  cSv"f  M-;M !0"H Z}JnQ@!Ċˁ r @j  @  @ ON c 2    FH`@|yry{qwvM{P[[PP[ƻ[Pwd[[dd[[d8 aaaw|~wognfH } + {c9ssb@O@@ Х}p{~}{~f - `@@|mqpnU@˩wmvv~w* BMYg/B쒉uemvWlo^v=C@<,x@`_]`[c)@1^~Tl`x qËWZ)@2)@W< *s\ f  @ m@h]TP44Яg'])/Zt~(.@Yw_= €-6?NU4ZVꋽB +h^PfVk#Fk0Jj'Qb  2Ug ?  K ` * H ; U ,;L>!nsZMVp4_\  P ] t !1!T!""0"##'#N#c##$)$;$$%%&&'u'''(I(^(((()p)}))*O*+U,,{,-- -?--.\.u..//*/T/n/~/090001H2i2233M3334f44455=555666k6667a77778$8;8U8o88909P9q99::I:::::;;R;Z;d;<#<,=d=====>>e>w>??&?8?N?z??@@#@d@@AA,AkBBGBC-C}CCDnE EEErEEFFUGG(G:GfGGGGHcHHI(IUImI}IIJJxJJJJKKLLMBMMMNNO OOcOvOOOPbPQ+QRRJR^RuRRRRSGS`SSSSTTTUVVDVW WWWXEXyXXXYYYZYZZZ[R[[\G\\\\]]^P_._T__``j````a6ahaab;bgbc'cVcccdd-dYdddddee7eKexeeeeff&f@f`ffgg9gSgghi@idijj5jOjjkklClm2mymn3nnnno1oooop5ppq*q]q}qqrrr?r~rrrss&sLsasstt=tNt\uWueuuvvXvnvvvvwAwxxkxxxyydywyyyzz-z:ztzz{{{"{U{{{|3|R|||}}m}~2~z~~~4Zt,cGaс,׃U҄>m̈́C8p`ч`~݉6щىŊg 6*h&a@oGUiŕq.sƚ sқ|"nҝ5\vIc1WM~ ]!9ըLZzө3]yĪޫ K¬%MAxF/Ƴ0_ٴܶ 8VeKd x~ v% 1xIxJ_1aaѝȼް $+Nps[}3XNBItV5tdL~"UShmphllx[n%{L;6A[үriwpw{zz e|ⴟ_=37F&+C3; ~ uqzusՋ?[O W>D_{v>>4~3D-LW> >^@_҇~t|DBW>W>+h3Dz}~H> nuu@jQ@@1@ h@"$Un@ɀ6ˀ~@G@ @vuq'@'q@@ ywyy2@ P?p@@gXf] }{+!P8z~d ~b`q{|ds䚺UggSz}\ ֲZ^&J8o}k&L nwZjtx}ʐŋƋҋxsbrh 2O;xmrPV]w}hqus~~{z Ro1W/1Xwe! rJ 輴dX ׋KeX hVιalwzAN1% #׸ԎLL _K5Xwly-cHxJWwww~wpa{ry~ty`NP :\%&-oK֠Z^ qn+&"NeF Xyr}z}|~8fVptkS;yȌ ߺ_X3%<1Zgf1gYJVcqn yy™hc\wq(C aYO@Recr `Y1]LgC 1ry|Z^ i{+򷩕im9m<- gnngqsxq q{vEPm`wx˪x^plxpuz olrmmr{o  BI\w~o~A\x ynQ  Bw{vI\szA\m t`vmy|cdW_jZt5c_fCahw\; honh st {s {|g~zq~s|%M%hёlXxguuH ",xPx[!Q,"+אNJW LdL,d*+1=6 c,Cy} ypQ>v}g @ }wh~/pkzu~zmnol\_`Zsht}v~jIbxSG}yx}@Dž M8(1A'tr 5' 8r Ϙ軋d( vYmo~j{z||[V|[kyZt~ t~D ڪ\M-&X1 udL[VL `&XUtoam}Ρ|{{W:Y=*#* P/G[%d"R1E- W0@/GQcaaV{}ņ|[*a {[rLt~ԋꄞ {|{|[V|[_yZt~$ċmdj\C9aFߋ~l{}xvr|p%j$hf{sraW| Fߋ~l{}xvr|p%0.hf{ŜsraW|{|{{[V|ZwzZt~w_t |{{W:GE|@+DӋٳ{ҝjyj]q]}Ç_opnYO VTZtoam}Ρ X{Yja|Y{}rgQRT{YefY{}{}]X|[|yZt~wcuMQR~`luat~w_ X}\jyZt~w_vX{Yc`|Y{}{}\ {szjpouw‹f-{Yi`}Y{|{|]<m*gN_ vWiw1²ĝgLVY{|kppukJlkcO{Yhc~Y{|{}]V|YuyZt~w_~T ~kdx‹ }\_xZt~"+ċmdj\CIaZ{Yu]b~Y{}|[ ő~ofC}|hca'|zs ik {gjU1bH{yLtw_~$f}co |Q_s|\muPu~ ‹w_v {|{hX8|_|THvCy~~dly)m90L}!!" q[f F{}ͅwtA:|ZoyZt~ %;AG0_^Jg 7]O/Rl‹zzvoxnR}ݷ,%q[f F{wͅwtA:|ZoyZt~w_ j ѿU? aSkx @T֦}@"QRNCVQVMXL ["{9}~snhdyYoAËky[}[jtZt}w_w {vrmp}o{|Y|Xu>q1~_[0L &)<˴({wqnhqo{ux}[-[; F G/ uo{ugga^q{}ɁpLF5]~Yy˺U{lxbi\z{}xaX uo{kmedRm{}{muo{ugga^q{}ɁpLF5[[v׮ K[[v׮U{lxbi\z{}xaX oru{}u^W fuԑ{zof]Ll{u;\~|xw,4HD`x\s}wk~.B}+Ez\}sㅥwkO~Rp ;{r\g |[hpZt~w_y(彿ƽ{vdemwo{}r_T^Smi^Ztr~g9{wqn_bo{x~:Toxp ދ/򋖋}vcESp]^abfqCTMNFE>aG[jh{||zafG}ǪŋEU!"KNll[W} ~eueq\r+ataw(߸()߾)-~mdt .K}}-K ~.~}|b)r7])^(s7[(|]wat_|-j\m odWeK_dbSq {|n< xh|nv{v}} ċǿvx}arz zz q{}\sow!>/zyϋȸy |lpRhuu }ycJDx@Y erpg9XHaST_nix˳̦ #vHnQ[i8-lqgP;CB1~4{@vm|~et ze>;f ?t◑ojqm[k@\ DiɋqqSvPg\WG-2Vx 9Ny|x|}ʑySDow~ZHgUV7:L 7hqolbuoʋʍKQk ыȴ̍wqcf[i{3۴wU1%X ?f }y;pm Y}wwxwsdËվjێiii𒝟ru}}_`ADUt<}͌~|*ixS` rzn|`aFbzb]iht δ hxhyo"*%2]c pv}rqxv lwJL5Ey寸 we_gvg-9.©ۤ u|w zdJ4V4b{Hum|~et!wd}u˳׭ts>JxGus|{~ ksnkwx~v ttx{؎EHk~NiguI\rt 2zQtcg^s}ul~xxҋ٪!l~NiguI\rt ݑuu!`̐ynnpr|]Ϟ֋ld[1RC, +{Hum|~et!wd}y Y$.8ßu T[k@{Gvm|uznx%ws}zx{Ǔ~ 6u}etu˳uQ"sqʋĺʍKQkXkdJ6I: mdJ6I: (pp^qvuop|n4x}etu˳uQ sqʋĺʍKQkXldJ6I: (pp^qvuop|n4x}etu˳uQ Tc*'R ?a*R  .-W;iWۭmY % dtutX[ Ք͋z~eL{3,$TT\k~m|rp5YxfuyzQ. q{oy KcɋwqSvPg\WG-6Vx }QZFiWT;6H7hq㏏}e rrzoy ݔ͋z~eW|~u vwyzwmeIK*'ˤËzo^quuop|n4x}etu˳ f+P;wmh qkekuoiRy{yl|ws}{ {zjwl {uzxzpxǍvymp{ituwb|}gy{v1foҰ wmʋʍINk}z}q$$31MKqu}} wn?eYH|x\u1kr_Ë,{og(F- ԋIs9ur}g9{wqn`fo{Pm c~D; cu ~ IEFkQZ]aZp2yPQLUR|Y{Wqmkvrpzqy}ƽǦTdtŖ{ynt MYvFpx|pbqfГ]K` {kjf=cԸtovo{(.H(26 ;;;;;;;; % %' '&&% % {wpm[rtzy~|{wt{{?ok{rtgl n|}|~ ~}@ ŕ~C\G/\q@`}pSi 0cvd ɒŔƔMMM~lu $~bQu{{yy*wIWW dgud}~uk {~s\ jbcjiccj LRVKKMRL Smx?Qyn^g^M_ QYyn 򋐋n~zl^5~p [Uyqryl`uȋűŋtsn^~dq?JSF d[bpMfn`~]cbwB7x~w~pe=s# jzsًǩvkyÿv vut\i`\js؋ĺ{6r n/~ :|7}^mh^vv ih olrmmr|o Yrk|~|ztzU̺ WɼmQmSMj KCMtAuC[ŋً͠џhR Y{W|[oaee™ ~}O Xk/HHQ|Ӻ纏])_{}\Pg ~[iZ~w}p\-~brq{s|d {~} 6i wyyL{͔Ҭ~k~kygv{[sujh|Z{X2Sjz zlljpjjp sqp}_}iem _}pdqcsc 򷦖yeCzr{9 |ehrFrfV]jԇ jrojwx|v |xl{ilwz W]eWiwgi B|}{ wkeɮ~`vE{T}[nyZt   ߅~zskv} |S*aēȏl{}|ythdӪővzu d# LOd~x|!hb[Ycht Y|a~y|MUۺ PɼmQmLMj } uh| ||m##)*|##{$# }舴{nus,i lcw~ꁲuvyvsoSAzs  ɄΕ}ih rRrrLG yugjhpw ]KYPjrεѫtj `G;ieȋGy}yu{nQ΋ѯȵۋwgN^V}] 9e%Mx xpOHX{ѥذ xΫ1_fRE~~~ŁlaM~u$lhftz}|*'R ?a qvwqrvwr rvvrrvvr xo nfh]lm{ttbp؏ whjbnҒziqpY` Œsx}lrvqֿp4Y=!if Œvx}lrvqֿp4Y*=!if hpmhvv{u ~$_puS~9 {~,du՜tucdml Ћ̋ujmvWlo wilrtq{~[Xf[ gsuR#Q4 ]aڋu{t{D jp^qvuop|n<~e|yǐwt ^̐ynnpr|~jzË}g[ %C, {si}$Kyx I&I: (pp^qvuop|n4x}etu˳tsoNkFlHgus|{~u|ދݵsvd ˴ru}}O`B 6:fg.Hlg(nihawq}unsuuӽl@5[ sod|qtxvypcw~lPPz9dz3rz »ǡvqb|qtvypcw}y~*'R ?a*R  ή}sod|qtvyobM\{| Y|Xu>q1~_[0L &)<˴({wqnhqo{ux}[-[; F G/ »ǡvqb|qtvyp\z}q$$31MKqu}} wn?eYH|x\u1kr_Ë,{og fjtZW6b4  qɕ}jh rRrrLP $(yp ySG}y{Džwh~/pkzu~zmnol\_`Zshtv~i ig 7 Y& ~~ }}|:%3*BnjmdngC>dʋxw}}}zx"$ psvrj tx=|\fnZNZ 4{ xxc ~|{{y}~}~y}ymghqu y wiiqwt{ #j@ @cjs^׌@O@D gvVafW_h w}}vngne yn qdozsgeV ~tlj]Yk|}v} ZZ P@Pz{z|֋C?OzJcTG|[ipZtw_yHݨދuztR ywzx]iXarN˃   6ak"0$B\y{m_~}~{lff^swsw <*+8D!SDe (\ |~}|SrsfrDhro} !~.hf{sraW|{|{|[V|[_yZt~w_u ~}\X}\jyZt~w_vX { Yc\ a{Y{}{}\X}\jyZt~w_vX 8ɡr[HBT.cGZQGm{Y~c`}Y{~{}]Jk|L~ƌόv[r}uz}{vVjMWon}pW>|[lyZtw_v m~tbjbjIkmlU= ʮĎ} [Uyqryl`uȋűŋtsn^~do{q }y51#VFi uim|^turu~ŋvrfwLa ~ֳtA 5=tbv mciNŵ Wa0y`y`cbw{}+U𰋖=.miMyjYnLx ԋ#oX1A$yrډvbdaHny{ q[lÝb@'@dAy Jr}~||3@X&B}2[r)!2@(v?怋 @\@[ˎqEn~ p@]M `>s y/%._ %0u .)0\ v, h݋ P35C/#;\S  "q 8Uy "}oa#tCJRnnnnmdÚ@܋ -tљl5ָ&1<0l߬ L9Jkt"⩗if ~I5:B!  -S[w~{o sL'%]i zuJ@^}zg}ڶxg fmhas՞|  ͚8(uxyz||ْ98}`Uh:_}xztOD=Q[_}΅m |xrvw $iSZ[jZk Vznk{{L2bgn Ƥra\Hr {zjHG9mvs.}q<r23n㙋3ۋ ۻKD1GB)idƞ Yc c]y_LSWZËûSn}rfzwػۢ|vqM_\lVU-]H#_w]B {Yca{Y{}{}\X}\jyZt~w_v X{Yja|Y{}qxE{YdfY{}{}]X|[|yZt~wcpM~`luat~w_ Ug܋̴Սn`kiTpm}wptnn ~j\VI;]uqxfmytأ]{vdemwo{}jl\JI{wkjafo{x~: J5&EC!idǒ  WA~x}w_w^Yck{ewtokHGj`hi{wh_/qhoeVo[z|ŲɧꧬJh }\jyZt~w_vc]y_LS WZËûSn}rkzwռآ|qqM^\lVU-hB%ejwB {Yca{Y{}{}\ ̶֋ګ\M?DK: jmxtx~ ʯIF#>3&@T֦~xUWxsb)jC Ϙ軋d(\Nto||zawP} }\r{Zt} p4r4Aߋ¡}Hl|\kyZt~w_vX{Yca{Y{}{}\V?uo]?LĞ{YfdY{}v|\ {Yca{Y||{|[V|[_yZt~$(;G} 3r8'no||zawP}ްߋP6daatcu IY]^Pgvd jb/+#',#馊~xUWxsb ~up_ug[o,Saror[XrŪpwfwdmk`Ybh{mt~ ̜mKcU]Xʥk^ejw"~pyvG^m+kdcawqM kz}qlyh~q}xuni{{hmË wdW?Djsq1wPaSzupvy}zxito}ΐX4 ~dl q^I_aMgj|tyi{ Zp Ϥɋ]`VTpzy|vo`^tf{byx vqypqyl[q̋Ǎyujlwe jp^qvuop|n<~e|yǑ|n-]l̐ynnprmɂ}kӪoylO %C, uwʋʍINk}kztSzl}vk[Mga}xwn?eYH|vg@qWhËЯ|pQOw M(r_Ë,{og[Y|[|[jnjqcyPow] ~v{O{y~rxzt~;nx~n~(q~ seji{ɒjRPRR>c~cRP MYiiz{{{ige[sMyس>RRjy ige[sMyس>RRjyMYiɒjRPRR>c~cRPsej BxmA\~wI\v{ B ewh%*0i<}͌~|*ixS`Y}wwxwsdËվj ێiii pl xyv}~KlHx|y Fe~FQeX~}A]Kdxpxz y~t|}~~|vzzzy_}at|}tz{   Ι͛W†ؗr r|OgMo{on{nuy|{ňŎ NiN_s_xx}}xv||}} }~ gwhetf~ wtn zv{h}ve z ~{uxw{ ~cQtw~x{{ ~ |z{ rB[>TkT`ct{s} }  |v~t xK]A} XeQFeF y|xHllnKe~~}vx lpl jlaQiQo|pz{w|ɊǏ   l~ftehvg }wyyu  ||x{t|yw{||~{xz|}kxlvtwzvn|v~v||z}z}~  }}||vx}}jkȀȋ zevh{v kw{wxu{ ~z{{{x~wuP { |xz͚} rzy|ws edaaWww}ų oasW{H ~|* jDz`nx <}͌~|*ixS`Y}wwxwsdËվj 'iԿ܍xu pg i=i#xo}wEQiZ{Z_ |llAQY\<}͌~|*ixS`Y}wwxwsd |Ë+j iݼ#䍽xuzvxc gy{v  {zj|tyt΋¨ 1foҰ{uzxzpxǍvymp_zxrruu s{q jrojwx|v oaq]l:g.Hrx'EX`nx<;Yµ‹xu e'hRawq}unsuu oaq]l:g.Hlg(j`nx>9Y¶‹xu Qm{Z_|llA[:fg.Hl g(iRawq}unsuu ||Ë l@7YѳӍpo}wEQ ttx{؎EHk~NiguI\rt g(nihawq}unsuuӽl@7YѳӍpo}wEQ3 8:fg.Hk yz{yyjl׋p2cL{mzupd vzy}3}qu}RM 5 cWxMyPRWTJ{Ӡџ˧ QA:$[r9q6ZXSo0^p3o/LثeT <}͌~|*ixS`Y}wwxwsdËվj u{vte{/~Gzϯڛw wv{ww{w ~jyzfuk ~jyzfuk я^8 ЎR#eޭ gQ#FR$ a~u]8c~tO! Uy~ ygs{>ZRh|[jnF5fͅu\}v[͚Ys gmzSnw]  TYR{WzTVŋŜÛY UcdoUppŗ TXR{W zTVŋŜÛY UcdoUppŗ yrur}nk~ fml dljy_fsʡ lvtt~vciel~vxneb\s~bhr~}HpSaxJ|Xo‹ [uyz]}Ǽ l% `möS`*l% lmw`#l%l%+S`ö( bqa|}{~~z s~k$~sd  |~agyo~ͱȕ~nyx{~ ccby~ xx|yy|x 5 8<3p2q70ً|@ ~_iZ~w}p])~bnq{o|d m~ewL6w{[ctmjwo\zͪr\JJHw 빤ܖwhheZZ[sl{vjw{iw|st|ngyQ_oz|wo ||~zاꓥnrnr{|QURURS 2g  HNald}{m\s؃xMuCRwW} zSooigtdzĠByRkgopvNUs8wJ\ԋًٝŗOwct|hj Z{~{|egY< pzpnjqlv xy|yy|x xz|yy|x xy|yy|x  }yq  ~t ~s #}~ s x y{yoczqyx^wo}uo}t~tw ߓ_gOi/IJl&s<6L9y7{}{t~OYTw}xtr`y~{Ǭ4-3])d.   s8&f! $5ĥ rkwrkw}}C^GB$vmwv~x {WUd_}t}] nwn~ ͠alh9jutmn ɋ^ihuzp|q| 3hj-񋭋}wq}r~mv4oۋxzs}uly n,9,3}⋻@n- ň  c,}Tqtmn8n~n~ ꍐ~~vZ[||~umn9nzn~ˇӋ|w~ hRrx||{Q ~~wY[}|~umxg>n}n~qx}z|}ot 6o9hh/şwwlo~oyv{zzn~o5hߧu~ mwrm|u}]jfdlmgh\ mttmo8nn~shb}]qy~r~q 8oxn~q~msqmo >~}\|gqsmouǕmmsqmo |!ktmwqmo9m}n~q!tn|71mw}{s m~ormn6qxl ËLj֋~{ux} ~v:f {{mROqVuYc`~yzj)e}jzen~qO յZ\ h5 J)*,j 䋘$p2r:G4;9u݋ qovHhwaju}twT9{sttmxg>nzn~ lxuoz  ~~c|ov}}"8( -g l'Iq 拲1o/q7=$6/e݋ pz}eyÌi9jutmxg> nzn~qHugq ɋZih|vw{z~xnz ~|y{znl~]{Tqn-VKDAr֣-zzv{znbh6܋ښ ~vvqvzm{sW Lrtqvzro zq {ywzzq6}~=懾鋋uvyz~vҥϐE^DD~~zyzwvV/W3iV3~zx~o{u w|^~yw}z~}o{{56pwv{qtzuo*-jl`wv~x1pr{z nvzn~q~vv{zq|vrhvwpo}}v{zqvzd}|s ooqqt{dcamkhzwryo~|JLxxnmÉˋɍochyo ~t~t?|p{p~䞽䛾 W55 (s2|Xp2p2|Yn2o~p|n? st heަq=t^ y wׄ}}vH vGeprmtX~_ {ɋ˟ΞnPxnu} vllyl8|rz okuBe`xxsjֶ q|^vjr;s6MTr:yQX̋h w}{j vG^u||x`}ݍpiLIcp3 㩦vd|}rZ3b^)~xr^'|~ P qn]wo|\|ЋԼ˘]EypĺÎt|v }ysYRpyQ|Yz~}~p} rmetvpk vjim__y rghjzu}Гvulyyv3{|tok#| z~z{z~z t~v}k~yu|xuutq{~ѥߥ _&~bpyvxt}spwlyyv zzz{vzy xuz=~eqXvqlwl3{Axgz wulyl3{}~ yghdxy{~p_fpw|t}~lxxui|ppl&|ppl&| pgh\qv}{n|k~zug |{wjn,{} ctxLzSTgv {}~xҋɠΜyPh_o}vtlxl vif{Ds|zxjb̴֟ }~pj6GUr:uEdƋuq6qks ||txtzxt{lyyuh|~z bjurwR||suspk y~H'8~]VC HxpO54ukT83f)* ~7ul]tkyv}sCt|N42 }nME]ZSQ7rq{wzO5Dool}|{ QDszS~aofhkugthf{o~azStŋdiiy &t(yq~ vSicho~b~__{dċԢmzPRz~_~b{ohco zǨ [֠tuOrr Nk`aALld b~ du.~ @|zgmjgov͋+h@?0 @ yPy geZK88RPTkzyh| @q@wsx@ǀ8 c |<| x~~||@ @^a\h`s~@ }vqo9|]y~Zt~w_t ssgRC;hC dY{} '@= }]jyZt~ *nW@ p Ԯɋm kxk d@q^E;sHw {勜pbjh_@<}}pr{ ~{ dO=, DG T+G kzkhY{} '@=}]jyZt~ X@Su]& C ʋxwe@$@ dՀ* 2@}}}zx"$psv' 1@  rj:a|Y{} '@=}]jyZt~ njmdngC>d ʋxwe@$@ dՀ* 2@}}}zx"$psv' 1@ rj:a|Yz~ '@=}]jyZt~w_s }}pr{ dNJ5=ᦙu{u~udY{}}oyQzlla@o @ f @ E d <Fs }]jyZt~w_t{Ys\X]$ۀ#@ - @G@ y:Fl{}{s`,rctf\s~vq gUsy @>@> }ꏀ2-{cif\s~Évq|p~}w@ X@ @@ Y!o@{YiiY{}{}\Iiyy :%3*BG *?4+ ƽdSEENZ4  w‹WTv}peiyjx{}@@a@@0--qq@@nE@x{YneY{}   p R5r@U}pohJn~}~fx`rJ @ %@G&t|@@궀܀I#nj @ċmdj^C @R]>^c |<K@ N@ :@mdngC>dʋxwe@$@ dՀ* 2@}}}zx"$psv' 1@ {~yb 3A>M {~y  @tt@ 3@3@@@ &|} {~y t{tTn{Z_|flA[:fg.G~f" n2o2p@1qke kvoiR|{yl|ws }{H@A1P 2U4"4@1[ |lf7P;@ @vPpq i{3 wU1%X ?gBZe؀r\@h :K'M@ Hy ttx{؎EHk~NiguI\rt ysN HHe$b8;d|z]b׸5i |~u }QZFiWT;6H7hq㏏}e ys  ǷVO4$,MF Ȣ/x@ ^ ׋:+552Gu@@@ Rs)jU~{z~| ȕՋ~P~[Nus|v~xma_]AwPwz ƻǡvq^yqtvy{pcbqqnm:%3*BG *? >2      9:BC   # $ & ' ( ) M N r s y z                `4lt| $,4<DLT\dlt| (08@HPX    4@4           mwQn  :BDD  # z * VtDFLTcyrlpgrek,latn&  !"#$%&'()*BGR MKD hSRB h&  !"#$%&'()*'  !"#$%&'()*&  !"#$%&'()*(AZE zCAT CRT zDEU "LAT vTRK z&  !"#$%&'()*'  !"#$%&'()*'  !"#$%&'()*'  !"#$%&'()*'  !"#$%&'()*+c2sccalt caseccmpclig*cv012cv028cv03>cv04Dcv05Jcv27Pcv47Vcv82\dligddnomjfinapfracxhliginitligalnumloclloclloclloclloclnumronumordnpnumsaltsinfsmcpss01ss02ss03ss07ss10ss20subssups swshtnum&'LOR @F1345678:;? W=U>!"$<%'*+/09 T#Y"*2:BJX`hpx *2:BJRZbjrz$,4<FNV`hpx 0NRVp~"`*T< !"$ $$@$h$p$x$$%"%R'*~*****+^+|, ,,,",&,0,R-r-v-z------.. .R.000@01p223(383H3X3h3x45565V5v5555559f>>>AtBBBC`CjCDDDEjE~KGJwMM w--M @w Bw  G % $6VW FFBPH! N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d (! 'v $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|     $ * 0 6 < B H N T Z ` f l r x ~     & , 2 8 @ H N T Z ` f l r z     $ * 0 6 < B H N T Z ` f n v ~    & , 2 8 > D J P V \ b h n t |     & , 2 8 > D J P V \ b h p x ~  $,4<DLT\djpv| "(.4:@FLT\dlrx~ &,28>DLT\dlt| (08@HPX^djpv| &,28>DJPV\bhntz$,4<BHPX`hnt| "(08@HPX^dlt| &.6>FLRZbjrz"*2<FPZdnv~$,2:@FLRZbjpv~  (.6<DJRX^djp" N" " O" P" T" U$ ]& N& & O& T* N* * O* T/ P0 N0 0 O0 P0 T6 N6 6 O6 T: BBBBBBDFFFF    OPPPPPVVVVZZ" QB" RB" ^B$ D$ OD$ SD$ WD% WE r& QF& RF& SF& ^F& WF( OH( RH( SH(H) OI j* P * Q * R * ^J* S+ O ,L- M g-M- rM r/ O/O/ WOO r0 QP0 RP0 VP3 S3S3 WS4 T4 OT4 ]T4 WT5 ]U5 WU r6 PV6 QV6 RV6 UV6 VV6 ^V8 OX: OZ: T; [; S[; W[" WB* WJ0 WP6 WV6 T QV h6 T gV m6 T WV o6 T iV l" T QB h" S QB e h Q( WH, WL k0 ^P0 QPE W ( H/ NO" U gB f g  " XB"B& XF&F* XJ*J0 XP0P3 XS3S6 XV6V4T5U) WI k" SB& ]F0 T QP h0 P QP p h0 SP0 S QP e h: QZ   $ & ( . 3 7 G ( T3 T? C E G S GSM S W 3 3 T" \B# SC# ZC# dC$ ] D% SE% ZE% dE% ]E% `E& Q iF h l& Q gF h m& `F& cF& ] RF' SG( QH) SI) ZI) TI) ]I) aI* cJ* T   m, L, ZL, dL- ZM- Z QM- dM- `M. N. SN. ZN/ SO/ ZO/ dO/ `O0 P gP p m0 P TP p0 Q iP h l0 Q gP h m1 Q1 SQ3 SS3 ZS3 Z QS3 dS4 ST4 ZT4 g ST g e4 W ST o e4 Z ST5 SU5 ZU5 dU5 `U6 [V6 cV6 `V6 P gV p m6 Q TV h7 PW7 ZW8 NX8 X8 TX8 SX8 ZX9 SY9 TY: SZ; O[; Z[; d[IUXZB?" ZB" B" O B n m" O B n l" O B n " O PB n p" Z OB" R B q m" R B q l" R B q " R PB q p" Z RB& ZF& F& PF& O F n m& O F n l& O F n & O PF n p& Z OF*  * ZJ0 ZP0 P0 O P n m0 O P n l0 O P n 0 O PP n p0 Z OPA BA NBA BA PBA ZB6 ZV6 VC DC NDC DC PDC ZD: NZ: ZZ: Z: PZ??? ? ? ? ?  ?            CCC C C C $$$ $ $ $ EEE E E E E  E  &&& & & & &  &  GGG G G G G  G  ((( ( ( ( (  (  MMM M M M ... . . . SSS S S S S  S  33 3 3  WWW W W W W  W  777 7 7 7 7  7  ? ? C C E E G G M M S S W W ??? ? ? ? ?  ?  EEE E E E E  E  WWW W W W W  W  ??? ?? ? ?  R Q       E EE E E $ $ & &     GGG G G G ( R( Q( (     SSS S OOS S 3 R3 Q3 3 0   W WW W W . . 7 7   " )/4EYbf l s%y(>Qqu8>X\ `a" JK EMU CEGILM pJK i g j k*  i g n p h q e f o *  e k n q  l m n p h q e f o : $&(.37?CEGMSW< $&(.37?CEGMSW< $&(.37?CEGMSW  $&(.37?CEGMSW hLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ _fg^vv`abc#$dFFfKKgh !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}`] _fg^vv`abc#$dFFfKKgh      _fg^vv`abc#$dFFfKKgi~  _fg^nn`vvabcd#$eFFgKKh%55 [d  55 '0 J.8/01234567%. 0&'()*+,-.%/8 .%&'()*+,-./012345678 .%86$%&'()*+,-./0123456789:;<=qyz{|}~         6 )6#)89 ,-BCDEFGHIJKLMNOPQRSTUVWXYZ[  !#%')+-/1357:<>?BD$CFK % & j     Z[\]^_`abcdefghijklmnoprstuvwx           ^pv  '       "#$%&'()*+,-./0123456789:;   "$&(*,.024689;=ACG ( 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J N O Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d ( r '7) *   r J   + ) *ozV";B[4 ?AD $$ :D FGKK % & , - / J z 8 AV,-W";B[4 ?AD $$ :D FGKK % & , - / J z 8 A6.VW6  - 0WX ILjEIS2TBCDEFGHIJKLMNOPQRSTUVWXYZ[  !#%')+-/1357:<>?BD$CFK % &T R!  u v+K m$  , - w , w w , - wW , x  HFy K L 789:& E r- M rU r%   r B$.8 zT {T |T }T TBFJV. U L ~QUDT` Z$,4<DLT\dlrx~ GU KU GL GK GI GCGMGJKJ;L:I>K=U<CMJG K H Z"*2:BJRZ`flrx~ #?U "?L !?K ?I ?C ?J ?M@C?KT M ? JBLAIU"*28>D GU KUGJKJ=UMJK2GH?KI5"(ABT";B[4 ?AD $$:D FGKK % & , - / J z 7 @"(BFT";B[4 ?AD $$:D FGKK % & , - / J z 7 @"(CT";B[4 ?AD $$:D FGKK % & , - / J z 7 @"(DJT";B[4 ?AD $$:D FGKK % & , - / J z 7 @"(EVT";B[4 ?AD $$:D FGKK % & , - / J z 7 @ zTB {TF T |TJ }TV$BFJVTBCDEFGHIJKLMNOPQRSTUVWXYZ[  !#%')+-/1357:<>?BD     $:;<=>?@ABCDFK % & , - / 0 z { | } ~  BTGFTHTIJTJVTK zTB {TF T |TJ }TVM24I"*,1 3;BFIJLPSY$[[+,3BIP_dhz}~   !$1468>ADHJQgijruw~ $, .3)5=/Z`8bp?rxNzU\kpt      I"*,1 3;BFIJLPSY$[[+,3BIP_dhz}~   !$1468>ADHJQgijruw~ $, .3)5=/Z`8bp?rxNzU\kpt       N24I"*,1 3;BFIJLPSY$[[+,3BIP_dhz}~   !$1468>ADHJQgijruw~ $, .3)5=/Z`8bp?rxNzU\kpt      I"*,1 3;BFIJLPSY$[[+,3BIP_dhz}~   !$1468>ADHJQgijruw~ $, .3)5=/Z`8bp?rxNzU\kpt      I"*,1 3;BFIJLPRY$[[,-4CJQ`ei{~   !$1468>ADHJQgijruw~  $,!.3*5=0Z`9bp@rxOzV]lqu       " 24 " 24 PG? KE "#$%&'()*+,-./0123456789:;<=>CGIJKLM\]^n    !"$&(*,.0246789;=>?ACTVhq%')79?ACEGIKMOQSUWY[]_qs   !*+,23678$:;<=>?@ABFGK       ! " # 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J"(QG? KCGIJKLM !7>?TVhq%')79?ACEGIKMOQSUWY[]_qs  $:;<=>?@ABFK       ! " #$CD$G? K$CD$G? KS $ %";B[4 ?AD $$:G KK % & , - / J z 8 A  &E $ %@ 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J M F G";"" K LWX   "> B^)aaFkkG{{HI ?AD  "((01 &$$+:D,FG7KK9 % &: , -< / J> z Z cVWX  , /WXF   "> B^)aaFkkG{{HI ?AD  "((01 &$$+:D,FG7KK9 % &: , -< / J> z Z cFX zF DFLTcyrl,grekPlatnbBGR MKD SRB (AZE (CAT (CRT (DEU (LAT (TRK (kernmark"mkmk(size.x_&.6>F\R&''((( (4(<(v(*6>@D$D%F$#n yL(<yyy( y ~~y#88tVeee8[ ~jj~te8jjjjjjG3j`t~=ottBj-t`j=B`~j```-88-888j~~LVVAFZ(((3VB88 I  ""&&''--..00 11 22 5578::GGHHIINOSSWX"ZZ" !  !!""$$    $$))//11 33 779:<<Z_kk z  F G K L     0""$$((00225578 :: BBDFGGHHJK]NOlPPQQ/RRSSlTTUU8VVlWZg[[mYca)%'(-d.bk^:hRZe_[" #<+*&]l]'^l,  l  f`3457!!6%%8''8))j++;--9//i11^33l55g77Q::T<<V>>UAABBDDlRR=TT>VV\XX?\\:^^:``:hh!llqq>vv@xxABCCCDaalccleelgg^iilkklmmlwwEyyF{{GHIJgggggKLMNgO.SP12  1!!2""""$$KKW       $$W%%&&')**+1223344556677889: ;; << ==Z_X``WjjzXWXW A A M M z z { { | |] } }l   r "&'-.012578:GHINOSWXZ !"$ $)/1379:<Z[\]^_kz{|}~ F G K L F\ ~t~y~yyQy&-! ",4/!$$Z`z (-(!A/A!$ (O r  ((0&6 )[g &7Li "(.4:@FLRX^djpv"B@2\3/d.Ic~ $&(.037  Q R T >DJPV\bhntzRTMvvvMvMvRT  &,28>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|'Bg_ {(l or&'&<&,&,,%,&x&B&7D&& &R&Q&&3&$&&'g*&'&B&r&<&B5g&a&%,(w&&l &R &,B& &B&<&&&&&'hO6 hr&&<&&&&+&B&7D'&&&;&&& ,>&& ,f&6L&+&&D&&CD=DDDDDDD/DDD7DzDDDsDDDYDuDDDIDDDrDCD=DDDDDDD/DDD7DzDDDsDDDYDuDDDIDDDrDVD/DCd&2&&h&&&&&& , ,DDKDDKDDDDD"#$%&'()*+,-./0123456789:;BDFGHILMNOPQRSTUVWXYZ[  &'23?@ABCDEkl#*jlnvy{|~$=C     $%&'()*+,-./0123456789:;<= + y z { } ~    ' ( N X e h( j q, 4 7 = ? @ NO>DJPV\bhntz "(.4:@FLRX^djpv| YZ&(&&&&&&3&&&e&[&G&2&Z&w&&2&B&k&d&&Ycu[0Wh|3&Q(&Z&(&&G&&&&B&k&B&k&Z&(&Z&(&&[&Z&(&&&&3&&e&[&G&&2&B&k&'n Z`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\N^)kd>:v08cRYfz^s8/4y0d:s40c)NNcrwX^C}f)}r^xxxsxxxsxL^^^NsUU"#$%&()*,-./013456789:;BCDEFGIJLMNOPSTUVWXY[&'?ABCD *jlvy{|$=C    $%&'()*+,./012356789:;<=    + z { | }  Y \ _ d &' "(.4:@FLRX^djpv|=bddYddddGz6}bc}U`<j`LT 9tz "(.4:@FLRX^djpv|VqqQPj!Pj!UEPj9"&*06BFJPVABCD*v{   $()+,/0278< + z { | }  ^ f K "(.4:@FLRX^djpv| $*06<BHNTkU "CwU|C"U||B CCr^z$5 "  1 z$5 "  1 7|:KrrrCC 1K"$%&)-04569DFITU&'AC*jv{}=$&'(012678;  + z { | } ~   ]  &,28>DJPV\bhntzwldgwpztpzM~_]tpzz -EMU'/ r $:pp:d  &,28>DJPV\bhntz "(.4:@FLR|CzCx>543S'Y+U6L>9.x0^iRDbN::{F..4l{]DcDXNNi665'7A2]2|::  O P Q R S T U W e f g h i n o p q  N O P Q R S T W e g h i l m n o p q ~ &,2p6*]LlLp V $ *t4|%hڊ\Rwl#[$SmN22r -RX!ZoN5N2N5<FpOPn`m bsO{k 3Y:  {spSSW|W.,@U0=>)m*)Um.1Q7277-(197\7}YadY15}O??dr+JeX2O+"N2KeJ.SiiRiGJ%n`mmmmssss3YYYYYXlYSWfX>m*m*m*m*1111-7-----N2-9999n`>)n`>)n`>)n`>)mm*mm*mm*mmmm*bmbmbmbm..s1s1s1ss11O{Q7k 2k k 2k 2k 237363773Y-Y-Y-Y\((    {j{s1{s1999999S\7SWSW|}|}|}F Y-9Z#c  2r7s1Y-99999%bm7YY}Qcbm37%Y-mm*mm*s1s1Y-Y-((99 {s.mmY-Y-Y-Y-SWQ\{F'R(S-4J/K8}4[\0|0 s pnYkWL N M!   " ! N ,i  (", 9ems; P=m|~s3RY5: 0{sULs21G5+ L21 9G5++ 3;Z% \#_~Q:#99LA-|>*-" L\#L-"i7V!t"~mmd=n` ssO{db )UP=m!Y5: n`{sb UV_FVU!#!Jm*G99i-7>)7f9#99i--r0m*m*.Jr(11QLK.99pp=SWs%mm*!G}99Y-zKzK!rb b b V_#Vi-%PmbsO{k 3Y: {sSy("wx-.]W*&. |1(97~|{-c_}P=PPn`>mm*mm*mmmmmm )Ubm....ss177k k k k 777373733Y-Y-Y-Y-: : (     {s1{s{c{M9'99p77S\7S\7S\7S\7S\7SW|}|}|}.1\7F mm!mm*mm*mm*mm*mm*mm*mm!s1s1Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-9999999SWSWSWSW2121212121212121G5G5G5G5G5G5mmmmmm++++++++ xussss\#\#\#\#\#\#LLLLLLLL-"-"-"-"-"-"-"-"=5;;;;>42121G5G5++ \#\#LL-"-"22222222++++++++t||JJ-"-"-"-"-"-"-"-"++ff212121212121Hl++++mm ssssLLLL~~LL: -9-"-"-"-";;Li/[ //OOEiqiBidyy5Ife\\\7(F=F<\ \N2X2N2#[$4W N2X2N2#[$ wn8')'^''2)R{Lspp1pvp Ok n`111177u7Z7e1eJ2>)72&1&2&.*.+*/212X2X1r red|d|1N2DDN5N eve0[[[)[[[[[[Q[[A[[{[[[G[=[[[)/!1\{F{ 7 [ [[H[[[[?[Y[F[[C[:[C[[[[[[[d[9[[[[[[@,@, 522Qp00QBB4BB"(*YFFFFFsW.H.O(@?4L fF_)^sT-,UHd$02Q^V1@/NBUcQ444BB''''Z(#(91p@,0@,3U9z!5M(sz:RliG1)170$40B80H5i7H;(-{AwJ@ L|G  L:M %QHetulYU[ -Q.#*& $  0:**1HN ?'rc@$d5 N0) !~N@,, ,,,,,,, ,b  bSqqF {I j!09IS@)\E%E_?9LFL5AhE" 0UJ7q8p 0w)~~GH^,,,l,,z,,,,,uHbbkSVq[gq]Fbqh!h{bIZajgg0{STfvJEE6y?|9uze6L]a+F`\YLZ5A/h^lE Y0?arQ}iJq]z0)~xy,,,,,,,,,,ybbSqqFR{Ij0S{EEg?9gL\FL5A`hE 0pJq#\5Rw;[<TmN22 -!t!wN5N2N5cFOY8K8GN1{ 8)BCuz@z5] u.@r0Y8K8GN1{ 8)BCuz@z5] uadu15O?kd+JeX2OQ+"N2~Je5J.cJYYYYYY'8GGGG\{ 8 8 8 8 8Xl 63u3u3u3u]/>YYYYYY'8GGGG\{ 8 8 8 8 8N2 6CuCuCuCu]]+Y+YY88888888KKi88888888]]AGAGAGAGGA]] N {{w{w{w{www]8 8]8 8]8 8]88#)#)#)uuuuBBBBBB3uCu=uCu3uCu3uCu3uCu3uCuz@z]]]      UUUUUFFFFF779R *doPldXo *%; P8nd"Rd H$ aga"   : - IbQ2As1 7V*19-29992 N OOOEiqi N M! M\*Q51Qb`-6.7.7...74[S[4[S[ 8 8SuSuPK!3]YĎĎ&mdc/resources/ebgaramond12-regular.otfOTTO PCFF /KHfFFTM#^xGDEF *_^2GPOSܿ-Ul GSUB/a]OS/2Lq`@`cmap}:Jhead}6hhea k$hmtx.^0.maxp P8name9;post2K( >_< hyhy   P +1R PfEd@ D VEA @y E%6 6 67$7KL7S     , " (O " 46` 6 6 ,6 7; B7Created by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)Created by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)EB Garamond 12EB Garamond 12RegularRegularSorts Mill Tools 2.1.0_alpha1 : EB Garamond 12 Regular : 8-4-2014Sorts Mill Tools 2.1.0_alpha1 : EB Garamond 12 Regular : 8-4-2014EB Garamond 12 RegularEB Garamond 12 RegularVersion 0.016 Version 0.016 EBGaramond12-RegularEBGaramond12-RegularCopyright 2010-2013, Georg A. Duffner (<http://www.georgduffner.at/ebgaramond|g.duffner@gmail.com>), 2013 Siva Kalyan This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.Copyright 2010-2013, Georg A. Duffner (), 2013 Siva Kalyan This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.http://scripts.sil.org/OFLhttp://scripts.sil.org/OFLEB GaramondEB Garamond12 Regular12 RegularEB Garamond 12 RegularEB Garamond 12 RegularRegularRegularKyrillische alternative de, el und eljCyrillic alternate de, el and elj,@, dd~>EQSW]adtz~_cpw "*.1:<CJMRX[eEMWY[]}    " ' * 7 : > D I K N W ` q !!!! !!!! !#!'!+!9!K!P!!!!!"""""""&"6"<"A"`"e"k"o""##*$%&&&~' 'S'W'g'*v+F,..%.)...;00 1CIQSWYk @QSW]adtz~bpr  &,03<>GMOV[b HPY[]_   $ * 2 9 < D G K N W ` p t !!!! !!!!!"!&!*!9!K!P!`!!!!"""""""#"6"<"A"`"d"j"n""##)$t%&&&~' 'S'W'f'*t+E,`..".(...:00&BIQSWYkpkhcba`^\[XJDC?=10|bZL  qpomifd]\ZXK:6'olhfg7Bܺ;20,!ZV`<`,`'` ```` ___~'}  t ~`>@EQQSSWW]]aaddttzz~~/569:=>_?bcpprw   "&*,.013:<<>CGJ MMORVX[[be 6 E<HMbPWhYYp[[q]]r_}s     # "& $ ') * *- 2 7. 9 :4 < >6 D D9 G I: K K= N N> W W? ` `@ p qA t C ^ k l m o p!!q!!s!!t! ! v!!w!!x!!z!! {!"!#~!&!'!*!+!9!9!K!K!P!P!`!!!!!!!!!"""""""""""""#"&"6"6"<"<"A"A"`"`"d"e"j"k"n"o""""###)#*$t$%%&&&&&~&~"' ' #'S'S&'W'W''f'g(''**t*v.+E+F1,`,3..S.".%T.(.)X....Z.:.;[00]00 ^&1bBCnIIpQQqSSrWWsYYtkkuvxy~LM   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_&pbcg(vni~thqeu jz alRk{+`#$ !89n45'w"%ox2EBGaramond12-Regular;     fog~< .$+28>ELRXcnx $+2=HLPV\cjpv} !$'.5;AN[agnu{&-8CNY_eoy~ &-4;BIPW\ahov} !(/6=DKRY`gnu|$+29?ELSZahov} %,3:AHOV]dkry !(/6=DKRY`gnu|      $ + 2 9 @ G N U \ c j q x     ' . 5 < C J Q X _ f m t {     # * 1 8 ? F M T [ b i p w ~     & - 4 ; B I P W ^ e l s z    ' . 5 < C J Q X _ f m t {  !(/6=DKRY`gnu| '3?IZ_chovz}!&+269>BGMTVX_adjory| ")07>ELSZahov} %,3:AHOV]dkry !(/6=DKRY`gnu|$+29@GNU\cjqx  '.5<CJQX_fmt{#*18?FMT[bipw~ &-4;BIPW^elsz ")07>ELSZahov} %,3:AHOV]dkry !(/6=DKRY`gnu|$+29@GNU\cjqx  '.5<CJQX_fmt{#*18?FMT[bipw~$+29@GNU\cjqx  '.5<CJQX_fmt{     # * 1 8 ? F M T [ b i p w ~ !! !!!!&!-!4!;!B!I!P!W!^!e!l!s!z!!!!!!!!!!!!!!!!!!!"" """"")"0"7">"E"L"S"Z"a"h"o"v"}""""""""""""""""""## ####%#,#3#:#A#H#O#V#]#d#k#r#y###################$$ $$$!$($/$6$=$D$K$R$Y$`$g$n$u$|$$$$$$$$$$$$$$$$$$%%%%%%$%+%2%9%@%G%N%T%Z%a%h%o%v%%%%%%%%%%%%%%%%%%%&& &&& &'&.&5&<&C&J&Q&X&_&f&m&t&{&&&&&&&&&&&&&&&&&&&''''''$'+'2'9'@'G'N'Z'a'h'o't'{''''''''''''''''''((((((#(*(1(8(?(F(M(T([(b(i(p(w(~(((((((((((((((()))!)()/)6)=)B)J)Q)X)_)f)m)t)|)))))))))))))))))*****#***1*8*?*F*M*T*[*b*i*p*w*~******************++ ++++&+-+4+;+B+I+P+W+^+e+l+s+z++++++++++++++++++,, ,,,,%,,,3,:,A,H,O,V,],d,k,r,y,,,,,,,,,,,,,,,,,,,-- ---!-(-/-6-=-D-K-R-Y-`-g-n-u-|------------------......$.+.2.9.@.G.N.U.\.c.j.q.x....................// ////#/)///5/;/A/G/M/S/Y/_/e/k/q/w/}///////////0000'020=0L0W0b0m0z00000000000000001111 1+161>1A1H1P1V1]1c1s111111112222,2:2H2U2d2s22222222222222222233 333(373B3N3\3l3z33333333333334444#4-4;4D4N4Z4g4n4t4z444444444444444444444455 55(595I5X5b5h5n5t5z55555555555555555555556 66#626@6L6Z6e6q6|6666666667777#7.797C7L7T7\7f7o7x77777777777777888 8888$8*80868<8B8H8N8T8Z8`8f8l8r8x8~888888888888999 9999$9*90969<9B9H9N9T9Z9`9f9l9r9x9999999999::::+:6:B:P:`:n:}:::::::::::::;;;;!;/;8;B;N;[;b;h;n;t;z;;;;;;;;;;;;;;;;;;;;;;<<<-<=> >>">->7>@>H>P>Z>c>l>t>~>>>>>>>>>>>>>>??? ????$?*?0?6?BBBFBJBNBRBVBZB^BbBfBjBnBrBvBzB~BBBBBBBBBBBBBBBBBBBCCC CCCCCC"C&C*C.C2C>CDCQC^CkCrC}CCCCCCCCCCCDDDD#D/D@DJDYDjDyDDDDDDDDDDDDDEEEE$E-E6E?EMEVEbEmEvEEEEEEEEEEEEEFF FFF-F9FBFKFYFeFkFtF}FFFFFFFFFFFFGGGG!G*G4G>GGGPG^GlGyGGGGGGGGGGGGGHHHH"H0H>HGHPH]HjHtH~HHHHHHHHHHHHII III$I2IMKM^MkMxMMMMMMMMMMMNNNN"N(N.N;NBNINON`NcNjNoNwNNNNNNNNNNNOOO+O=OEORO]OhOsOOOOOOOOP PP&P2P>PIPTP\PcPkPsP}PPPPPPPPPPPPPPPPPPQQ QQQ&Q0Q7Q=QEQLQTQ]QbQgQlQvQ{QQQQQQQQQQQQQQQQQQRR RR!R+R5R?RORYRcRmRwRRRRRRRRRRSSS"S7SFSUSdSqS~SSSSSSSTTTT+T:TITVTjTyTTTTTTTTUUU!U,U7UEUOUYUcUrUUUUUUUUUUUUVVVV%V/V9VCVNVYV]VaVgVkVoVsVwV{VVVVVVVVVVVVW WW$W(W,W0W4W8WXXXuni00A0uni00ADuni00B2uni00B3uni00B9AmacronamacronAbreveabreveAogonekaogonekCacutecacuteCcircumflexccircumflexCdotaccentcdotaccentCcaronccaronDcarondcaronDcroatdcroatEmacronemacronEbreveebreveEdotaccentedotaccentEogonekeogonekEcaronecaronGcircumflexgcircumflexGbrevegbreveGdotaccentgdotaccentuni0122uni0123HcircumflexhcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonekIdotaccentIJijJcircumflexjcircumflexuni0136uni0137kgreenlandicLacutelacuteuni013Buni013CLcaronlcaronLdotldotNacutenacuteuni0145uni0146NcaronncaronnapostropheEngengOmacronomacronObreveobreveOhungarumlautohungarumlautRacuteracuteuni0156uni0157RcaronrcaronSacutesacuteScircumflexscircumflexScedillascedillauni0162uni0163TcarontcaronTbartbarUtildeutildeUmacronumacronUbreveubreveUringuringUhungarumlautuhungarumlautUogonekuogonekWcircumflexwcircumflexYcircumflexycircumflexZacutezacuteZdotaccentzdotaccentlongsuni0180uni0181uni0182uni0183uni0184uni0185uni0186uni0187uni0188uni0189uni018Auni018Buni018Cuni018Duni018Euni018Funi0190uni0191uni0193uni0194uni0195uni0196uni0197uni0198uni0199uni019Auni019Buni019Cuni019Duni019Euni019FOhornohornuni01A2uni01A3uni01A4uni01A5uni01A6uni01A7uni01A8uni01A9uni01AAuni01ABuni01ACuni01ADuni01AEUhornuhornuni01B1uni01B2uni01B3uni01B4uni01B5uni01B6uni01B7uni01B8uni01B9uni01BAuni01BBuni01BCuni01BDuni01BEuni01BFuni01C0uni01C1uni01C2uni01C3uni01C4uni01C5uni01C6uni01C7uni01C8uni01C9uni01CAuni01CBuni01CCuni01CDuni01CEuni01CFuni01D0uni01D1uni01D2uni01D3uni01D4uni01D5uni01D6uni01D7uni01D8uni01D9uni01DAuni01DBuni01DCuni01DDuni01DEuni01DFuni01E0uni01E1uni01E2uni01E3uni01E4uni01E5Gcarongcaronuni01E8uni01E9uni01EAuni01EBuni01ECuni01EDuni01EEuni01EFuni01F0uni01F1uni01F2uni01F3uni01F4uni01F5uni01F6uni01F7uni01F8uni01F9AringacutearingacuteAEacuteaeacuteOslashacuteoslashacuteuni0200uni0201uni0202uni0203uni0204uni0205uni0206uni0207uni0208uni0209uni020Auni020Buni020Cuni020Duni020Euni020Funi0210uni0211uni0212uni0213uni0214uni0215uni0216uni0217uni0218uni0219uni021Auni021Buni021Cuni021Duni021Euni021Funi0220uni0221uni0222uni0223uni0224uni0225uni0226uni0227uni0228uni0229uni022Auni022Buni022Cuni022Duni022Euni022Funi0230uni0231uni0232uni0233uni0234uni0235uni0236uni0237uni0238uni0239uni023Auni023Buni023Cuni023Duni023Euni023Funi0240uni0241uni0242uni0243uni0244uni0245uni0246uni0247uni0248uni0249uni024Auni024Buni024Cuni024Duni024Euni024Funi0250uni0251uni0252uni0253uni0254uni0255uni0256uni0257uni0258uni0259uni025Auni025Buni025Cuni025Duni025Euni025Funi0260uni0261uni0262uni0263uni0264uni0265uni0266uni0267uni0268uni0269uni026Auni026Buni026Cuni026Duni026Euni026Funi0270uni0271uni0272uni0273uni0274uni0275uni0276uni0277uni0278uni0279uni027Auni027Buni027Cuni027Duni027Euni027Funi0280uni0281uni0282uni0283uni0284uni0285uni0286uni0287uni0288uni0289uni028Auni028Buni028Cuni028Duni028Euni028Funi0290uni0291uni0292uni0293uni0294uni0295uni0296uni0297uni0298uni0299uni029Auni029Buni029Cuni029Duni029Euni029Funi02A0uni02A1uni02A2uni02A3uni02A4uni02A5uni02A6uni02A7uni02A8uni02A9uni02AAuni02ABuni02ACuni02ADuni02AEuni02AFuni02B0uni02B1uni02B2uni02B3uni02B4uni02B5uni02B6uni02B7uni02B8uni02B9uni02BAuni02BBuni02BCuni02BDuni02BEuni02BFuni02C4uni02C8uni02C9uni02CAuni02CBuni02CCuni02CDuni02CEuni02CFuni02D0uni02D1uni02DEuni02E0uni02E1uni02E2uni02E3uni02F7gravecombacutecombuni0302tildecombuni0304uni0305uni0306uni0307uni0308hookabovecombuni030Auni030Buni030Cuni030Duni030Euni030Funi0310uni0311uni0312uni0313uni0314uni0315uni0316uni0317uni0318uni0319uni031Auni031Buni031Cuni031Duni031Euni031Funi0320uni0321uni0322dotbelowcombuni0324uni0325uni0326uni0327uni0328uni0329uni032Auni032Buni032Cuni032Duni032Euni032Funi0330uni0331uni0332uni0333uni0334uni0335uni0336uni0337uni0338uni0339uni033Auni033Buni033Cuni033Duni033Euni0340uni0341uni0342uni0343uni0344uni0345uni0351uni0353uni0357uni035Duni0361uni0364uni0374uni037Auni037EtonosdieresistonosAlphatonosanoteleiaEpsilontonosEtatonosIotatonosOmicrontonosUpsilontonosOmegatonosiotadieresistonosAlphaBetaGammauni0394EpsilonZetaEtaThetaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonPhiChiPsiuni03A9IotadieresisUpsilondieresisalphatonosepsilontonosetatonosiotatonosupsilondieresistonosalphabetagammadeltaepsilonzetaetathetaiotakappalambdauni03BCnuxiomicronpirhosigma1sigmatauupsilonphichipsiomegaiotadieresisupsilondieresisomicrontonosupsilontonosomegatonostheta1Upsilon1uni03D3uni03D4phi1omega1uni03D9uni03DBuni03DCuni03DDuni03E1uni03F0uni03F1uni03F2uni03F9uni03FBuni0400uni0401uni0402uni0403uni0404uni0405uni0406uni0407uni0408uni0409uni040Auni040Buni040Cuni040Duni040Euni040Funi0410uni0411uni0412uni0413uni0414uni0415uni0416uni0417uni0418uni0419uni041Auni041Buni041Cuni041Duni041Euni041Funi0420uni0421uni0422uni0423uni0424uni0425uni0426uni0427uni0428uni0429uni042Auni042Buni042Cuni042Duni042Euni042Funi0430uni0431uni0432uni0433uni0434uni0435uni0436uni0437uni0438uni0439uni043Auni043Buni043Cuni043Duni043Euni043Funi0440uni0441uni0442uni0443uni0444uni0445uni0446uni0447uni0448uni0449uni044Auni044Buni044Cuni044Duni044Euni044Funi0450uni0451uni0452uni0453uni0454uni0455uni0456uni0457uni0458uni0459uni045Auni045Buni045Cuni045Duni045Euni045Funi0462uni0463uni0470uni0472uni0473uni0474uni0475uni0476uni0477uni0490uni0491uni04AEuni04AFuni04B0uni04B1uni04C0uni04C1uni04C2uni04D0uni04D1uni04D2uni04D3uni04D4uni04D5uni04D6uni04D7uni04D8uni04D9uni04DAuni04DBuni04DCuni04DDuni04DEuni04DFuni04E0uni04E1uni04E2uni04E3uni04E4uni04E5uni04E6uni04E7uni04E8uni04E9uni04EAuni04EBuni04ECuni04EDuni04EEuni04EFuni04F0uni04F1uni04F2uni04F3uni04F4uni04F5uni04F8uni04F9uni0510uni0511uni051Auni051Buni051Cuni051Duni1D00uni1D01uni1D02uni1D04uni1D05uni1D06uni1D07uni1D0Auni1D0Buni1D0Cuni1D0Duni1D0Funi1D18uni1D1Buni1D1Cuni1D20uni1D21uni1D22uni1D26uni1D27uni1D28uni1D29uni1D2Auni1D2Cuni1D2Duni1D2Euni1D30uni1D31uni1D33uni1D34uni1D35uni1D36uni1D37uni1D38uni1D39uni1D3Auni1D3Cuni1D3Euni1D3Funi1D40uni1D41uni1D42uni1D43uni1D47uni1D48uni1D49uni1D4Auni1D4Duni1D4Funi1D50uni1D51uni1D52uni1D56uni1D57uni1D58uni1D5Buni1D62uni1D63uni1D64uni1D65uni1D9Cuni1DA0uni1DBBuni1DC4uni1DD3uni1E00uni1E01uni1E02uni1E03uni1E04uni1E05uni1E06uni1E07uni1E08uni1E09uni1E0Auni1E0Buni1E0Cuni1E0Duni1E0Euni1E0Funi1E10uni1E11uni1E12uni1E13uni1E14uni1E15uni1E16uni1E17uni1E18uni1E19uni1E1Auni1E1Buni1E1Cuni1E1Duni1E1Euni1E1Funi1E20uni1E21uni1E22uni1E23uni1E24uni1E25uni1E26uni1E27uni1E28uni1E29uni1E2Auni1E2Buni1E2Cuni1E2Duni1E2Euni1E2Funi1E30uni1E31uni1E32uni1E33uni1E34uni1E35uni1E36uni1E37uni1E38uni1E39uni1E3Auni1E3Buni1E3Cuni1E3Duni1E3Euni1E3Funi1E40uni1E41uni1E42uni1E43uni1E44uni1E45uni1E46uni1E47uni1E48uni1E49uni1E4Auni1E4Buni1E4Cuni1E4Duni1E4Euni1E4Funi1E50uni1E51uni1E52uni1E53uni1E54uni1E55uni1E56uni1E57uni1E58uni1E59uni1E5Auni1E5Buni1E5Cuni1E5Duni1E5Euni1E5Funi1E60uni1E61uni1E62uni1E63uni1E64uni1E65uni1E66uni1E67uni1E68uni1E69uni1E6Auni1E6Buni1E6Cuni1E6Duni1E6Euni1E6Funi1E70uni1E71uni1E72uni1E73uni1E74uni1E75uni1E76uni1E77uni1E78uni1E79uni1E7Auni1E7Buni1E7Cuni1E7Duni1E7Euni1E7FWgravewgraveWacutewacuteWdieresiswdieresisuni1E86uni1E87uni1E88uni1E89uni1E8Auni1E8Buni1E8Cuni1E8Duni1E8Euni1E8Funi1E90uni1E91uni1E92uni1E93uni1E94uni1E95uni1E96uni1E97uni1E98uni1E99uni1E9Auni1E9Buni1E9Cuni1E9Duni1E9Euni1E9Funi1EA0uni1EA1uni1EA2uni1EA3uni1EA4uni1EA5uni1EA6uni1EA7uni1EA8uni1EA9uni1EAAuni1EABuni1EACuni1EADuni1EAEuni1EAFuni1EB0uni1EB1uni1EB2uni1EB3uni1EB4uni1EB5uni1EB6uni1EB7uni1EB8uni1EB9uni1EBAuni1EBBuni1EBCuni1EBDuni1EBEuni1EBFuni1EC0uni1EC1uni1EC2uni1EC3uni1EC4uni1EC5uni1EC6uni1EC7uni1EC8uni1EC9uni1ECAuni1ECBuni1ECCuni1ECDuni1ECEuni1ECFuni1ED0uni1ED1uni1ED2uni1ED3uni1ED4uni1ED5uni1ED6uni1ED7uni1ED8uni1ED9uni1EDAuni1EDBuni1EDCuni1EDDuni1EDEuni1EDFuni1EE0uni1EE1uni1EE2uni1EE3uni1EE4uni1EE5uni1EE6uni1EE7uni1EE8uni1EE9uni1EEAuni1EEBuni1EECuni1EEDuni1EEEuni1EEFuni1EF0uni1EF1Ygraveygraveuni1EF4uni1EF5uni1EF6uni1EF7uni1EF8uni1EF9uni1EFAuni1EFBuni1EFCuni1EFDuni1EFEuni1EFFuni1F00uni1F01uni1F02uni1F03uni1F04uni1F05uni1F06uni1F07uni1F08uni1F09uni1F0Auni1F0Buni1F0Cuni1F0Duni1F0Euni1F0Funi1F10uni1F11uni1F12uni1F13uni1F14uni1F15uni1F18uni1F19uni1F1Auni1F1Buni1F1Cuni1F1Duni1F20uni1F21uni1F22uni1F23uni1F24uni1F25uni1F26uni1F27uni1F28uni1F29uni1F2Auni1F2Buni1F2Cuni1F2Duni1F2Euni1F2Funi1F30uni1F31uni1F32uni1F33uni1F34uni1F35uni1F36uni1F37uni1F38uni1F39uni1F3Auni1F3Buni1F3Cuni1F3Duni1F3Euni1F3Funi1F40uni1F41uni1F42uni1F43uni1F44uni1F45uni1F48uni1F49uni1F4Auni1F4Buni1F4Cuni1F4Duni1F50uni1F51uni1F52uni1F53uni1F54uni1F55uni1F56uni1F57uni1F59uni1F5Buni1F5Duni1F5Funi1F60uni1F61uni1F62uni1F63uni1F64uni1F65uni1F66uni1F67uni1F68uni1F69uni1F6Auni1F6Buni1F6Cuni1F6Duni1F6Euni1F6Funi1F70uni1F71uni1F72uni1F73uni1F74uni1F75uni1F76uni1F77uni1F78uni1F79uni1F7Auni1F7Buni1F7Cuni1F7Duni1F80uni1F81uni1F82uni1F83uni1F84uni1F85uni1F86uni1F87uni1F88uni1F89uni1F8Auni1F8Buni1F8Cuni1F8Duni1F8Euni1F8Funi1F90uni1F91uni1F92uni1F93uni1F94uni1F95uni1F96uni1F97uni1F98uni1F99uni1F9Auni1F9Buni1F9Cuni1F9Duni1F9Euni1F9Funi1FA0uni1FA1uni1FA2uni1FA3uni1FA4uni1FA5uni1FA6uni1FA7uni1FA8uni1FA9uni1FAAuni1FABuni1FACuni1FADuni1FAEuni1FAFuni1FB0uni1FB1uni1FB2uni1FB3uni1FB4uni1FB6uni1FB7uni1FB8uni1FB9uni1FBAuni1FBBuni1FBCuni1FBDuni1FBEuni1FBFuni1FC0uni1FC1uni1FC2uni1FC3uni1FC4uni1FC6uni1FC7uni1FC8uni1FC9uni1FCAuni1FCBuni1FCCuni1FCDuni1FCEuni1FCFuni1FD0uni1FD1uni1FD2uni1FD3uni1FD6uni1FD7uni1FD8uni1FD9uni1FDAuni1FDBuni1FDDuni1FDEuni1FDFuni1FE0uni1FE1uni1FE2uni1FE3uni1FE4uni1FE5uni1FE6uni1FE7uni1FE8uni1FE9uni1FEAuni1FEBuni1FECuni1FEDuni1FEEuni1FEFuni1FF2uni1FF3uni1FF4uni1FF6uni1FF7uni1FF8uni1FF9uni1FFAuni1FFBuni1FFCuni1FFDuni1FFEuni2000uni2001uni2002uni2003uni2004uni2005uni2006uni2007uni2008uni2009uni200Auni200Buni200Cuni200Duni200Euni200Funi2010uni2011uni2015uni2016uni2027uni202Aminuteseconduni2034uni2035uni2036uni2037exclamdbluni203Duni203Euni2047uni2048uni2049uni204Buni204Euni2057uni2060uni2070uni2071uni2074uni2075uni2076uni2077uni2078uni2079uni207Auni207Buni207Cuni207Duni207Euni207Funi2080uni2081uni2082uni2083uni2084uni2085uni2086uni2087uni2088uni2089uni208Auni208Buni208Cuni208Duni208Euni2090uni2091uni2092uni2093uni2094uni2095uni2096uni2097uni2098uni2099uni209Auni209Buni209Cuni20A5uni20A8dongEurouni20B2uni20B9uni2100uni2101uni2103uni2105uni2106uni2109uni210Euni2112uni2113uni2116prescriptionuni211Funi2120uni2123Omegauni2127uni212Auni212Buni2139uni214Buni2150uni2160uni2161uni2162uni2163uni2164uni2165uni2166uni2167uni2168uni2169uni216Auni216Buni216Cuni216Duni216Euni216Funi2170uni2171uni2172uni2173uni2174uni2175uni2176uni2177uni2178uni2179uni217Auni217Buni217Cuni217Duni217Euni217Farrowleftarrowuparrowrightarrowdownarrowbotharrowupdnuni2196uni2197uni2198uni2199uni219Euni219Funi21A0uni21A1uni21A2arrowdblleftarrowdbluparrowdblrightarrowdbldownuni21DAuni21DBuni21DCuni21DDDeltagradientproductuni2210uni2213uni2215uni2216uni2219infinityuni2223uni2224uni2225uni2226uni2236similaruni2241notequallessequalgreaterequaluni226Auni226Buni226Euni226Fdotmathuni22EFuni2303angleleftanglerightuni2474uni2475uni2476uni2477uni2478uni2479uni247Auni247Buni247Cuni247Duni247Euni247Funi2480uni2481uni2482uni2483uni2484uni2485uni2486uni2487uni2488uni2489uni248Auni248Buni248Cuni248Duni248Euni248Funi2490uni2491uni2492uni2493uni2494uni2495uni2496uni2497uni2498uni2499uni249Auni249Buni249Cuni249Duni249Euni249Funi24A0uni24A1uni24A2uni24A3uni24A4uni24A5uni24A6uni24A7uni24A8uni24A9uni24AAuni24ABuni24ACuni24ADuni24AEuni24AFuni24B0uni24B1uni24B2uni24B3uni24B4uni24B5openbulletuni2619uni261Cuni261Duni261Euni267Euni270Auni270Buni270Cuni2753uni2757uni2766uni2767uni27E8uni27E9uni27EAuni27EBuni2A74uni2A75uni2A76uni2B45uni2B46uni2C60uni2C61uni2C62uni2C63uni2C64uni2C65uni2C66uni2C67uni2C68uni2C69uni2C6Auni2C6Buni2C6Cuni2C6Duni2C6Euni2C6Funi2C70uni2C71uni2C72uni2C73uni2C74uni2C75uni2C76uni2C77uni2C78uni2C79uni2C7Auni2C7Buni2C7Cuni2C7Duni2C7Euni2C7Funi2E18uni2E22uni2E23uni2E24uni2E25uni2E28uni2E29uni2E2Euni2E3Auni2E3Buni3003uni3008uni3009uni300Auni300BuniA726uniA727uniA728uniA729uniA72AuniA72BuniA72CuniA72DuniA72EuniA72FuniA730uniA731uniA742uniA743uniA749uniA751uniA753uniA757uniA759uniA76BuniA78DuniA78EuniA7AAuniA7FBuniA7FCuniA7FDuniA7FEuniA7FFuniE001uniE002uniE8BFuniF6BEuniFB00uniFB01uniFB02uniFB03uniFB04uniFB05uniFB06uniFEFFuniFFFDu1F1E6u1F1E7u1F1E8u1F1E9u1F1EAu1F1EBu1F1ECu1F1EDu1F1EEu1F1EFu1F1F0u1F1F1u1F1F2u1F1F3u1F1F4u1F1F5u1F1F6u1F1F7u1F1F8u1F1F9u1F1FAu1F1FBu1F1FCu1F1FDu1F1FEu1F1FFu1F44Cu1F44DAdieresis.deuOdieresis.deuUdieresis.deuuni030C.capuni0302.capuni0302.flatuni030C.flatacutecomb.capgravecomb.capuni030C.alt1tildecomb.capuni0306.capuni0308.capuni030B.capuni0304.capquotesingle.altuni0311.capuni030A.capuni0307.caplongs_longs_llongs_longs_ilongs_ilongs_longs.longlongs_lT_hc_hc_kone.lnumtwo.lnumthree.lnumfour.lnumfive.lnumsix.lnumseven.lnumeight.lnumnine.lnumzero.lnumlongs_sgermandbls.altc_tuni0327.capuni0328.capf_f.longt_tt_z.altL.scriptQ.longi.TRKscf.longzero.taboldstyleone.taboldstyletwo.taboldstylethree.taboldstylefour.taboldstylefive.taboldstylesix.taboldstyleseven.taboldstyleeight.taboldstylenine.taboldstyleone.tabliningtwo.tabliningthree.tabliningfour.tabliningfive.tabliningsix.tabliningseven.tabliningeight.tabliningnine.tabliningzero.tabliningEuro.tabliningf_hf_kf_bf_tf_jlongs_jlongs_blongs_hlongs_klongs.longlongs_longsu.LATmedii.TRKU.LATbullet.01bullet.03bullet.02f.DEUexclam.subsquotedbl.subsnumbersign.subsdollar.subspercent.subsampersand.subsquotesingle.subsparenleft.subsparenright.subsasterisk.subsplus.subscomma.subshyphen.subsperiod.subsslash.subszero.subsone.substwo.substhree.subsfour.subsfive.subssix.subsseven.subseight.subsnine.subscolon.subssemicolon.subsless.subsequal.subsgreater.subsquestion.subsat.subsA.subsB.subsC.subsD.subsE.subsF.subsG.subsH.subsI.subsJ.subsK.subsL.subsM.subsN.subsO.subsP.subsQ.subsR.subsS.subsT.subsU.subsV.subsW.subsX.subsY.subsZ.subsbracketleft.subsbackslash.subsbracketright.subsasciicircum.subsunderscore.subsgrave.subsa.subsb.subsc.subsd.subse.subsf.subsg.subsh.subsi.subsj.subsk.subsl.subsm.subsn.subso.subsp.subsq.subsr.subss.subst.subsu.subsv.subsw.subsx.subsy.subsz.subsbraceleft.subsbar.subsbraceright.subsasciitilde.subsbrokenbar.subssection.subsparagraph.subsegrave.subsuni2016.subsdagger.subsdaggerdbl.subsexclam.sinfquotedbl.sinfnumbersign.sinfdollar.sinfpercent.sinfampersand.sinfquotesingle.sinfparenleft.sinfparenright.sinfasterisk.sinfplus.sinfcomma.sinfhyphen.sinfperiod.sinfslash.sinfzero.sinfone.sinftwo.sinfthree.sinffour.sinffive.sinfsix.sinfseven.sinfeight.sinfnine.sinfcolon.sinfsemicolon.sinfless.sinfequal.sinfgreater.sinfquestion.sinfat.sinfA.sinfB.sinfC.sinfD.sinfE.sinfF.sinfG.sinfH.sinfI.sinfJ.sinfK.sinfL.sinfM.sinfN.sinfO.sinfP.sinfQ.sinfR.sinfS.sinfT.sinfU.sinfV.sinfW.sinfX.sinfY.sinfZ.sinfbracketleft.sinfbackslash.sinfbracketright.sinfasciicircum.sinfunderscore.sinfgrave.sinfa.sinfb.sinfc.sinfd.sinfe.sinff.sinfg.sinfh.sinfi.sinfj.sinfk.sinfl.sinfm.sinfn.sinfo.sinfp.sinfq.sinfr.sinfs.sinft.sinfu.sinfv.sinfw.sinfx.sinfy.sinfz.sinfbraceleft.sinfbar.sinfbraceright.sinfasciitilde.sinfbrokenbar.sinfsection.sinfparagraph.sinfegrave.sinfuni2016.sinfdagger.sinfdaggerdbl.sinfexclam.ordnquotedbl.ordnnumbersign.ordndollar.ordnpercent.ordnampersand.ordnquotesingle.ordnparenleft.ordnparenright.ordnasterisk.ordnplus.ordncomma.ordnhyphen.ordnperiod.ordnslash.ordnzero.ordnone.ordntwo.ordnthree.ordnfour.ordnfive.ordnsix.ordnseven.ordneight.ordnnine.ordncolon.ordnsemicolon.ordnless.ordnequal.ordngreater.ordnquestion.ordnat.ordnA.ordnB.ordnC.ordnD.ordnE.ordnF.ordnG.ordnH.ordnI.ordnJ.ordnK.ordnL.ordnM.ordnN.ordnO.ordnP.ordnQ.ordnR.ordnS.ordnT.ordnU.ordnV.ordnW.ordnX.ordnY.ordnZ.ordnbracketleft.ordnbackslash.ordnbracketright.ordnasciicircum.ordnunderscore.ordngrave.ordna.ordnb.ordnc.ordnd.ordne.ordnf.ordng.ordnh.ordni.ordnj.ordnk.ordnl.ordnm.ordnn.ordno.ordnp.ordnq.ordnr.ordns.ordnt.ordnu.ordnv.ordnw.ordnx.ordny.ordnz.ordnbraceleft.ordnbar.ordnbraceright.ordnasciitilde.ordnbrokenbar.ordnsection.ordnparagraph.ordnegrave.ordnuni2016.ordndagger.ordndaggerdbl.ordnexclam.supsquotedbl.supsnumbersign.supsdollar.supspercent.supsampersand.supsquotesingle.supsparenleft.supsparenright.supsasterisk.supsplus.supscomma.supshyphen.supsperiod.supsslash.supszero.supsone.supstwo.supsthree.supsfour.supsfive.supssix.supsseven.supseight.supsnine.supscolon.supssemicolon.supsless.supsequal.supsgreater.supsquestion.supsat.supsA.supsB.supsC.supsD.supsE.supsF.supsG.supsH.supsI.supsJ.supsK.supsL.supsM.supsN.supsO.supsP.supsQ.supsR.supsS.supsT.supsU.supsV.supsW.supsX.supsY.supsZ.supsbracketleft.supsbackslash.supsbracketright.supsasciicircum.supsunderscore.supsgrave.supsa.supsb.supsc.supsd.supse.supsf.supsg.supsh.supsi.supsj.supsk.supsl.supsm.supsn.supso.supsp.supsq.supsr.supss.supst.supsu.supsv.supsw.supsx.supsy.supsz.supsbraceleft.supsbar.supsbraceright.supsasciitilde.supsbrokenbar.supssection.supsparagraph.supsegrave.supsuni2016.supsdagger.supsdaggerdbl.supsexclam.scquotedbl.scnumbersign.scdollar.scpercent.scampersand.scquotesingle.scparenleft.scparenright.scasterisk.scplus.sccomma.schyphen.scperiod.scslash.sczero.scone.sctwo.scthree.scfour.scfive.scsix.scseven.sceight.scnine.sccolon.scsemicolon.scless.scequal.scgreater.scquestion.scat.scA.scB.scC.scD.scE.scF.scG.scH.scI.scJ.scK.scL.scM.scN.scO.scP.scQ.scR.scS.scT.scU.scV.scW.scX.scY.scZ.scbracketleft.scbackslash.scbracketright.scasciicircum.scunderscore.scgrave.sca.scb.scc.scd.sce.scf.scg.sch.sci.scj.sck.scl.scm.scn.sco.scp.scq.scr.scs.sct.scu.scv.scw.scx.scy.scz.scbraceleft.scbar.scbraceright.scasciitilde.scexclamdown.sccent.scsterling.sccurrency.scyen.scbrokenbar.scsection.scdieresis.sccopyright.scordfeminine.scguillemotleft.sclogicalnot.scuni00AD.scregistered.scmacron.scdegree.scplusminus.scacute.scparagraph.scperiodcentered.scuni0327.scordmasculine.scguillemotright.scquestiondown.scAgrave.scAacute.scAcircumflex.scAtilde.scAdieresis.scAring.scAE.scCcedilla.scEgrave.scEacute.scEcircumflex.scEdieresis.scIgrave.scIacute.scIcircumflex.scIdieresis.scEth.scNtilde.scOgrave.scOacute.scOcircumflex.scOtilde.scOdieresis.scmultiply.scOslash.scUgrave.scUacute.scUcircumflex.scUdieresis.scYacute.scThorn.scgermandbls.scagrave.scaacute.scacircumflex.scatilde.scadieresis.scaring.scae.scccedilla.scegrave.sceacute.scecircumflex.scedieresis.scigrave.sciacute.scicircumflex.scidieresis.sceth.scntilde.scograve.scoacute.scocircumflex.scotilde.scodieresis.scdivide.scoslash.scugrave.scuacute.scucircumflex.scudieresis.scyacute.scthorn.scydieresis.scAmacron.scamacron.scAbreve.scabreve.scAogonek.scaogonek.scCacute.sccacute.scCcircumflex.scccircumflex.scCdotaccent.sccdotaccent.scCcaron.scccaron.scDcaron.scdcaron.scDcroat.scdcroat.scEmacron.scemacron.scEbreve.scebreve.scEdotaccent.scedotaccent.scEogonek.sceogonek.scEcaron.scecaron.scGcircumflex.scgcircumflex.scGbreve.scgbreve.scGdotaccent.scgdotaccent.scuni0122.scuni0123.scHcircumflex.schcircumflex.scHbar.schbar.scItilde.scitilde.scImacron.scimacron.scIbreve.scibreve.scIogonek.sciogonek.scIdotaccent.scdotlessi.scIJ.scij.scJcircumflex.scjcircumflex.scuni0136.scuni0137.sckgreenlandic.scLacute.sclacute.scuni013B.scuni013C.scLcaron.sclcaron.scLdot.scldot.scLslash.sclslash.scNacute.scnacute.scuni0145.scuni0146.scNcaron.scncaron.scnapostrophe.scEng.sceng.scOmacron.scomacron.scObreve.scobreve.scOhungarumlaut.scohungarumlaut.scOE.scoe.scRacute.scracute.scuni0156.scuni0157.scRcaron.scrcaron.scSacute.scsacute.scScircumflex.scscircumflex.scScedilla.scscedilla.scScaron.scscaron.scuni0162.scuni0163.scTcaron.sctcaron.scTbar.sctbar.scUtilde.scutilde.scUmacron.scumacron.scUbreve.scubreve.scUring.scuring.scUhungarumlaut.scuhungarumlaut.scUogonek.scuogonek.scWcircumflex.scwcircumflex.scYcircumflex.scycircumflex.scYdieresis.scZacute.sczacute.scZdotaccent.sczdotaccent.scZcaron.sczcaron.sclongs.scf_f_bf_f_hf_f_jf_f_kf_f_tlongs_longs_blongs_longs_hlongs_longs_jlongs_longs_klongs_longs_tv.LATu.LATv.LATmediuni0306.cyruni0306.cyrcapuni0431.SRBuni0434.altuni043B.altuni0459.altuni0414.altuni041B.altuni0409.altgravecomb.stackacutecomb.stackuni0302.stacktildecomb.stackuni0304.stackuni0306.stackuni0307.stackhookabovecomb.stackuni030A.stackuni030C.stackgravecomb.flatacutecomb.flatuni0316.capuni0317.capdotbelowcomb.capuni0324.capuni0325.capuni032C.capuni032D.capuni032E.capuni032F.capuni0330.capuni0331.capuni030F.capat.01J.histj.histquoteright.01U.LATscu.LATscone.01one.taboldstyle01Q_yQ.shortQ.lowq.longscuni2619.01uni2767.01paragraph.01f_f.shortuni1E1F.shortuni1E9D.shortlongs.shortuni1E9B.shortlongs_longs.shortuni1E9C.shortf.shortguilsinglleft.altguilsinglright.altguillemotleft.altguillemotright.altbeta.ipagravecomb.grkuni0313.grkuni0314.grkuni0342.altgravecomb.grkstackuni0308.grkstackuni0313.grkstackuni0314.grkstackacutecomb.grkacutecomb.capstackgravecomb.capstacktildecomb.capstackhookabovecomb.capacutecomb.grkstackspace.stackuni0345.cap1uni0345.cap2uni0345.sc1uni0345.capalpha.scbeta.scgamma.scdelta.scepsilon.sczeta.sceta.sctheta.sciota.sckappa.sclambda.scuni03BC.scnu.scxi.scomicron.scpi.scrho.scsigma.sctau.scupsilon.scphi.scchi.scpsi.scomega.scAlpha.scBeta.scGamma.scuni0394.scEpsilon.scZeta.scEta.scTheta.scIota.scKappa.scLambda.scMu.scNu.scXi.scOmicron.scPi.scRho.scSigma.scTau.scUpsilon.scPhi.scChi.scPsi.scuni03A9.scf_ff_if_lf_f_if_f_llongs_ts_tgermandbls.sc1sigma1.scgravecomb.scacutecomb.scuni0302.sctildecomb.scuni0304.scuni0306.scuni0307.scuni0308.schookabovecomb.scuni030A.scuni030B.scuni030C.scuni0311.scuni0312.scuni0313.scuni0314.scuni0315.scuni0342.scuni0345.scgravecomb.stackscacutecomb.stackscuni0302.stacksctildecomb.stackscuni0304.stackscuni0306.stackscuni0307.stackschookabovecomb.stackscuni030A.stackscuni030C.stackscgravecomb.grkscuni0313.grkscuni0314.grkscuni0342.altscgravecomb.grkstackscuni0308.grkstackscuni0313.grkstackscuni0314.grkstackscacutecomb.grkscacutecomb.grkstackscalphatonos.scepsilontonos.scetatonos.sciotatonos.scomicrontonos.scupsilontonos.scomegatonos.sciotadieresistonos.sciotadieresis.scupsilondieresis.scupsilondieresistonos.scAlphatonos.scEpsilontonos.scEtatonos.scIotatonos.scOmicrontonos.scUpsilontonos.scOmegatonos.scIotadieresis.scUpsilondieresis.scuni2010.capuni2011.capfiguredash.capendash.capemdash.caphyphen.capgermandbls.alt1germandbls.alt2germandbls.sc2q_uniA76Bregistered.supsa.01g.01periodcentered.CATperiodcentered.CATucperiodcentered.CATscj.dotlessi.dotlessh.01k.01hcircumflex.01uni01E9.01uni021F.01uni1E23.01uni1E27.01uni1E31.01uni019F.altuni0275.altf._ff._if._ascb.f_h.f_k.f_l.f_t.f_thorn.f_longs._longslongs._asclongs._itheta.ipalambda.ipachi.ipauni030C.altuni030C.altcap1uni030C.altcapu1F1EC_u1F1E7u1F1EB_u1F1F7u1F1EA_u1F1F8u1F1E8_u1F1F3u1F1F3_u1F1F4A.pcB.pcC.pcD.pcE.pcF.pcG.pcH.pcI.pcJ.pcK.pcL.pcM.pcN.pcO.pcP.pcQ.pcR.pcS.pcT.pcU.pcV.pcW.pcX.pcY.pcZ.pca.pcb.pcc.pcd.pce.pcf.pcg.pch.pci.pcj.pck.pcl.pcm.pcn.pco.pcp.pcq.pcr.pcs.pct.pcu.pcv.pcw.pcx.pcy.pcz.pce.xtex1e.xtex2e.xtex3chi.a1chi.a2chi.a3chi.a4chi.a5chi.a6chi.a7chi.a80.016Created by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)EB Garamond 12 RegularEB Garamond 12h  !"#$%&'()*+,-./0123456789:;<=>?@|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abgdfj}srx{     e !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@A~BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:oAuiwvpqtyklc      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  #&U%6=Wj|1G[jNsBb{1Uq.?T\q>[ 1 H h ^ 1 W |  0 D c )Lg1AR,HbKp/C4`*^N)Oq%X?qnJw3p !!&!L!!!!"("Z"""##$$?$m$%&s&&&&''<'_'''((6(k(() )@)r* **++6++,,G,,-'-N-v.//00+0M0o01<1222:2z222344F4i44455/5N6667&7T777899L9u999::H;n<2>???AAAB"CCCD/DZDDDE'EhEEFGbGGGGH,HLH{HHHII)IJtJKwLLoLMNNO=P PQxRuRRSTWUUV1W WoX Y}Z[)\J]^t_@_h__`aDabcd[deef)fg|h4hZhzi2ijkbl_mm7nnopqrwsssttzttu!uwuuvvFvvvw#wFwjwwwxx^xxy7y|yz zWz{{C{{|)|x}L~x~)T@]W [)X4p :h._1k Fm{]~\1g2 Ev' 7\1 92RQ)@uP1DxLnM\ ºĩmyǔdȈ_`ZV̷͜@έZ_1Ҁ@'Ւ#֬ rס%ٲd5<%mU9M#7Jkfe(9Sj|&:M\k~2h{<u3s"3n$6vHZj' 8J> 0AZ 4Bc*Ni`t4f 9bQm a       {  'd 'Uo.}YE 2 _ !_!!!""'"I##%#>#Z$:$^$t$$%f%z&K&d'w()R)}*?*m+[,S,m- -<-\.L.s...//%/00 0:0i00001 1!123)4I55/5i56q7H7|7889^9999:< <=4=Z=>Z?u@s@A A=AZArAABqCC1DEF*F>FFGG2GhGGH0HfHHHIIIIIJ0JjJJJJK)KRKKKKL9LsLMM'MJMvMMMN"NONNNOOOOPP P]QQQQQRR*RHRlRRRRRS SS>SLS{SSST-TiTTTTTUU)UQUpUUUUVV'V=VzWWXXYkZQ[W[[\A\]z^^3^F^h^|^_j``a!aUaaab:bobbc cSc~ccd d7djddde)eoeefHf~ffg:g~ghh0h]hhii*iMiziiijjGjsjjkkDkpkkkll<l\lllmmFmkmmnn?npnnoo/oZoooppXppq;qxqqr&rYrrrs#sUssstDtxtttuuKu~uuv9vkvvvwwCwlwwwxxYxxxy1yxyzz_zzzz{{C{k{{{||6|]||||}}A}a}}}}~~L~t~~~%G 5[.j%o1m"d5sL OgS,O| [DNQBp7p 8t']Dhgf%fbtW+{%m1f;5i JH"a)tFw$NQ|$d:zD[)g7Z}.h7yIsIt@l>)}$v6{q R<<xPE QÞ7ď-mžSƣ2aǐǿ-L}>ɆFoʘʿ 7bˋF̶̔@d͓1uί qϗϼ7_ЇЙ>zBhҍҟұҳҶҸһҾ $F]rӈӝӺԕջ,֣֤.Uhׅ׬ lؠQٖ_ڄڲڳGܺ3Iq݌ݞݱeߏ+BNc3Lb{ .LM 8#nap%Fq3PfNu<Na3ndZC3= .  Ka t{.>Skc"4Ygz)kR^ UD$S0Y>-<A\  M  !!V!!""`"""#(#j#$%*>+,U/378c89:;;;-;F;;;>=@@AARBBCDtEFGHIJK)LGM6MNhOPRRSTrUEUVW'WDWTWXY"YYYYYZZ,ZZZZ[[![;[T\[]@^5^_~`(`ab{cicddeefgehiij{k lJmOmo"opqrrrs2s\sst tCttttu&u<uZuuuuuv v#vAvmvvvvww3wIw`wuwwww{"Tf-=~oS!-LOw  P.&eSe,Jtt%)Dh#:Tl'9L^sBXw(BQr %Ie@]v 1@Tcw'Tq8Pe} !<_t"6Uye}&Yk}*>d/Ghu@Ws.Wu9Ri~(<Z~C]!Ih{(<O\q'v R+>Pao?U Bn<^x >Ywž /DUixÎâô Mkċ8QhłŚŸ,InƄƜƱ7LkǐǷ|ȔȮ?sɅɗɪɼ3I^ʄʮ2Tmˎ˜˷/l̠̃2F]͆ͤDi΃Κί4HZnόϱ1yД(@^чѧѻ*BWm҂Җңҹ6]q"d|ԡOՍ՞կ07Qdv֖Kauׄ״ -9g،دBeي٥ٹ/Usڌڪ "7HXk~ۓۛ۰۾8Nlܒܵ 5S݀ݦ"F\sވޙީ޼3L{ߒߵ#8b!;Ot/a EG:Dt~:^y!SBdCgBo4W}7R{Cw3Vy;];rP)c7_!Dg'JmGu)n%[/V})VP(^*\@h,NpAnDm5Z f  < &0DX|1 .GYk| 7G_OcOey Z!8!##,##$!%!& &(&:&L&a&v'Q'a's'''''''(((R(f(v(y((((()$)O)e)))))***I*o**+ +9++,,0,@,\,r,,,--5-H-c-----.....//-/@/h/x///0040{001622:2L2]2o222222333*3>3Q3`3o333333344!4/4C4\4n4~44444445 55L555566?6v6667-7b77778 8G8p8~8888889'9n99:(:W:f:v:::::;;B;k;;;&>?A?@ALABeBCxCCDEEFF.GbGLN@WWWWXX=X_XXXXXXY"YEYcY|YY[[+[B[W[h[x[[[[[\\E\h\\\\\]]+]N]l]]]_ _5_L_a_r____``bc,degh*irk6 $m$; g}  !LEnR q`!qߋyppwsp OP|! ! o]\Pw0)" I# p$ % exlT[ & ' h( ) o** p}w0z~}+ p, + p, |Jw3۩ / - W[. / sa|m0 _1 P|2 IUwT3 HTwb4 0qvv H5 6 07 8 vz9 '-': r>l>; }< *\= |1> b? c@ AvA Ro]I1B C D 4vtX E uyx~| ͋ 颔m]l^%R1,==Q|ŬQF }|}G gvH _~PESYI J K L vM N mNt2O }; < < '-&j P E: vyQ # R Y?R v]~S } c f )T U V   W X XiFdY =Z ݆oƧ^Vz[ f\ ] ^ $|B_ 3e ` 6a cwzAfb c wpoNyd e f g }}}4lh i Ά>j 0k X\2l M'm ㆳc߭xfn o )v%Ipsp q hr vXxs t }su v Æzt{M^w x y Ư Uz <{ mvm_x| } ,~ l{^s Bر  }ܬ)V  Dv 8vO! g ݆7 ̵{ \֮*R *\ \ܧeoR  J mUkF *} w }v w c |   } }wy  | !}g_vi    Fܣs  Nd`DẌċp{wY@տ}/@M^08J.@Fb% %|trx}  kKX>E 4    w_@ ܤ>0  :0  p{w ب =w/ ٤wVWEihJJʘ޵g!KV6@XjK)NR)[<b;j j ު  ٤wehQfptwwti[JL̀рӀj j ܬ }2 zl w Q ܱ w - ܴ 6JA4 ж  ȸ A} UD  Ի J}˻[Q}  x{ԫwiD3 l  Qv$ QI I$pw{*5zf{syZ@cytsZdyq6!ڊuw/oSsQ   vٰw   .æ W     v8 .æEWjBRI    rL @  q3v  >H   7}\ b  grvE}t  x ~ֽ3 \ AŬV vvAw&G i +(F~y  Gn E =Zbu ) c v5ӳKo  l& H$wװ h ~ r>l>; =5  c -$~bQu{{yy*wIWW8dgud}~ukX b&(&  鱽+  XLtF:qfJ,={{dc|mnwmFơcXE\HwXF OaFܳncدfXVib{l{vjv~iy}w||tiQ]~mtwoU]#A v>w0uv8^yȰii|_d;ReBs^jpV_iË _7jk`z@slwW~م{kxvdӟ[|³֐o^f]n   *<  l XKFVaX}p-boqċ_O5ӪT4 j ' H$w h %vbww. B{}yՋ拥trtr|_U^UaS߉ʌ%9 30z~}_tbww1. j0z~}1*ާqfJ,={{dc|mnwmFơcXE\Hw%v"뺢wXa {}yՋ拥trtr| _U^UaSʌ% 9 30z~}0`r_fXVib{l{vkrmw~v||`fdQ]|~mrwnIc ½ NVI   c Xi"-F;dA M#Y =Z Xi"-F);d(A ԍ#Y =Z XiFxd(|= Y =Z Xi@^F{d$:_  2AY =Z Xi,Fvd, W Y =Z Xi1F嵸d  oY =Z pmpCA3J {+ 3  c c  k $c _ nf-W;ūA b zc nf-۲;jA ^b zc nfFZ0= b zc nfDXQ W `BIb z`c 0ꪫ-;20iA 8k 0ꪫ-H;()A xk 0ꪧQ0= k 0ꪵے W k #  z^϶j_  e&Js t }철-;\3A u v }철-_;A u v }천= cu v }첾^$N_  !u v }첪 W Gou v  }s   }ܬ-;4V(:A s ҂ }ܬ-=;V(A  ҂ }ܬV(Q . ҂ }ܬV, W 2 т ݆謫-M;7(A s ʆܬh7yj׾<>Q}XYfw|fcn‹ݜ݋ -pqxxzUx]bUzrdV[nyYttYn\ܣk ~! *}ἵUZ1(Lr" 2R w *}ἵU۷1=(Zr# $R w *}Ἤ]kmM(P$ . w *}àPY,*j% 2& *' J w *}Q+, E  w *}ͥۄe6)( ) ' w }Og)N* W~+ Rn, - n.  g+vgq~xqj~}xunkҘŸqiw{a+L԰gm\`3$0D1!}gꪵUɅ1v`r" ,    !}gꪵU1bvnr# ,    !}gꪬ]ɖmrvd$ >    !}g|Pv E 0f  耚  ܤU1R0r" _ ܤU1*0r# ȳ_ ܤ]m0$ Ƚ  ܤxщ4 E ]3 }\ERRֲz&VB6N}lWFu/gRPokk$# ;*' rQ$2];;K޴٤Pol &j%  &  ' @#/ @ }Uݏ1r" K zl }U1r# K zl }]ݠm$  zl }àPݎ*j% 2& *'  S zl }݆,6 E 6G zl ҽ| {i0 1 }2 &-3 L4 x{ԫUn1 r" PL e  x{ԫU1 r# BL e  x{ԫ]m $ L e  x{ԫeq ; E F d  Q馾U^1f 0r# xk w_i|x.u.0adNoqwwwNy} N$L=\xxD呭kj{XjjQT 8* E  XiHFsd(5 ;Y =Z *}_B( Է w Xi)Fd(6 Y =Z *}le*7 x w PgiFndɶehhhlĬtcjoj:K_{}||aHM^@?uYmziutkqSY=nuz{_y|Zl.F@LYCY *cpإ|Zr{}y~qxmE 8 iqηyplg\VJ`loru|qvàmiMpq%aZwsoadc݌c^hLMEAi$|-Y;ͰA _  }氶U1r# 3 $|= _  }氭]Нmw$ ~ $|H < a0_  }I ,t $|9 A_  }MМlv: { 쪴~(g9 ԉQ` 6a }UvѲ_%; z  n #  x w ~< }ٸGS= nfBU55 j7b zc !}gɊgv "@    nfObL6 Mb zc !}gɗ.tv7 `  耚  nfۡ< >Sb zc !}gv6 4    gcwzફɶehhhlνƋz{ky}> [syYt֋ՈYj6IDLYcgɽi? 2÷Ȟxvhiqƛqi`r1N孔8[:5)7biMKCAinfFZ09 db zc !}gMɕltvc: ;    }}}㱝l= Rh i Nd]`DƊmẅ_$ @1@   @A 4 @   }}}㱨 l6 Ch i Nd`DƋ.ÿ7  {@    A 4    }}}㱫]l$< qIh i Nd`D̈1 @_@   @A 4 @   }%㶰}lB zh yi Nd `Dƫ̈ @jC  &@   A 4    Ά۽= +j _}D Ds Ά\dTlHzUg^zUzrgOzUbcUz{]PU[yYtt]jMR`quattYw`?vYJLRclt* kj{Xpi_mptwwz_dX`pxwwt0^L({_  &9k ܤ蠔P;,j% 4& ,' 3g 0U05 Hwk ܤ%0 O  0ꪲH06 k ܤѫ7 - 0g,ɶehhhlìtYnXzU`]zUz{\X\oyYtZl/FALYnܤq<E 8 iq䴹wt|􋸐^bH{򭄘mgmptwtv;G/Ai0ꪵ.0<< ek ܤ6F A\-52l Xk Fܤ'>:   n b X\G0Q Ȫl ]m0$ Ⱥ M%㿨0B m p%{SB \ l uܤ{4%w_vwcuvAWʇØpjgZy{\\U\|~^bH{mgjptww|ㆨnߪ-M;v.A  n jo ) p90|F > %㿨nߪ5B ZMn :o %)tB p ㆨnMU\[ҭ$+; YUn Zo |UwѲHT%; f ㆨndYﭭ$]2 -n Zo Ѵ2 0 决c߭xazUtZ_}Uz[Cq|}̣M_nyWyuzgqty{j&Ij>>Ln%wwBũRm=呭kj{XX|gNjptwwtz籦-`;ܶA jhs t ٤U1} r# / լ %㳠*B :1s Zt %٤ sB U/ m z̶9 jTs t ٤Mрl : L/ լ ٤Uȑe ; / Ӭ bm'F`zN[Rzrq4Dk|wAxC={xtD94@~yLettY}-o4r|e-mHon|w}uzmyc{٤w Eh5G H I J K }5 o]u v }ݔ* (! zl }첧6 su v }ݡ.=7 A zl }첬-$M   u v }UݭU(Rr# # OK zl I}mwzsA`VNC(".? (sN{Ƌz{ky}~~Y#^vT}l{tu{n+hvtuS0kdoklt 7IR4$E{ő}M]r>vËyk}}vso9}x+} 7ًƫYn‹Õqidr2M뭔8~f%HWreVeOLzl mvm逸-ۮ;A j| } ,~ 6JUAщ1Yr# fj ȶ  ĸ m%㯹mDpB :| Z} ,~ 6%JAzB d h X d mvmB|,9 j}| } ,~ 6JM8lcN: q ȶ  ¸ l{-;l(dA Ԛ0 A} UǪ1?U$Kr# Ʉ1 Һ ɻ l{a\(Q @ A} ]^mOU$A$ Ɏ9 Һ ɻ lbsQUxȁwgSt{ԋL6msnrzZt|z߻eo܋Ћ+RX9ˋɋËjQ|~^K :;4;W\TJIEc^@Ag ׽}Uvgq~xqj~}xunk՘ŋJmkV lsgcum[b^ts}~tD1l{a\(9  A} M]lQU$@: ɏ6 Һ ɻ Bcرvg"msnrzZt|z߻eotYn[̍ˋyoq|||uw}xnoi}ualyeuy[[ovYtH1Jջ[ѹvgq~xqj~}xunk{wdlhQ~bAV|~|?fD0BرWR0f9 :x J}˦pUo; m Ƚ BbXovYttYn3ݍˋpxw|}jm4JFZXMoi}ualyeuy3%}E[x0k{Sb¬{|_gi,L M 藈 ~}xpqmazw}ܬ^V$Uf  XC ɂ x{ԫ Pmr j%  &  ' @T@ a@ @ }ܬV(5  z ҂ x{ԫs /   e  }ܬV(6  ҂ x{ԫр. B7 @ d  }ܬ V6   Ȁ x{ԫ̥јᴫ e( ) @E|@ b@ @ }ܬ-V(M  j* ҂ x{ԫUьF Wr# # L e  ^ܬXV >-_0M# ( zvolfnmzx[V&TXi>KGLYɶehhhlΠ۵c{ԫwդ÷ȞxvhiqѰq{hN g&x}bKbmt|rxri`bWdU~{n_=bɋ~VcgXPJAi8{O(<(Q S[ Q]mI`$  ݆謻B]70QQ  Q馵]mv 0{$ n ݆謶@ۢ74r W -D ̵-`;A WC  İU1 dr# O   ̵O< 7  İ ,    ̵L9   İMl Y:    ܣO }v w #Îkm{XshL|~>Vb~P pɋ+ ?#iI]XoƧv:^V#j1fgi{[V[oyYtŋ~\ 4J~[ j{mB?ERQlk}cs^qӆoƚo }1f\Q 6vR 5S T }v rx c`VbeP pɋ+ ?#iI]X'6kuqm`fmpY =I{ w!AV47ӆoƚ }x\Q h{}Ta=zvl\ \oyYtxÃ͋ˬ= Xks}v w c | nɋ+ ?#iMzYaaÕ|[[eh||uæ$#2,K[sg}rx|t}Sr(R??-P+m}wgStqns;HY.B8|BL% @e~rja[v{N{kySkV>&VJ0UNjՏÏ}qX[E0)H@'dW狸buct~9}B\~elZLWVWgnt~3$0ðqiw{a+L԰Ƌyz5ًՋ#  Xv9=Q(r0qtBǖtAdwW[zyYtڋS"n_ n1fbi{\ӇҬoe}^ldZ,Q؞wM9C 쓷tYoX֋zUz]m`rj}Ƌt<kxzqh :}wՏby rxxr]x} w{ky_o 6&$͋zg~oq{X娢}sp|Щp eϋ&.\_uowqmuo`-2j $7*A !KOYcgxwhTnWQTOqˋʓƶƋLVcwzĤAXv{^#Y~~y{yPqtYsVz@kE0 eep~xh+num{wct=|ˮ0hU PV }˹dQW X Y \pwpoN*xN\z||qyyopvvƋ8l{tu{nsYavzuʇe FmBzlOG[6r؋Pnw^4B{xmv$bhpzr`su{qmt{ƨᚸؕ ~}}㱗4l YfgaWvzN{+YVB!UT6+Tڋʰ䪓{gyhTuZ|Ȃu}ytzhmy}^o>3,742 )ꋾf{x~v|DnoTJra~soq{v~\!r@hLZυb ov[JτFJV$;VJ%>=A<^Ƈ睖|\q\oyYttYnq׋zU.`y$C:!J&0G5)'3',Ͳw&5=q.=O,G2ndptwwt咭juYffih{Vi'',!Gz\v:͕܋Ihj+@h1fgi{ZTZtyYttYzo[O{K\gv{gh_i|xu.0ad #ζU~lj5*-*>ptwweOy} N$L;\xxԨԪ^f}zbJ^Q¢~ierhXoȋȋ]:cV~|ho} ` pa wv1 eaiO2Vt{zx >ʩʘvakyx}ug_s:}|ywygQVRoVJ˻[Q}2Hfhpzr`su{qmt{ƨᚸȋ{wdlhQ~܁bAV|~|8gBTv-rw6n1fgiuy[[ovYttYn[̍ˋyoq|||uw}xnQ}˻[/2ζU~lj5+-'Lwm8gý{wdlhQئM ؗ~(\/ߏ{ >ᘋvTgyxo`V\p:̍ˋyoq|||uw}xnoi}ualyeuy}ܬ)V@hb c d x{ԫiԽJe |f }3ֶTc]flz}{v{FVZ( F :5+:\9Ƀ툼zqcdeEiZ~G5"X?/ Ԣ}ܬo0B#=qg|wO}Nj ;27)$Dzvolfnmzx[#5d$Td!]{x}lzn^\\W}ufQS/l\yo|/9zvol]bmzKs Tep([opYttYn(ڝ尿W}b6vg}|w}{u}OFZ\inepo{򋖋~oI[l[\Z^_cn ǹAA8^[Wng|a{[vĊN/YCYD~|\J[IO9tlhW} (vٰw ۋ@NSF}|yx  jWp`qb@~}sfrgoc}xtiԆۋxm`qim}ݯs:g }᳓w`0,x6qZwU|<Cxo.vpxQx:TG܋܏|noE\rL2Kصr/vஙwrqy{[+G ո}vc|bvޕjsCMSmzpft4xW65 ) Ë"_OvݭwM@=FkEK}Ѳ}os{';@Ta]@EসۘVUMCxsh _wuzǵbACK{Ie΋ċSEt䳣Ū~.ԾbT/GJt|zˆF6 zB@ڋP+Bp{}hoͷK#xVnWƋbtzmp]zUz{\uT~~ԦB55k*"TZog`oy~|} ܌, ;tc8vp` L؊luq~d^trypdsazߺ57-9  ` 6a jİMn3Ӭl K: p@ h@ p@ ` 6a }g}İuyM lS: X R X   $ \-nߪ߭2l \@in R2#/ꋾf{i N޳}dBXтV;sXVkQJ^~@vf0òNOJePYRfɻ90}ċp{w~wau`40Q'6_|trx}}|\v|spzoy|x~}x3qӋs@+kK}}}l9 nh i NdM`DƉlÿ^: @2@   @A 4 @   M}h9 Sm p{х q 1 Ԩ ^W[Wr *u v c s iQ zl ^X[5 Fr *u v cݜO 2 Bs iQ zl }ݯsr 9 g "t:ȭMlW: @t q@u @v 5@h @w Ml0: Ȼ m̵y3Ұbm ` 6a jİh3Ӭp h p ` 6a }g}İuy X  R X   % }}}㱡-n;lA Nh i NdU`D1g̈ir# @'K@   @A 4 @   8}iwxm?zUg^zUzrgRTzUbcUz{]X[yYtt]jM(^*& :xzkri}m,-{.!_XHe&qxў+E%/H1`<1 XKŰŸ{r?I8>U[;P>J0 N* ::ŋBr{+[WaP_˾XY?8`B;;Q%퀀ȵh{{c@>!@~@(/@L@xl싟mOHOjN@HgNAA8^[W]ۢs|a{[vĊ?5ONtlhW}؋)ivٰw xttxXX{Ax@7z‡"UNSF}|yx  B]CH+}xti',ӀLU4@ԧ@W@4ـXi,Fd< mY =Z *}ۦ(" \ w mrwzrmsnrzZt|z߻eoƋƋz{ky}> [syYtB(gg1vi Zvgq~xqj~}xunkqi`r1N孔8[:5)7C0}첪5 #~& W ȀGou v }Ƚ݆+4 Tk %] E Ȁ6G zl }첾^ 5 !=D  Ā!u v }mĿݎ (.k S "  Ā N zl }첪NK< yu v }Y  zl }첪aK5 "+< yu v }݊G Ek ":&  zl ݆>b70V5 U1 Qk 0  A~w1 C_o\ZnRw`xܼfdkkoz3咭kj{Xpd~_Bw E; C9I\ZnRw`xܼfdkkoz(*cJLLansuI rJ iୄngkpuwwtbڻhQ!~E[='EM  ށb>V|x\ZnRw`xܼfdkkozc $ }^vw:B咭}htBzU2y_o 6&$͋zt?P _pɋ+ ?#iI]XEH &>&\>?ٸGS[d`S_#+ܫekwр@ʜ @ ^ @TG'',!GʋtkptwweOy} N$L;\xxli}dLT]tcjovb `)xyzXzy{q}||aHM^@?uYmziu`@t h؋Y=nuz{_y|ͅ >Y~$|Br[o''~jqX[ET[dvht~xyzmVySkV>&V%MG uNjԔÏ}Z}氾w' y԰ԋ^u{xzm{z{3UXg^;~ðqiw{aejq""c!߭|q_nyWyuzgqty{j&Iq);jzUtZ_}Uz[cOرQ4[ovYE0)w1Ɗypq|||uw}xnxyzjQՋoi}ualyeuyetYnAT Uu[>ӭʘvakyy~ysZ{$^JmkV lsgcum[b^tq|n vٰwdUj ^NSF}|yx 쟥 B]CH+}xti?{Toӭʘvakyy~ysn'ӹ+-K2_q{mB@RQln}cs^q}Xo||f>5=I=?[oyYtŋ}\ ?&Q|ebUzv[;z}|Ь )U M/34#o-&G'/JՌؑ獳ztqkn{mzYXB4\-zvolfnmzx[VzPF/L&iu~cy|ͅtcjoj:K_{}{HM^@?uYmziutkqІcwz!A?\hh\nN}l{wz|s ixyzp\i(=Ek@z{[VgL~|tcFƋz{ky}c =}gꪽw_v z fY3zÕqi`rhmsFvu{xzm|yx5)JVel{P[79}E\V$2z||qyyopvvƋf*AkzUf]zUz{]k!{t*xN\H/  \zo! YᘋvTgycpriZz:A}n`yykV;VJ>΋ŘX%ZV0F5)'3&WSwCwр R@퀌|}TG'',!Gʋt)>ʩʘvakyx}ug_s8wvm8_|7§ʽ<&QxebUzlON7{tTZtyYttYz8xylO} ,>QK/jwیԌ‹F:,JAp_{tpzwwjFαywosf|lo~x ط 䬄ngP7@h|r~vypyo|bjep([opYttYn(Ě1œztcbn{mzrz~uQlzvol]bmzKsy8z^ ]}Y=|u}ċR~uff{y~ry$chhc~xs]^{tԋ_n>b6vg}|w}{4}ID}ȍڎu\{}"_q3}owuY@!_@" & !@\-g% t[pG~6</Ď<@@jqV#2'΋0@P)}}k@@il\+/{VLs^ukK­=Sg(9ؖwh}]wl S7Ŗ l  }v{wKM# @? - @b g!SZBXWbFn;82@9Nno@n}h}W~ր)W⨀}v  cTVb|P pɋ+ ?#iI]XζU~lj5--'C}:(,d[{lwde{^Yxjxws}fx+ HM@~@1@a Y @3=4}X|4z^nhzg_do?eog{kp{ϸ[^MUl`fv԰ԋgm\`3Z]hwCw y % >ًʩʘvakyx}ug_s:咭}htBzU2y_o 6&$͋~}y UζU~lj5+-'Ry_o 6&$͋zg~|q{6}`}9osvË`u6-KTbjq8tM*kQ4A@@`@Ax@@rjڋ/F2}KQ p }sԿQذzyy9y'5[foYmYO+IIrmbbu|uzwZI rzomstx~znv0}&Y&U")^PigglBD]Bep}_@@   }@v}APN/bQws|mq~ä\dchstx~szx{ ODi}@v}APԞ@cnyYSbQws|mq~ä\dchstx~szx{ @rzomstx~znvd}A&xRO]eU3]üZdchstx~szx{ad ׋`d;D+ 8H)D }͋\Or`gdbj|rxpiO, K3TM?_y~mdvgb2zζU~lj5--'Xtdt'',!Gʋt}w    !T3d?    kȇ } $)V   S}vSi-?}stkkzыBE܋$֋^>mW @a,@B@{@;^:=+@@ }Wc`^wov1="m\rި۫w_/dU~{o_=aʋijsxmuwwjN g&x}cLb}vzx|dr`Y_e$puwwz_cY`pxwwvvXJLRcltζU~lj5+-'h0$ζU~lj5--'#oswwu[hQm-)$ bhkwr`s|k{ƨᚸދ`JL4\xxm,<E ^bH{mgPP|tptwwtL}Ԥ%n^bH{mge]eȨmzw, wyw}dei咭kj{XpdLVqGptwwtx؎ۏpw} kr|ut咭kj{XpdReeVUm҈_ptwwtww # >ʩʘvakyx}ug_r:咭kj{Xpdyt]ѥw}Ht u {! 'L9সۘVUMCxs+呭kj{Xpdptwwto_wuzէ4Av|ԫwW\FN Wg&x}hMb|urwii`f.@0oYN Wg&x}eJc{trwoi`f.@0oWdU~{q_=b'ʋŨGayڋɵzg~q{ݫwY[FN g&x}iNbzurwji`g.@0/ZN g&x}fKcytrwsi`b-@1tXdU~{q_Adʋayڋŵ|muwwj٤wVXFgJLQntp{n[ʩʘvakyx}ug_s:[JLBansI J ngkpuwwtbڿhQ}0Fr5Aʿ&?rp]iW~~wxotw)#<׋#'ߋ!wtrT }C/Sd[{lwde{^@TބԋA: N R|uI5pOwϋى苒w|rg9m}v|z|v:nlf*:mm}rz$%{|z~v|iS th}O:K&Z% 47-28.ۋavŋ FHtC;_g􋟒Ëslr~`\q\^[bLEyn !  r EwlǤA^bH{mg#Hezkwtzwxkwy}krpq{Bwl(wA䒭kj{XpeCHezkwtzwxkwy}]p EwCA A( >ʩʘvakyx}ug_s:^bH{mg#Hezkwtzwxkwy}6J4αywosf|lo~xp{jpXvngpzwwjEwJA  >ʩʘvakyx}ug_s:αywosf|lo~x p{jpXng62>1*9pzwwjYΟywo6Z2ow}ywkzHYpjwwz9>o}tx[)  $ o3#cB~|mnt^bH{lh\X|l}νpn~xhh|~wufdrbRez˳uRAwC Jxj\g}JmkV‹@ ltgcylShi{P >͋ͩʘvakyx{uqe:)чВI:ʖʋR~^dP' Ћ>O}>Q^nsu{qmtxHeR|^tgIP|t FnNxctzsΤϨیZͶU~lj50-'Dwѩ? 2[O[u˼H >ʩʘvakyx}ug_s:n$c6D7-ζU~lj5,-' ^>LrqqEB_NXmՋŽkbwZEڌ< Js33NSYwAQpi(p_pvz|aMJw[ # >ʩʘvakyx}ug_s:M  ܁b>V|x}{ %wiMVbmt|rxri`b.zg&x}b,idU~{n3l~};=bɋzg~vq{ҪZ. }.~xhht|~j6Od[{lwde{^;QŚ罙~dhhd~xa`rPR 7* xlo}䫜wiFV*& 9xzdnxv}qf^-v,!_aBdU~{nQ.}M}[xy}w{u^k2=P}joowQI~mwmw|wE}Usx|vn5}Xxz}אΆwu}#Q Gpsns}pb+X~kqnwyF}X~x}yw|ش࠯SVXA| v ~xhh|~~9U5Ggq]]S l3 L~dhhd~( $vpGotwwt>y.B wQvٰwb  $3 >ʩʘvakyx}ug_sߋxm`qim UNSF}|yx  B]CH+}xti ԯ7vٰwTVUNSF}|yx  B]CH+}xtiiipӛϸ{^\`YpP "tOvݭwHt su v 7h w E(1Ovݭwk2p[\dO^qǧpîL9সۘVUMCxsh _wuzՋ4AzyxaZ_FF_CN^Ћɰttx~vl?|Q,E`Vmxu}SRIAptwwtJً@G>N YDoo\gJptwwtb[mk`ʋδ΋gm\`&C }>w P䒩kj{Xpe)IPxwLhHbIHYjozzfӋNddy0m\`6J8,ðqio{ajN\gG}58,<,F%/?=0 B/AK:KE ,EA;J< H>.'S[Y >a  C h}?[*LwU}* 0D&g8VudTv6GfVW֚s~t}xpnƺ(,dw!Q+3Gkc>vpw$zmvszph"bʋx}y}AΟu|o-]">jyoz/3ԋƨx;(R Y2/:FkbwZEڌLϏ^bH{mgf]?LrqqEB_NXmՋVyE @ ytsZdy~t{N .OYDoo\gsD|vptwwt>[mk`ʋδ΋gm\`&C}gݰuw.: DPzinۋxm`qim UNSF}|yx咭}htBzU2y_o 6&$͋ tRtwz+y U-咭}htBzU2y_o 6&$͋zg~ਗq{d_w|qէ4AC?!*{wIu {! 'P9সۘVUMCut}kԯpuw7: U TNSF7}|yx咭}htBzU2y_o 6&$͋ziw׊iipӛϸ{^\`YpPV| ʻ[`Vmk[‹ispc)nNVZ`iηltg~hGX?Y)M ΗI~b>V|xV$c˻[#{wdlhQQt{ƨᚸ6ζU~lj5,-'G~ށb>V|x|8g+'ehpzr`su{qmf}@[;{Jyouqi]]eo!ɋǩìerϸe^IWqZn{԰gm\`3hindtcy^lhQ禑M  ׁb>V|x|8gqܻ[wBh(Alrv\ ~؋Pnw^4B{wmvptwwuegoplfb\ouwwu[hQm-)$ bhkwr`s|k{ƨᚸދ`JL4\xxn}vwѾ\ p#ЋJmkV‹ ltgckpSFL[Îkm{XlhaVb~P msݰwA+咭kj{XpdptwxԆۋxm`qim UNSF}|yyy Aavx q  Nv9d  vn#_i&;O[dVut澋n7)=aʋijsxmuwwj wCvn#_ i&;O[dVut澋n7)=aʋijs0yv{jyzvPcov~y|~}q{ ffBSƹìzklo?أϾs2{y&~rmyvryv{jyzu{U@@.mȪ@(4@#kwqnnxpp􏀑ah q T~<x]uX~v}Ĭ׎W;d/`(P|2 OP|! ! i C >-* > yn[XbSEV`p.4 ys}aZekle}|}ԸNMB4#BZgBB^BMc oS]m$ o[Ml: c@ N~ \cr \U1r" Ec }!{! U1r" U1r# v* *@ * * *a.7  t( ) s HYPY% & ' R\Ur# # lvwp/Hkλrzomstx~znvkȇ } $)V   vvjyl{|~~|`zĻdvrqWemaerv|{wwmwrq}}؏~֋b{yizcv@[Kyv}~T~l{~LCriy|{Xf@RO `  \U1r" \U1r# S]m$ nvPY% & ' ~  aɩ.7  n E  t( ) \Ur# # [Ml: C% 󀘒sC%  \Ur| | a }z~rQ֚uwhsgncrwvrrwvrqvɫ*q~ i C lϿ l j   Uf1/r" U^17r# I Hv&w|{`+}xTI+&!x}.H,}x < 2s{|ȿŢlnqry}yfj  ۳\w|{͋ͩʘvakyx{uqe:T" S0 D 5  % B  s K)&w|{c4|!_|yHp4Tŏl\]{\]gxu7ɋM⡖yEd]m3sm|| i |~{mesm]m-$ kɩ.! ɩ.VfEEfSY~ir@RO `  !! !! ý! ! rL @  ${t${t)\= \=  4 4_x}p^4x}@ڳ, x} m6<ÞCPŹc}V]pF{]VrH'  lloEDyUXjliroo\U1r" \cr ei`T  ` lϿ p3crP3 " Y r s s '  s  ZZWMO-f&fw ٚ Yߧ1Z3113Z%ߧ Y 1숋w&fٚMOWfgv:l^B"̱}e=4~՝٬@@K`c]gqfouljWe^WP|2 r '-&j P E: \cr #3crPK " Y Xi`cFVd(0 EY =Z *<  nc;wA  /b uc !c?w( 1j >gc?wP Xk }fcBwvsP Uu v ۆgc)wP + 9cHBP D }3co8jr (" Y H  XiFdY =Z ݆oƧ^Vz[ f\ ] ^ ߲of   Hz   nfAfb c ̵{ Ά>j }ѹvyR4$Eo =HY.Bo 3Hv |wu){}a~fye~{}|0k M'm P ){%Ipsp q hr zXxs t $v̽wNҥˤ>@I~r|knplboye‹~@qJ|\~hyi@~@@垃ҋ~v~@zgjuVN?@{t~>|}~]}vxy;s}su v Ȇ޳o (    Æzt{M^w x y v ` pa Bر  Խ cŬ>LM!={@&50(z;fcoYttYn&' %zU`]zUzw#{/' 8!g . ŬB 0ꪵۓ W k Խx۝4 W  % |Cҋc+ly  e A  e 6}ccR #   gcwe    }c8o$ П/  C}ၟ3cbrq p " Y @T @ |CҟwtylU A  l vǴ=Q8:Q8H.öNa5tQPZuyixgw|˶ZY08מ?ًshɋԋe3؋_1"Y'IIvwY FPONcFk*'l]}jo_!GqlT&6quyJ[)Z/=}~; Ai5:RiXY*@el]Qk쁘}ta10e-lpao|l^[0R}hv-I,56}Y   ;Rqx.7>0Ԑyd\VC~ywnsr3WoF8ڞtblRDjy`Vk]Prx7e%;gvv#e   I}uM+7i-fE\1Aߋjˋg"<(G䒏}w8*  o|AtpͶċYX75;~Zh`TkXvW[fddvx|ɟãgUg]d³֏qXg6fsI|{l`+qZ~hGNcFkۋ2{xl+&0X?|}yȍFIY~©֐ohgvw0uvCYsΰii|_d>PfAs[kuV\k _7jk`z@slwW~م{kxvd[||~qvulv9 PONqTk.1hqx|nn}vJ3?/ilRPwoTe%dhcKcHwyW_R@3VBՋ𜚋yd\VC~ywnPrhGthjrïpuR\\glǺpuNdipjy`Vk]P+} * }T̟weBm6I0:ca|}wtenqem|H[huԽ ۆgc)wP + Խx۝4 W  % vTw.U]9rpmegj73 ?.99`87ҏluyn|Z:2) +?suq}qww$yi~V91U9i[{|~grYI7'㙋3ۋ}sBaUD]Xˋw_k;=cvyk{tovnuTbc>axٝxΔɦrol+}JC} Lmuq싍zޤߋ]#F)* 5RIٜwa1!?/Ԑyd\VC~ywnsr3Wo}|nmwZa\oNyd e f g ,v|NC*4qW}q؄rh{y܄Ԉ֋V{ ~؋ptsW6a-v<8nkuqfF3 gXSO+kj)a_^=`~ՏՋ%xo|ރxtwjlmXzyyoo^drv~Zh`TkXvWko|eY`vxfsb_KO˶³֏qXgLpЋEv; t  +}rhZF)ՒhjQxYZl~$|B_ vعtMykHj}v}}{usvfk[^tukdmuywh`Pku g5=B=rslȳ|j>5=B=rsW2ц͋ŋ݋= Xhr%zUg^zUzrg<>zUbcUz{]X[yYtt]jkm`quatdk(G Xdp|Eݍˋpxw|}in:OK^]Roi}ualyeuyZZpvYttYn*>6YvYttY*ymësa-;A  j džꪫ-;4VA  !cЬLKG  s٪ x tYtXzUc]zUz{[OxnzghltXzU`]zUz{\X x5}j{jXiFdY =Z ӆoƚo}1ffQ 6vR 5S T ݆oƧ^Vz[ f\ ] ^ ߲of   `̴p-`?#uitumw})zU|_.:-fewzye -"UZ,{|՛cwt؋o:nfAfb c byr«saKdK  d  ,  d  }ϹdQ   dž*f džꪲK G *ymësap l i}<ܴp_l"uiYaosYttYnXzU`,.;-fewzyeW Hcgtzopjr!){%Ipsp q hr Ά>j }su v Ȇ߰qapsYttYnXzU`.CBAF-bUz{\X\oyYttYn΍̋ފÆzt{M^w x y $|B_ Bر  !cЬLz pլe˪YZQ I;VcoYttYn= 2(7zU`]zUzws;+.9g s٪۬|voL]zU`]zUz{[OntghltXzU`]zUz{\X |Bĝx8zwtwtۋL1 s٪|zU`]zUz{ZNngM'lvVzU`]zUz{[X |tYnXzU`]zUz{[O|ntgh&Ss٪ܳ~U_[zU`]zUz{[Ontgh&S^zU`]zUz{ZNngM'lvVzU`]zUz{[X ~y͡rtwt֋4ܲo5L fZJZoq`rj|ȋucUZoyYtŋ΋ˬ; XMs"zU`熨ӚOL  k ӇOL>t<roX|^AVXMs"zU`]zUz{[UZoyYtŋ΋ˬ; &|xt3    }moG,<,F%/?=0 g tYnR ?'AK:KE,EA)~> TwzU`]zUz{\X\oyYtTym-y<}}uzFfyYmyqm8<# YC5ꃛ:x`*mOqW_ċ>j=|aotYttYnXzU`co`*} w o}w9q(,da{lwdmu^;bڊR솂{<̓ϙw}{GX+OCNBy ]J* <ZSvdHH>.'S[Y >a  C "vp(4  bެrʳѓۘjppyuy-{|ʡcU~||yy隟~npƘyrtetrydvDsouoh!}g_vi    =lId~ d  , :v}9Hn  b ֫z }, ? elIcd  l k}Wi!ؼ~|v}k|{nݚp\pvww{yrqetrydxDso}yvhPp  h ;(R }2 zl mU    ؖ Q ܱ  } .vٱw4$    Q! yw !  r I$p" sVў|gyr|dhhd}pp{5z}dhhd|p# |V}{|yy隡~[I7$ es4/|wz}dhhd|p|pz{|dhhd}pp{z}dhhd|pp{wes4/Ѡ~U}}uw隡xp}dhhd|ppz{|dhhd}pp{z}dhhd|p# ~aMvٰrw"n_% 5pouw٧-_xg닦{eh;y煐r]xM" & b% ' 0M" & b˪mIP`m^sm)}%rav( ) άt* 8}x12wwy}S|dhhd|pouwws?! ; D2{+c/V:P;\(,Zl2>|@orwwt{dhhmo;GbEQmv~~~rh}owego͘Q]qm}qk!}gꪵUɍ1vhr" ,    !}gɄHv E (f  耚  p8wl=6C1&`X#R+LYh}|#5kj{XsH_Optwwz]͋`5"ҲpU1 Or# p4  -}#oAت{|yL|{c}}حϋvqma`3$0Ϣqiw{a4bmA} UD  Ի ܤ>0  ܤxщ4 E ]3 :0   }KFl#"/ y7rqetrydvDso}}{xupquwݜwppvw٣-_xgj˪pITemRxo$:r%>"$yehhd{p&/zehhd{pouww{ 7p}w٣-_xgj˪pIScnTxo8w`?vYJLRclt #5kj{XsH_Optwwz_dX`pxwwtelIcU1r# b=(  j Uu1(r"  Qԫo ,u Y! (v:sش韷ޢw{|dhhd|pp{4z|dhhd|p# VBwt@/v93L %y ZoyYtŋ΋ɵ; XMsvzu~}|{yEzU`]zUz{[p'ouuojprMvٱw0~_% l]yUz{\X\oyYttYnWصL,r+‹ƌquuXv{vzW[trypdpwwwq݆ؖ7 QLb}|xhhw||yr~9{};|dhhd|yrm9c2ptwwt݆ŬV[opYttYn5ږݠŮztgfn{mzurqQrhj]ys}|/9zvol]bmzKs T+{r QLb%}|xhhw||yr~9{};|dhhd|yrzx:{ttu{2ptwwt0k byr«saҲݟޟ a  a  )  a  =lIdԫdΤ̽ m a  ) Xi)FKxd,s Y =Z *}˫^n*T *r w Xi,Fvd, W Y =Z *}P,, E  w pmpCA3J {+ 3  c c  k }]Ӽg)* W~+ R, ^- . nfL.@' Jb zc !}g˫ɒUq   耚  =|ˮ0hU PV }KQ p =|ˮh W U PV }K]a E | p byr«saے W a  a  )  a  =lIdV̑ E   a  ) }Ϲd]Q  W @ 8? ,u+q ;,@ A {B IC  C ӈ\C D Wu m+E xF zhPp  h  }(rG `H q4e (WI .ı4$    }J |4!#J#K |4QL SVM "Ҳp(4  lw͸N mU    ؖq4e (WI ~O P P8lQ 'R pmpCA3J {+ 3  c c  k {L-ٽhzS _lT zU V !W ߿X oBY z?4ٿZ ~[ } ]w("\ ] >9e^ 0_ XQR` MH6 a }ܿb pÎc pd )̬e xf 6'2g ph i lj kKk g/l Uy5m xn {o B䫍.np ο7q 8r vKos n~||~xERCiumgfʜZ\5${XGulw}vkjl|rzKj^w~t {~r}\wl@o)WQ6~u Tu~~{xbNQJU~wwyoajccAMOA4t|vgwwPQZntyo_l,yww}eqɴo` \` RShOXq}o}xm]wgV{Q8vjȋ‹ŋicogqkjdymkfyȀVruiobX>\Mvpjwl{~~<n} ~r}}dj/hoP~P Lnabex|{xlXipy|v}~jxyu{~~on{~~on{~~٤ Eh5G H I J K OX4 lv CLz$)rHOXerGT{|~~xcHbbow BeGnt I{x ?zB oy xr Am7"ltIr-rx~{uo{r{hz\s4evu\Pa'a.~YR9OQz { F 6@(| zB oy x} ~ Qd\Pr JMSÿzwzpYlŵvwmo@MO@Le2ܥ‹gu}nR4d~wr1{~~~}'ؑFS}n\EfZ_QQwqwwEDkkgzzx~}~ @@ O @&(+-37@Cx Asr0 YBvu<+-rHɃuˀ4i1Գ D7{woro^woRDwPEX_Dklo ͐A̡̺pXhʯiFɵd   Y =Z *Ϲwr5  94 w ݆oƧمV < t[ f\ ] ^ }w \  c u  aoƧٔV,< <[ f\ ]] ^ Tتw^" ]3 c = ] E oƧ ^V#5 : 4[ f\ [] ^ !تwt! ]&2 c = ] $c-Y;6A t i_  g氶U1 r# 5 hJT 쪯w< @` 6a } o G  u a[,< 5l` 6a TظS" ]  = Eۓ5 ` 6a !ظՍx! ]  = k^4 $` 6a gW ^S  > oۘo o` 6a ]գm-$ ]  = nfBp@n >}5 0j7b y0c !}gὩ;ɀbv mo ^k ;  @ 䀛 nf Bpl@F Al5 0j7b y0c !}gὩ;ɀ$v tl  ^k ;  @ 䀛 onf=c'o ^b >c !]gəmovg-$ z  y z M^nfBiM @ /`b `c !@RgɃZvO B  = O  < = mnfO$L6 @& ]0mb =0c !ggɗtv 7 ` t@  t t@ \oۙɫ< bd e f g Fܣs | .T  }}}l5 -h i Nd`D~l̈ @@   @A 4 @   Ά!!*< Uj ѱU B a2;,< Wj TѥI" f Άۻ W GKj \p2 E  q`  zoj tbV z#[ d#&6 ]j k6l..! yB 0M^EtM H 4-sk @Rۦܤ|G>O D   = 1 0ꪵ-;4ے )R W k ܤ;xRUl )( E ]3 M-;A Fm p{`U1# j  ̨ Ma,< m pT{ѧK" \+ l ME ۂv5 x> m p!{W! \* l anߪۼ@,< Z#*n :o T)5" h` anߪbۼ@ 5 < R#*n 2o T)~15 $= b` E nߪZۭM5 ZFn :o !)9o! h+_ onߪ_߭Io Zn :o ]¦)m$ -$ hk ){묨-/;I5A d p q br ٤UVI1 !r# 4 ր  ){묲-IU< dp q br ٤I3W  u Հ  )a{XI*,< 4+p Tq 2r T٤H4W" U` m U z籰O//< ja/s t ٤Ѽ e E/ լ a٠I5),< :g}s Zt T٤k" U/ m Eж5 :s Zt !٤rq! U/ m o֠Զo :s Zt ]¦٤шm-$ U/ m }첾^ p F "-  Ā!u v }mĶ;ݎ l '' "  Ā N zl }첾^0- 2 W !dg  @!u v }mݎ'0x >a E i !  @ N zl }p-?n $>}5 o]u v }Ὡ;݊bo $^k  zl } pF $Al5 o]u v }Ὡ;݊$l $ ^k  zl Æzt-۱; A Oww x y U1 r# a Q ձ Æzt۠ < /w x y  h  Q ձ mvm况۝< jt| } ,~ 6J Ax! Ğ ȶ  ĸ maչm{ ,< :8| Z} ,~ 6TJ8/" b* h X b maչm>{ 15 ]< 48| T} ,~ 6TJ-y/  lM `* d T ` mEmۖ5 :T| Z} ,~ 6!JrAz! b%) d T b l{ؼ< z A} ǙU$ ɼ/ Һ ɻ laڬحu,<  ATئ ǏU " i r i l{ ؚpE < $RuF ɪ A} qp?UH "PF @ Ȁ @ l{a\6< $9  A} 5[s4U: ")m @>c Ȁ @ laڬح,< |< i ATئ Ǐ0U A d@ h d@ Bر'0< ̮S J}˦p'  Ľ Baر.,< lY JT˦px" X h BE رIMa5 l/u J!˦p{! T  d BoرNI]o lC J]˦pmfK-$ T d aܬۮV" W rJ  q S{ԫin?0 D  T 4  M^ܬ۷Vc !Tgv8" z  y z nf´Ȕv 0{1b y0c !}gᴒȓv l  耚  nf^N]_  `b y`c !}gàPɄQvj% & ' 4  @ ‛ nfFY43@ v8 0b y0c !}gꪬ5Y;ɓsoRBl \ >  @  nf4MFZT @g8 b xc !}gꪬ5Y;&ɓsov o \ >  @ ‛ nf@FZU @l b xc !}gꪬ5Tɓsjgv~  V  @>   @ nf^F]   @R2 b xc !}gꪬ5m|sov   ( @>   @ anfFc0= @< ]0EYb =0c !Tgꪬ]ɖm0v d$ _K t  t@ t 0ꪻM6 Ƞqk ܤݴjm4  9 0a,>,< hck Tܤ'>" W b aܲAX,< 3u v TةX"  zl }첰o+ Wu v }봒B M zl }천Y4zr $v8 cu v }5Y;ݝswFl $\ ] zl }천}4X "g8 cu v }5Y;Olso "\ ] zl }천@vȐh "l @cu v }5TݝsjZ  "V  @] zl }천^N  "R2 Ācu v }5m݆s    !( Ā] zl aܲ천iX=  < i3u v Tة]ݠm3$ \K i zl }-_;7 Yv =] }հU1}r# c^ _ s> }-;\37 cYv =] }հUݏ1}r" q^ _ s> }o+ v =] }հ봒}B ^ _ s> }^NU  H;v =] }հàPݎ}j% & ' ^ @_ s>‮ aܲAX,< dv =] Tةհ}X" z^ y_ s>z aܽܬ7V,< t r T{ԫe"  sU 5  }ܬMV6 t Ȁ x{ԫʴȴ G L d  }ܬ-=;V(7 ڼb c d x{ԫU1Խr# H,e kf }ܬ-;4V(:7 b c d x{ԫUn1Խr" V,e kf }ܬMV6 @fb c @d x{ԫʴȴԽG e if }ܬ^V$UU  ʀb ɀc ʀd x{ԫԠPmrԽj% & ' $e bf aܽܬ/ V,< ub sc ud T{ԫԽe" [yhe ;f ݆謫-S;-70A 3 Q馾U1 wr" jk a.7,< le_ Qgx Pxa k_ ݆謻]Ⱦ76 ɐ+ Q]ȗ 6 ) ݆^JZ7(_   Q̠PU ,j% 4& ,' c sְonf[d_zVhjHj]zUz{\X\oyYtN ۆuzgqt^y{j)IkzUtZj-w, [N咭kj{Xpd},咭kj{Xpd}Y~}[ptwwt[,[ptwwt}R ?f * ;;x{{<,dW{lwde{^;Quѩzk}"wUJF#*& $ozcx~ds[^-}!0d 22.ѝzcdZ +ztgfn{mzppw.|zvol]bmzlR(}quHG^HZhܚ}u?^~w]tibrwQr_4G[d,掆MlMБ,9O#OǠ~xhhy|~srHF}-* }8*  l gc?wP 2k >gc?wP Xk UHc]*^ p UHc]*^^ p- l> r>l> I M ZM Mxj?08 % >- >-* '-* ?>- F ?>-* F ?'-* F SYB:YPpzy|xHJmJ[lax|{xx{H `olu|xwpHlw~tHZkwaPʟyzSYY9wB:Y7pl)wtZiwayzzyyJJ)[layzyx{Y Lnlt|omVhpsI{unal\vzytIJYwpYsIw̋wyYZpwZvHHVYccYYccY}< c} < x< P}  p< x< x< AM2kMYN@@S@S@@@S5555S@P| C@@wz =o5 Kæ/fhr/@fᙀHP|m   aP|p    P|  HP|   aP|p    k$wcm~FITf%N|pXH~SW_k$wm_iW_S6ؾƦ%TFͅ~6cis}  ! !j  j  }  fy  }~~{  W ǽD Rp\ ,} c f f@=)T U @V @ T U V  } c f !)j  T U V  } c ! f)T U V  j  xg/nrvxp]k6@6HPHZ}[~֑Ȓ_>Ӻkeppzpuv0w HM5 6 07 8 P|     XEŤ*4 r Ou~}}iСyv!{z~~xJ X=`{~yՊ拥trtr|`T^VaSɌ/`91XB X>,q XRvtZ{{|!wzZuXC٘\\ Ũ   ~ XPv91C|}yՋ拥trtr|_U^UaSʌ/ XL\ XJ,q= Xtu~vy)e{]uXJ٘\\y Ũ   ~ Xn1:$\ $* ~%P L) 8$M. C Lz$F T= w (bĻ &BlG x vwK#$JA5[qE }ز& ^k B)`crp}}zoYZ_rysg3%P060 Rgً~}~2@+ Va0]iFNcfvumtrvkΠngkp}}n`c7c &^k( Z1J'%N`bqyi^\qJmkV‹ ltgclShws4UM金=&QxebUzlO:ZtyYttYz@}ygO`{ċ?یĎԌ‹:RQzgopsuqzUmyý w < }ٸGS= Zyn=|whòioK.+<#d0l}z|||U}zЌ*1NjՏ{y|idtdu]|d0oׂjoctzbyySk}f( kK&O,l l[Bq*!BcuRP=qtpFKںQyI( ;pE=O:6VM{gyhTd|u}ytzh|p|| OpV$28YZT(-?F @ ?i n'j$<j74켋UUvZU"vv+j|rG;O`Ābh4U^مyh7{t rWa~@{tCp}wzzsumzm|wӉJ)K\    ćbK8ĻY| 5   $|B_ X*J F lv 4 yzB0J y c} ~   \oNyd e f g }>fu|w zdJ4V4b{Hum|~et!wd}u˳׭ts>JxGus|{~grvE}t   x <} }tϋ `"OdO1W~eun]]x2Mk}=R[_qZl$B]2˥]NNs7ː˱\e:ȺtE!vzӪTX8" j ' G)Zs t Uvm_x§ʽ<&QxebUzlO:ZtyYttYz@}y,БA Q0&Srǀ@8Q 5Ë6 j`/R;H" *L[9`ċÑ\jh訟E뎀}l^Q=VGl8u`-싀@j@O|2,38pXQ:",~ 2v9lDAw 4߀W}|w)lk>2?{ p@y(/ s7,Ý߅ !WֹًuE | Ww{zgN}~T>K\ȔC{}Ƌ94b]ohxd~ubglh~  zf֬e af    w.nnp ye Qf vI(#J#~dzhg}d~}VNOvxU =€>z]cqQ@R }!ch4jY@&#&~dhgd~}p-es{Urq1M W ZˈmEoqT~F ~ŬB }B$\A) F%!D5(:B%f{}yymuofuzjSmt~\$"66;  ˏSi{ufoumryayXM'm Xi1F嵸d  oY =Z  S2}skaG{~袆yhk}rnqsuuz)ilrcikpd|3yZ ǩdz|WVhhthaoRVjӋȋ]NPA.g5z߻yQlS}NtgZLLcϳ_x|Ћ43.^LLG~Xo@TH]֋]Ns:E~{}q|l{mrjX# l  0k PWk k k k k {m Xw(k D| |lXk  |lTk Xk  |lRk Tk Xk  nlWT 'k g nl2k X nl3pk k X ㆨnߪ߭fn xo $|B_ 3e ` 6a ){%Ipsp q hr ܤ>0  eܤ>>$  0  Sܤ>>>!  $  0  4uܤ>  ]O b Qu 4uܤ>  a S uܤ>>f `@   a S uܤ>>> K `  `@   a S  qܤ>$U"   b I$p"  qܤ$> V a >" qܤ$>>; `@   a >" )/  } }y  | ٤VWE ު   Q4vvwX:PRc؆~c>RRPRɣ@.jes[aMYiiz{{{ige[sMس>RRƅQG\ؠXRR>đMs[egi@{{z.iYMVige[sMس>RRƅMYiɌRPRR>c~cRPsejQ2vvwXhjesPRc؆~c>RRPRɣiYMRR>đMs[eginO ɓȦybGGFFGGbyȒȌjr5(\MNώϡЌFuGG`bypȄ)r\MNpϋψuuЈϋpNNZtOopȉybGGuFСώϋ`NNZtsejV?;C˅4glr4gmˑsejɌ˘˘r˅ɌRPRR>c~cRPQ4vvwX9PRc؆~c>RRPRɣ˅ro˘R ˘Յɣxfjes 4g+ro4g˅CV?;jes\aMYi'4˘4@˘6>@MYiz{{ige[sM4g6>@4g@4@C'4W?@ige[sMس>RRƅQI[ؠXRR>đMs[egiW?@'4C44g6>4g@Ms[egix{{zfiYM6>˘4˘'4iYM [1Mkh  )s3RPRR>c~cRPX)#h-_< IԽ k K ͐Yۍ&% K +D k IQw@|1z{{t#WRlJE ijؑ>RR !乚 W 9kVz{{Z  +C 3%^{_;[@2z{{@#@;@@@س>RRƅ @ ;@܀_Vz{{[ +@ @@_@Q2@@ F@ F PRRRc>~cRPą@ Fl@@#bi J^ k K@ Y&@ K k + J 8ƹƹ `B `BbX< mPZ dZ Ls3RPRR>c~cRP L` d mP4`B `BFe /nVb 7haTG Q4vvwƹƹV GTaiT7.b nV  e`B `BN4 m %il !􌋐 PRc؆~c>RRPRF l} % C m~<X`B `B8ƹƹfX`@`@@D@(س>RRƅ[(ZD@s@`@`@ b@*z{{vn@ cQI\ؠƹƹ c @@nv{{z.@c {`@`@@@@"RR>đF _`@`@Hz   HRy}YH Ȇ޳o (    Ȇoި (]zUtZ]zUzy\X\v{YtxtYzXzUsY^zUzsa||rr[cvdxrS?Q^gdv^My~qu_[y~quc*\= *\ *< z/ˋ\CPWSLMVcŅE8h`gmKCEɋFQ[a:$B()/6㋺ܧ?P܋L/3\ b? QK@ 43 ]xm!4 Ri@ @ 43 unx@4 `A @ 43 R#nx] 4 ]B @C D Q@ 43 gI1Xx. 4 @E @ ^@ HRg@ 43 Q1lx: 4 jF Q@ 43 }rҡx)} 84 G Q0@ 43 zx24 `H @ 43 ~p3x=PES*4 wI J `K L vM `N aQ@ 43 N9mx5t84 `uO HC@ 43 |qbxMO 4 > b? a A 2P3 }(<(< po@ A}+vc< pU'A Ro]D{< B C D I&VXD2< E  ^ Q&|Ŭ~< (F Z}g8D< G T}M< {mH L}PES< r9I J lK rL vM lN ZN.tB< O |c(n( @8< > b? ,K@ }(m<I< ho@ p@ b}(unc< 2U'A L@ R(n]@< B C D ,@ I&(X@S< E  ^ &Rg@  Q&(l:@< (F ,@ {}g(ҡ)@< G ,0@ u}(z< 0{mH L@ m}p3=PES < J@9I J IK J@L vM IN 4Q@ {N.(m5t@@< O &C@ Q|c+bvO @< > b? 4 A }x!_4  w :3 }wxw4 y c k   3 }x"v4  3 )}x4   s  3 }gx_v@v4 f  ‚   3 Nܣsux-  4 m3 dxv`DẌ4 @ @  `A 4    Q3 x_!4 i s3  ܤϟx>4 "J   i3 Пx:4 "(   W3 {x4  ʨ  ]3 (xD4 o 0b3  ٤xVW 54 o   x3 ٤xe@4 t/ р 3 }x{!4  zl 3 xw@4  Q р s3 ~x@4  - р a3 JʟxA,C4 hz     g3 O} xU @ 4 €"  € w3 h}˦px&4 . ½  F3 1x{ԫxi@4  a  y3 uxE"w4  3 xI_B4  0D3 x$a"|4 e" \3 x L"~4 6 K3 İx`4 %   w3 N**/jNZZNNZȼZNhibbiibbiPTF߸UhÝ!I}ou{wujj{m{Xh}4Z{z{൯ଋc}yyj||x8JE=bluvxbW&rZ[WpoZvIW@z4tlKPiifvblvv}__ mRySz~cgoiޫ@l  A  8 Xw} X 8@ ]0 8@        ƀ|! 8 8 Z $   j~ F  8  }Yv~uChhzݫ\u6~y_{p~![~q}|}q"  "{}I|h ~{ {||{}~zu~~w~|uzq{u{ ~ӆPvxx~wxxo{kguc}x}}Rt}pqokNNctb"P|xszl.F|ralXjrd_r[{|`u`z"Pyvh  }||zrk{}~_M_ gSySzgިnpʁl L{, L       B    ,р  LB  B    hvg   utor   .   vm M pzz|L  = R LJ  c v]VPlg[cmqŇ^8t`jkVdƫYQw`[AcT)GAċVaճjGRldyXx}Rvdwԭr[r;j@@}~}~xw@@{py{jyyr}yx}`ta~~|ˆxx0we|z}u+v}q{u!~{~Rvxx~wxxo{kguc}x}}y}ra|xo z@d~y ^{p~$![~q}|}(q  }0dCkr{{îÞ\vguhr~qyW {xsyl~}vmխXt}pqok~{8@|w|~uxv]c{m͍m~{pw}~Zi{~b[Xgvvxx~wxxo|kguc}y}u}ogx{|ez{8X~~i|ralXjud_t[k~usr|u}%X^zyvi X@0{y}Rv kTdwwg׫[r@`Wyzx}w~ra|Ztscs~Շǁ{@  ~jqk}TfM$ osg{|`u`z4yvh( "@h}||zhF $ { p~"n~y`+p}krlk~qzr|ttu~s{}}~ xx|y{|uzq{uh~j(~$4vxx~wxxo|kguc~x|}Α`~v|qpnj~{c|`n*?*"I+vhyjn_ĊoMzuon}PmWz\̋_vw}qԡËfOi]cdfl_dgm_gn*w*"Ktn{YZx[`Kdhl_dgk_IjåwTF߸Uh<`bMcu퀪viszxkXe|kp}r|wh4\*:4z@͠{oyyyz{|s[uZ&dWrqx}l}ybhjb퐋]jp]gaie}~LK|}}~lwqufknPI{`jbju{əQvuvlvzƚ˫}l|twh4\4z@vZop{oyyz|s[Wu[rZ&WbdWrqvlbJ8xl||yy}}ybh]a{z{Z4ie}}h~XLK|lqIUwpA IUwŴ, aApA  aAŴb,  p p `R Y?R  < < x< < T# 6R Y?R ?R Y?R # R Y?R ?R Y?R ?R Y?R Vutu)w Y͋3&%S3t9I@PԢ <` 2- Ѫ` xY`B `BsxR;AcNV|34g33ٙg3ٚffœ3S3G>c~cYœ@@ƀـ怋@@@`@`@. w @: 1NW@z{{ㆨno߭>  F8n No m"jH}z@H}z@P ㆨnur߭fn No  >   Æz.-t{EZtyYttYz, Y bN;p~-)o`cbUzlOV,U\"/gf}ygO`ċÑ\jh-\M金§ʽ<&QxebUzlOAᘋvTgyxo`V\p=_G~ *}Ἵw2!|Zr{}y~q|trVpqo4.nl~uzx|pVJ`loru|qvàZZwsoa`>݌Wċy}˻[w/75*Vu{xve~}`AV|~|vz|W.~ȋý{wdvu~Ά۵>_zUg^zUzrgRTzUbcUz{]X[yYtt]jMR`quatx8zwtwtۋoCw_ўV~~yy隡~yruZJLRcltBkj{Xmgpuwwz_cY`pxwM,w8zwtwtʋoCkؽȹÝ~kEVUz\`~OzUe_}Uz{]VYzyYttYۉʋh~wxv{wʋyV~~yy靚ywuvAWʇØpjgZy{ZYU\|~kh{Xx\ptww|%w_v̵G~䋭ًw8zwtwtً\J^_cnSNAA8^[Wng|a{[vĊT=!NtlhW}؋ vvٰwxv V}{|yy隡kdUNSF}|yx.  B]CH+}xti|vt3X2/G0H5)'3&WS>J,zzR{T:6V;VJ>㋺vrltYn)+%d>3M-r)Y>rqtm]}n\݋BM)j|w0g|S|kY.2%yq$fzt~7z@sH~SYttZ{#}C0|rVPldF</=z~;,_M?zj`_fgyzwn~l'q}Sy|tًzsad^Io|vvj0;,'A*#0C;>XL\v{Yt‹‹bV2VJ$>CGXnp{tsrltsrzy\v$W"}A[~dhhd~xsm䐖^\infpov]Oğx}lzše^\]vh#Y+d(j3$ȖzstxnzzszxO{gk݇zwpmgplzn`"~=UH+gN0zwgfislzmql~| ˻ B W}@U~urffwypfI5}?X|?H~zqII^\inepoQv4Fئzŷ mq^&x**5gZ?Fm䐖P~xhht|~yr~CM}T'D([e:+ ޱshTYdT{|Z^,<Jc󘋄|}9-7 cٵw~VZzyYttY}͋ʋȋދ\{tu{nFOzU`]zUz{\:/w otwwtvws~vEchhc~}nG}mNX)8%*.DrB zpwwzozz}gGz8H+/TK ^ӹ6gzslpiT[`;4=}g_ y25)77/9*;T*B싙╮qi\m-q-t` qi^r1N孔dU>{l? c@g@YDwl Aj6KVocuzؼc(Hezkwtzwxkwy}]p }qvȴᴫomoksmox_`c__df_ zl ,q+wvq y7xxvvw|xyy|s{x$~z*h}~tXr~cng}EM7oxH z@A !+"5@upQ, |Z D| lRBs@M[Rӭʘvakyy~ysZ{8^t t qx~UG@ʘvakyy~@:!)CPNAA8^[Wng|a{[vĊT=!NtlhM@!" ½ Nf,MbwJHRPg{}{˃~knoykv}_swsxZT!Z =v0p9ki=veepk9sx\4"[s8~~yz\eC[pzwy~~~8A0tT3 l3 @f+u4 g4 !} cϾ N)jazjjSSf5XZssvynk~eLojͬόtzc MxjEMxj eH!   IApA IAŴ, aApA  aAŴb,  \->1zUg^zUzrgRTzUbcUz{]X[yYtt]jM'xN\z||qyyopvvƋЋ8wh/bkj{Xmgoswwu[hQm-)$ bhkwr`s|k{ƨᚸދ`JL;]xx\8s E}H73Czv~ݾ;>5\5"TYiV$cg~oy~|} Ό,2'I{wlutu|a{[vMO {ХvvwK]@[Gp^wuy׋.ACiVQgs|jsOu~y|{ƩP8ࣲC|~y geαf7Zf&"0*6k=^p*[G]ꮕ|{2$Uc‹碖t~p|>dyv!R`]1fzozjoruzXpdm+kLՋxyu~xnqy{ufVeovG;>J`ٸ/lɋ ڲ{\]z " uyx~|{w fs⚋!/ V++݋4MX < uyx~|׋{<(]S$ )I=І􌵑݋2]'[b =ei|qyyopvv\-ʾ] ':   " uyx~|{wt​@@ V+,݋4ML-X f :  < uyx~|׋܀<@@@$ )I=􌵑݋2]@@b =€|qyyopvv/q   }J5e񃋃rU{$~(eRT909RA=Rـ{&3"N "N-O q@ӎS|rߍ_^HG<Ae@)@"|@gӈ@@M'm p{w ب =w1ZZm呭kj{XX|YVj4ptwwtw,Gptwweawmy} N$L;\xxk~j|XX|'*t|qc=  zmʯwRr\vuv;]C=qj4{nkuoqvwsuw{NjʋnuptwweOy} N$L;\xxv Q 8 w -TG'',!Gʋtt|qc?Gptwwkw1/ė xߵ|w:Ss\\/>K}}}f1׆TG'',!GʋtKXc^jhrGZ|t$ptwwk(&WTT^qhd|}- [(vV5c[[JdfYg{p~ڲ͋VNطËZXKTX}hj^mhlnqvwR`quattYXzUg^zUzrgRTzUbcUz{]pwZw}  : >ʩʘvakyx}ug_r:kr|ut咭kj{XpdReeVUm҈v.olI P@fgiMX[yYtt]jMR`quattYXzUg^zUzrgRTzUboNީʏЋԋtYlO:ZyzUtZeUz͋ʋȋ~vvt{zz{vl{~t{lrtxvzuÆz=VzU`co`# AC -p;Xߋ}uzK[mmYttY)먐wI)kZ~iwÚY.2%pI򃰋sdwߜ@HýzUgfUz`q~/x!|@CWW0zrVЅ$zUb]zUzvb+N0D\oyYttYnzU`]zUz{\t[y0c~s:}h~HLowzygf_`jzk;j_x_x `s}xtZgc~g<\~s:}zep`o (Ⱥȴ|hȤw\LqiPutqh+  t( `y  t  t  r2 Jr2 "Ep) Ep  Ep P Ep$  qd qd p"p epo~ (tuPҖOv@wȪ}x~Ⱥ *N )p " p 2p  pniz$ p $ poouo$P p $$p $`p Pdp! !p"   pV# `v/Vw(US$ R ɑ% & ' $ ވܣtyP( )) * + , ܣt_F- . / 0 ܻ[Q.1 2 3 4 ܣtyP^5 "06 7 8 ߋ/ 9 ܻ[PQ.1 : ; < = }iܻ[^L5> ? -L M -@ ]A %}^rqɈ_]#B  C YD ZE \F @G }  fy  }~~{  W s5H I [9 ,Q}vJ eK L _;M N O }*Щ^;  < 8= {u>:n ȣ+TP wQ TL:n WR S ~(zh8T U V $S= QW I! 2X IC  C ӈ\C D qu mWY xZ gz!D<4p[ \ d] h^ }!_l_ t` a  }(rG `H q4e (WI rhb cc }vDS 4Wd |  I}<Ǩ]\e f g |H|h }J |4!#J#K |4QL ˈ  i  ggj SVM }vvwwsvq[vc0__wx_kr~srl}Sprsipzyvh @ 0{z}og~[~z||YFYgc|zsesskfu~}tuP~}ḽvqn~oy}x{Pj4|w|~uxv]c{m͍m~{pw}@~Zi{~b[Xg~vvxx~wxxo|kguc~yz{ss  cugr~qyW{Ʉ\dҝsn|0z{d_t[x|s`yze~vz<xxuqus~}{w|y}zpl}{Lyyz]<u}j~~\Uxj zt~qi}p{q y{z~~yqQm~y{f |s}y}s}TWz~~}qyWot~tx~vyLzqn>zvxx~wxt{{yvxayfz|vPiFZ?d0tcjoj:K_q}||aHM^@?uYmziu蜗tkqSY=nuz{_y|ͅY ,  }69Z. 4R??*(".? (u k  }1V  T7k  P9 == Q&}D D&q A-;A A-;;A > 'RI~wPOPO]-]-ɩ{ny{y~k 8+Q_^^_ ` H6 K W M-M  g5 >u[s znnzxp]} P  K< ܣPPʋpxx`TEvmvltwwt'ʊEmmuwwt~咭{xwz_?y^Yq_vP=bpwmvltwwt'؛ܣO_GbᒸivntWmggpswwu3ʋpxx`TE~{mvnuwws)ɌʋftwUY_Dy^Yq_vP>bp~|mvntwwt)כܣ^5l bᒸivntWmggntwwtܣP0om ܣP5*ʊEmntwwt咭{xx|4,Kw{mntwwtQaotwwzȋɋۋdX`oywwsvYJLRclt Ǔx~{~kjݏݍˋgR^}be_k U }bh{M U   uaPTx_ċ^WTgr^jQv±‹ɋNM7-ml?E6̅|rc~Rgcefnu94æ΋T'4&lygefиwy&"*H6ٸċKIR,hZTD$Wt~zز:>8BL8iuvtnu{-]xwQv{~yrl܇Ñ݋2cL{mċl\n o gewO @ sދ䫭ì̋싿iD^8Oș咿9KN{v~w}_i;##)#ϓˌxTWnN3e˴ҷ~/@  r ވܣtyP( )) * + , }ջ[wd.n*~{xpqmazxSb¬{|_gn{ܙ*~Sb¬{|_gn{M ܗ ~{~}}~{ХvvwK]@[Gp^wu}ע.ACiVQgs|jsyyzy~y|{ƩP8ࣲۘC|~y grvE}t   x isv*5 8e!6ڳ5 \F'dd*.Z:%k'7 ). >8,;7A'7/赇iVV{^^zT}~^Xg< Fܻ[ ؝ v}п2 ++ + + W60:@P;6Fv^^bNp0f@/a@ċ_aQNӆ@yO\vA vR]|1B C D vI_X E  ^ vQ|QF v}|}G vH v~PES_I J K L vM N vNt2O {ZgrZyQy,u|{|suumċlvs{T{v΋ċVE 72ml?Eꋾυ}rc~Rhbefiu}̺r\P+Bp{{efwy#%*A=ٸċBS2FTkB}ZTD$Wt~z9?=TG&iuvunu{-]xwx{~y~|~}؉Ñ݋2cL{mċl\n o {eO : sދ䫭ì̋싿iD^8Oș咿owQ|v~w}_iRO_}،֍Ҋ~xx|4,K^x nE< {txr}t߻[R'.w F呓~xx|4,KWx EV uirpɋ+ L#iML\")>(ugx{~`~hpbrs}i߻[@^7ly^4Azxm{zxgonxSb¬{|_gi{M . ~}xptY ~Ɍ拗Pߣt^Rj`vsm$HAysulvut̶L搸y{xngf`f~ɌȋauDP4/KwmabSe_T{zxgon銿/ ܧghܣ]Rj`vsm$HAysulvut̶L䐸ivntWvmdxmotwwt*ɌȋauDP4/K}tߣP5%ɋʋEmouirpɋ+ L#iML\U呓~xx|4,Koy Dz ߣ}P`5%ɋʋEm{txrÉ΋dXVy~vwgeYJLRcltBҊ~xx|4,Ky vߣwP~5%ɋʋEm{txrV4}utimu~4R·ĸŘpmgovx{>RO_}،֍Ҋ~xx|4,Kw{mabSe_T{zxgo~nFܣO ܣP0om x{ԫiD3 l  ܤ>0  D| _M_ gSySzg޶`pʁl L{, L       B    ,  LB  Bр    hvg   utor   .   vm M pzz|L  ep`o (Ⱥȴ|hȤw\LqiPutqh+  t( `y  t  t  r2 Jr2 "Ep) Ep  Ep P Ep$  qd qd p"p __ mRySzbgoiޫ@l  A  8 Xw} X 8@ ]0 8@        ƀ|! 8 8 Z $   j~ F  8  Fܣs  Ճ{ |  } $} T/~ B_ [3wl<  0   yQ xv/-ոʹ߹ z { -PgRW { dj>Iv in  ݱ ~   ;w3; :w A= ˥' v>mD 3Ѻ    y~o XzŤ*4 r X; X~F XPa   Xv𓉭>  A X~ X4J 5 Xvr X}ţ\_* è   w  Xu!ow S t . 3g踜 c " !ӷ˷t  " FҬ!   =ۭi ]  X8lQ 'R {L-ٽhzS _lT zU V !W K" ߿X oBY sF4ٿ~tZ [ >D0ڿ - n ]w( \ ] >9e^ _ 0R` UH6a  }ܿb pÎc pd Õv̬e xf 6'g ph i Tj kKk g/l )k , ^~y5~m xn {o Tf   "䫡w.np wο7q Ov vr fE -@: " Գ" |o =" ?>T6 ?B  vKo  E^w  5 J Kj^w~rt { ~u B SR Le2  o&T󟅥\`ȉ    w Ȁ 8SDw ڋOQz { F Q, |Z >\w? ⋤w ~P L 8M OX4 lv C! Lz$ T= w &"['6o ܖ @(| bĻ| ˉBeG x ?zB oy x} ~ evy\Pr av{h ` zvq` T$ݣr Su /m߽; Ⱥ /mH; Wx`  `  Ⱥ \ +[;@1 I L$2㨴.       oȺȺ  S_Z(w@Zh9$~w{d  d p d p d  d h SU^] w@[c  *  ) Y L I  I J I  Y ,{ |  } $} T~ B_ [/l<| 0   yQ x4~/-ոʹ߹+ z { -PgRW { -n`>I in ~ ݱ    3  A .;'; !)>m |Ѻ a a ,A ~@ X5Ť*4S r X&;V X#~F X*Pa*   X3ۓ>W  A X1w X,4 5 X.r X2ţ\_ è   w  X:!o S , . |g c " !C˷  " ,FҬ  =ۭ ]  X'8lIQ 'R '{L-ٽhzlS _lT zU V !W K- (߿DX oBY 'z?4ٿZ ~[ >'D0ڿ -s n, ]w(z\ ] '>9e7^ 'N_ RO` U'H6xa  '}ܿXb pÎc pd /̬.e xf /6'g ph i ,j kKk 'g/#l D , ^1y51m xn {o T/f   7$䫍.n@p w,ο7Lq O-< +gr f'E -'@: "'  Գ |@ = ?T6n ?m  v)Ko)  E+^r 5 &Jo K-j^~t { ~u &̩ SR $Lp'#  oT󟅥\`&    w Ȁ 8$S0- $OQ*z { F @Qȓ |Z >$\ $* ~%P L) 8$M. O)X4 lv C Lz$F T= w ['6 ܖ $@| (bĻ &BlG x ?%zB o)y x} ~ e+d\P a-fh  z$\ Tݣ $Su m߽ɢ Ⱥ mH x`"  `  Ⱥ_ \ +[;@ I L2㨴   &p   ȺȺ  SZ@Zh9~w{d  d p d p d  d h SZ^]@[c5  *  ) Y L I  I J I  Y 1{ |  } $} TG~ B_ [l<$ 0   yQ x~/-ոʹ߹ z { -PgRW { n`>I in ~ ݱ    ?3S > AU .' !>m\ TѺ    ~ XŤ*4 r X; X~F XPa   Xۓ>  A X( X4b 5 Xr Xţ\_B è   w  X!o S  . Tg c "6 !˷  "6 FҬ9  3=ۭ ]  X8lQ 'R {L-ٽhzS _lT zU V !W K: ߿X oBY z?4ٿZ ~[ >D0ڿ - n ]w("\ ] >9e^ _ QR` UH6 a  }ܿb pÎc pd ̬e xf 6'2g ph i lj kKk g/l  , ^y5m xn {o Tf   7䫍.np wο7q O r fE -@:- " 2Գ: | 2=: ?VT6 ??c  vKo  E^# 5 J  Kj^~t { ~u Z SR Lp'  oT󟅥\`    w Ȁ 8S0 OQz { F QD |Z >\W  ~P L 8M OX4 lv C Lz$ T= w ['6 ܖ @@| bĻ BlG x ?zB oy x} ~ ed\P afh x z\x Tݣ Su Pm߽S Ⱥ( PmHS ox`  `  Ⱥ \ +,[;@I I L2㨴O   .!   ȺȺ(  SwZ@Zh9<~w{d  d p d p d  d h Sv^]@[c  *  ) Y L I  I J I  Y D{ | V d} $} T:~ B_ [Al< 0   yQ x<~/-ոʹ߹E z { -PgRW { Cn`>I. in ~ ݱ  V d ߟ3 ޟ A .' !G>m Ѻ]   D ~0 X;Ť*4 r XJ; XM~FA XFPaF   X=ۓ>  A X? XD4 5 XBr_ X>ţ\_ è   w  X6!o/ S D, . g] c " !˷,  " DFҬ  ӭ=ۭ! ]  XI8lQ 'R I{L-ٽhzS _lT zU V !W KC H߿X oBY Iz?4ٿ,Z ~[ >ID0ڿ - nD ]w(\ ] I>9e^ I_ R` UIH6a  I}ܿb pÎc pd A̬ve xf A6'g ph i D j kKk Ig/Ml , , ^?y5?m xn {o TAfV   7L䫍.np wDο7q OC Er fIE\ -I@: "Ie ҡԳ |0 ҡ= ?T6 ?߯ Yg vGKoG  EE^ 5 JJ KCj^~*t { ~u J SR LLp'k  oT󟅥\`J    w Ȁ 8LS0~ LOQ{z { F Q |Z >L\ L{ ~KP Lz 8LM OGX4G lv C Lz$ T= w ['6' ܖ L@| HbĻ4 JBlGl x ?KzB oGy x} ~ eEd\P* aCfh  zL\ Tݣ* LSu@ m߽ Ⱥ mH x`j  `  Ⱥ \ +̸[;@ I L2㨴   .J   ȺȺ  SZ@Zh9~w{d  d p d p d  d h S^]@[c  *  ) Y L I  I J I  Y v}  L,nzif{fdg OP|! ! o]\Pw0)" I# p$ % exlT[ & ' h( ) o** pW} {~} pÚDRVzIYR{ɽĺ pDRVzIYR{ɽĺ|Jw3۩ / - W[. / sa|m0 _1 P|2 IUwT3 HTwb4 0qvv H5 6 07 8 vz9 '-': r>l>; }< *\= |1> b? c@ TvA Ro]I1B C D 4vtXw  I=􌵑݋eGuyx~| ͋ zq|z^*Ϋˎ= Q|ŬQF m}|}G gvH _~PESYI J K L vM N mNt2O }; < < '-&j P E: vyQ # R Y?R v]~S !} c f)T U V  8 W X s5H I [9 ,Q}vJ eK L _;M N O }*Щ^;  < 8= {u>:n ȣ+TP wQ TL:n WR S ~(zh8T U V $S= QW I! 2X IC  C ӈ\C D qu mWY xZ gz!D<4p[ \ d] h^ }!_l_ t` a  }(rG `H q4e (WI rhb cc }vDS 4Wd |  I}<Ǩ]\e f g |H|h }J |4!#J#K |4QL ˈ  i  ggj SVM \֮*R *\ \ܧeoR  J mUkF ws5H I [9 ,Q}vJ eK L _;M N O }*Щ^;  < 8= {u>:n ȣ+TP wQ TL:n WR S ~(zh8T U V $S= QW I! 2X IC  C ӈ\C D qu mWY xZ gv!D44p[ \ h] d^ v!_l_ t` a  }(rG `H q4e (WI rhb cc }vDS 4Wd |  I}<Ǩ]\e f g |H|h }J vI!#J#K vIQL ˈ  i  ggj SVM .æ W     v8 .æEWjBRI    rL @  j3v  >-H   7}\ b  grvE}t  x ~ֽ3 \ AŬV vvAw&G i +(F~y  n E =Zbu ) c v5ӳKo  l& H$wװ h ~ r>l> 3H`@|   { w Ž/ b&(&  鱽+  U]#A ]n   *<  O5ӪT4 j ' H$w h !Ic ½ NVI   c U15" bH I U1l5# qbH I ]m|5$ {H I ӠP[58% & ' ZH I Z5T& E H I ݥᴔ5~ ( ) t H I (v5Dr[77 *x8 o9 : g*g© ; {u>:nU B1ȣ" 2,P rQ {u>:nU ֟1Yȣ# $,P rQ {u>:n] Smiȣ$ .>P rQ {u>:n.Gȣ7& E `QfP q`Q I!U1E0+" ȒX I!U F1(9# ЄX I!]m'0/$ ȎX I!֑4& E .#X FE +T> 8? }!ݠP_g% & ' a@L_ b@` @a  }(U1" G `H  }(U1# G `H  }(]m$ G `H  }(ؠP*X% 2& *' G `H  }(t& E HG `H   }(M  K= }U֎1" RQJ }U1# DQJ }]֟m$ NJ }օ,y& E J  UgW1(# Mdj rɩeȪ (W }<Ǩ]]€ e @f €g Be f g U15" bH I U1l5# qbH I ]m|5$ {H I ӠP[58% & ' ZH I Z5T& E H I ݥᴔ5~ ( ) t H I (m>Dr[77 *xg8 9 w: g*g© ; {u>:nU B1ȣ" 2,P rQ {u>:nU ֟1Yȣ# $,P rQ {u>:n] Smiȣ$ .>P rQ {u>:n.Gȣ7& E `QfP q`Q I!U1E0+" ȒX I!U F1(9# ЄX I!]m'0/$ ȎX I!֑4& E .#X FE +T> 8? }!ݠP_g% & ' a@L_ b@` @a  }(U1" G `H  }(U1# G `H  }(]m$ G `H  }(ؠP*X% 2& *' G `H  }(t& E HG `H ҽ| {i0 1  }(M  K= }U֎1" RQJ }U1# DQJ }]֟m$ NJ }օ,y& E J  UgW1(# Mdj rɩeȪ (W  v֢4J& E (j q5H H I q5H H I .~5[ 7 H I .~5[ 7 H I j.Ն5&s z%H I j.Ն5&s z%H I }*U 1# 6; }*U 1# 6; }*]m$ 4; }*]m$ 4; }* * `; }* * `; }*Ml: 1; }*Ml: 1; M ol(: Ԋ< 8= M ol(: Ԋ< 8= FE +T> 8? FE +T> 8? {u>:n G^ȣ+ _@P rQ {u>:n G^ȣ+ _@P rQ {u>:n T,qģ@> 7 x`P rQ {u>:n T,qģ@> 7 x`P rQ {u>:n ։ȣ* )jP rQ {u>:n ։ȣ* )jP rQ {nu>:n ֢թȣs V:n ֢թȣs V:nM Rlkȣ: /;P rQ {u>:nM Rlkȣ: /;P rQ ~(z]m~h$ T U V ~(z]m~h$ T U V ~(zΩ.h 7 AT U V ~(zΩ.h 7 AT U V ~(z h* T U V ~(z h* T U V $㶩(z`hB z T yU zV $㶩(z`hB z T yU zV $S=] ֦m$ W $S=] ֦m$ W S= QW S= QW I!ݠPH,% 4& ,' X I!ݠPH,% 4& ,' X I!20  X I!20  X I!ֳ 7 X I!ֳ 7 X In!|6s hX In!|6s hX I!-04* ȉ'X C! 2X C! q4C X C! q4C X IC]m'0/$ hC IC]m'0/$ hC $\C B D $\C B D \C D quU G1:# eY jZ quU G1:# eY jZ q$u nB ZtY :Z q$u nB ZtY :Z quU/ 4ȇ$f; 2Y ZZ quU/ 4ȇ$f; 2Y ZZ qu0etEϪ M($1@ EY ZZ qu0etEϪ M($1@ EY ZZ qu m+E xF qu m+E xF }!U_1# e>T_ i` a }!U_1# e>T_ i` a %㶠!_>иB 5r_ 9` Ua %㶠!_>иB 5r_ 9` Ua }!M_l: eI_ i` a }!M_l: eI_ i` a }!_l_ t` a }!_l_ t` a }!_l_ t` a  }(h "G `H  }(h "G `H  }(復.{ 7 ?BG `H  }(復.{ 7 ?BG `H  }(Uo(# # G `H  }(Uo(# # G `H z|xI1pMw  ! z|xI1pMw  ! }vDSU ֣1v # Ldd u  }vDSU ֣1v # Ldd u  %㶭vDS B ]Md =  %㶭vDS B ]Md =  }vDSM Vl : Wd u  }vDSM Vl : Wd u  I}bpymvotwwt߀a_Rd^TptwwtË߀/ mfRj`vsm$HAysulvut̶L␸y{xmgg_f~~͋vܻ[wPS'.w jʋpxx`TEqm'mgl~~Ӟ{~tGxrV4}utimu~4R·ĸŘpmg_ovx{>RO_}䒮~xxy_?y^Yq_vP=bpz~mva_Rd^TotwwtËga_Rd^TotwwtË}iܻ[P_/ )ly^rAy^Yq_vP=bp_z~mva_Rd^TotwwtËoa_Rd^TotwwtËxSb¬{|_gi{M / ~~xptY'~ˋ拗P}tܣfPP3)>(ugx{~`~hpbrs%jʋpxx`TEoz~mv`^Oe`Votwwv*ɋʋEmouirpɋ+ L#iML\Uސ~yxxy_?y^Yq_vP=bpoz~mva_Rd^Totwwt*֞ܣ}fNQ`߀ʋpxx`}TEz~mv]ZIhd\ovwwu*ɋʋEm{txr‰΋ ߀z~mva_Rd^Totwwt*ԞvܣP^ʋpxx`TEz~mvE=ptwwv*ȋcvwR]_Dy^Yq_vP>bpymvotwwt*מAWivntWmdtrj$HAysulvut̶ɐvܣwPQʋpxyb~VIz~mv^[Jgc[otwwt*ɋʋEmN̋ {~txrV4}utimu~4R·ĸŘpmgovx{>RO_}䒮~xxy_?y^Yq_vP=bpz~mva_Rd^Totwwt*Ԟ~hܣtsQaoʋpxx`TEz~mv_]MfaXotwwu*ƋЋ[awrZHxwxSb¬{|_gi{ ~v}`^bVx^Yq_vP=bpoz~mva_Rd^Totwwu*ӞQu Qu x{ԫiD3 l  a  HK |}עwpSdV{lxeg}`KU4(2j I0‹~ŌƋw}Iu^YLP`PGb^bwʴxuAwt隡k~b{zux5soxspnwwu-{|Փ3 d|_tpplw͸N ߈ODwuzN7aru~IKzux5swx{wtqd|KI`ywxud˰[TY!  pv}}x{EHrbr|z{P\w}t{xoUZ,{|̛rvwt؋ohY FɬɖV"5RJ@fqـr%?)= XCm||-|{OjwXk{iutlo/LHu~~dy|\;ko \;kl S5s dm`^  ` ~k a8  yv򴗼 dx y S5sm pGn  pF k-;;k -; a,< a" W h   \=9 oo d&6  O} M^^M ` E5 P1&z Q{ W?R0Cϙ{vzz{u~s|%:4hԐx|bvouuHK&+Kz]Aze=X`UO9I-A"$>s6X:&:41W6 }yc4[iy0k ܤ>0  \x{Wfy`֭h[nqxpuz|4!#J#K |4!#J#K c%wJ_k.Ssb]pċ_pv%w~Sk.SqbEp@4K3 ߀ċ_Xq ~uff{y~ryHF}]0smrrmb>HY5dK_LCd)1Z:w_{WLf]kC"{  UWmf]z͋s~|eJ]^Xig9_LCd)1Z:w_{<{ Ⱥ  UWpcJEqx]5:6[yb;_LCd)1Z:w_{<{ vhePGNj'؍ X(v3)%"偑ǣЋ;'  0j!(W F ep`o (Ⱥȴ|hȤw\LqiPutqh+  t( `y  t  t  r2 Jr2 "Ep) Ep  Ep P Ep$  qd qd p"p epo~ (tuPҖOv@wȪ}x~Ⱥ *N )p " p 2p  pniz$ p $ poouo$P p $$p $`p Pdp! !p"   pV# Deʹщ}Txyش|wWZuxvxt xk-{zrw}ވܻ[HVcby^Yq_vPcqy}mnqwwr΋su|wwq ~|[jY9΋kqYiLupnik~}ʢGܣsћ D Խ  Sܣ$ ~ljHESo-Y~|zxxLxmntwwt5触Uܣ ܣЛD !D ވܣHru|wwrG[jYcby^Yq_vQcqx~mmqwwr(ƛ΋kqYiLy}mv 4intwwtW-~mzG|'ܐ8 P8*,U~lj5/-''M|xGܻ[v-  I$wx`m I$wxv^ $w`m \ $w>^ \ a#|t{}.'ad_i|xJ^gVaesuLM64IptwweOy} ZF\cr b>wϿ b>w * \cr p Y \Ժ \ \cr 4` 49` dU^d©~dh`rIrfYSj҂fv ϴ \cr :}8*  k I! 2X r s5H I [9 ,Q}vJ eK L _;M N O Iqw AT*   M3w 0 {u>:n ȣ+TP wQ SVM $S= QW  |F> I g I! 2X \C D Hw' gz!D<4p[ \ d] h^ }!_l_ t` a v0 ʣG8`2 x`b `x` ` x`vzncG09` : =`  }(rG `H q {0    q4e (WI  wYаO ZhB90[P ̓RRTzAgJAX|H|h 鈧$  {! " @o# ˈ  i ~O P 8 h$ s5H I [9 ,Q}vJ eK L _;M N O Iq} AT*   M 0 {u>:n ȣ+TP wQ SVM $S= QW  |F> I g I! 2X \C D 4' gz!D<4p[ \ d] h^ }!_l_ t` a 0 ʣG8`2 x`b `x` ` x`vzncG09` : =`  }(rG `H q {0    q4e (WI YаO % & ' |H|h 鈧$  {! " @o# ˈ  i ~O P ׋ h$ ވܣtyP( )) * + , ܣt_F- . / 0 ܣsQ.1 2 3 4 ܣtyP^5 "06 7 8 ߋ/ 9 ܣstPQ.1 : ; < = }iܣs^L5> ? L -M @ mA %}lջrqɈ_]i#B h C D E F @G ~w`GgN|ptww|e.ӳ^PXxSTL焋~}r\~zGD/| Y(O$YаO % & ' \U1r" \U1r# S]m$ nvPY% & ' ~ aɩ.7 { n E  t( ) \Ur# # [Ml: qvɫ*q~ i C lϿ l j   ei`T  ` r \;ko \;kl S5s dm`^  ` ~k a8  yv򴗼 dx y S5sm \cr b>wϿ b>w * \cr p Y \Ժ \ \cr \cr c5 gSH I {u>:nc ֜ȣ -;P rQ $S=c  DW I!c U(B {X  }(c G `H 鈧$cV( TU 8 c [$ I!3cKr8 )" Y )X I!֑4 E .X 鈧$3֒4e E  鈧$3c,Rr )" Y # c5 gSH I {u>:nc ֜ȣ -;P rQ $S=c  DW I!c U(B {X  }(c G `H 鈧$cV( TU 8 c [$ I!֑4 E .X 鈧$3֒4e E  rx( rx(   Z fx( \ܣk ~! 0} UЫUD   @ € @ }<Ǩ]]€ e @f €g Be f g `v/Vw(US$ R ɑ% & ' 3H`@|   { w }e~ S7Ŗ  \ }~    ^2 :2 aOpttooutp$ ܤ6F _@ p{ ب |5_@ sD p{|5 Ҩ  q |5_@ {q H_   pц E x p{ p- |F Ws Ҩ }jxswwv??*.oѾ_ũ5t~Ldf caVbv nɋ+ ?#iMzYaCz䒭up~o{sdw>_/) {sdpuwwz_cY`pxwwvfZJLRcltp{w>/) {sdptww|%w_vʋΆwcuvAWʇØpjgZy{ZYU\|~=w>/) Г{sdptwwt}˻$u[|8gý{wdlhQ~}pG[w>_i|x.u.0ad) {sdoqwwwNy} N$L=\xxܣ4o؝̋qwq_vP>bpymptwwt|ܣ&xmptwwt+Ȋ؋tS`Z5)Ksܣ5l }ӯǧR(BZ:(`(l*3@S)a><6TA&'4ًߋ8#=w y  }}rxww|t~zXpF~kotmnwsZf%>,z}|w}{u} O|lx~}wrwwwoYsia56C5R~dhhd~xsU%; @ A@@}yy}~]@÷ufzzz}@4@ U%; &uiXMqhiXsb&u-N}iXұ\iX%ұh+-N%h#q_;tg _;t!ŋPl0 _k)1ދ׋_k)h`BOuPb`BI_kA'+#A(_k*}JyIscXRy`V)Ht XR*It7 VJt7Z Jt Lv{(s I7 :ȴ!H #?j5fvF\)|)և j='m8'a9X58&' w'm+ևߕ\)vF J5y?# $!H 9 7L Iy6׍ᰤuH^E7߾$O4l7Z#AHP4vnd8[dp"6 I,dB$Z 9XDzV#J$]ܺ|)Iyᚠ$ &%!R۬J."9X(Aލ,ɋKX)j+;  ݋4 )'m6_} X m4kDߙ8J >5 S,ӶSq,J >5e8S^ ff4㔼 X6⠃)ؓ4 "u;?+ K֕, Hy_@!r"8R /r۬JFP$ Iye`ܺ$ #SDzƨ$ZB ,d"6F8[dnd4y#AHr7ZK4q$O`7}X=mH)*N :< ;! 7}޸ 9H -fgܬ- >DL* e#<):9;b @B :^w0hIya #*@ B ./e499 /Gf` Pb @iyO@2UVYÕy, #v!9-B (1b?fF d0w)XuB  ro 3}% JW[sc׌P=qX4  7_ `K{SD   !>- Z O\ | 3Z Լ j> ͑Ǯh 83 -0:n8R " 3ӷ#!?aC@3 +yF3e}a ={ [e2n l~ɺO7'{sΘ> /Ӌ@S Nw UӋ dAQ:*)#P Cpc!Hs3NV)*B6?[ Õ^8;3@ 3 y_ыNN񳶋B Rt"Mp/9yݲV+޸?ۋ?/>[e݋('͑kF<6,quJ@ ^$YC^8RKz~NuL@ P@:qi/]{ W'J> .V.V+ݲgGlls3{%ElI=0* !H?TL‹@ (e`5?Y8 k)9kFb!Jdދ-WL:!g`-PE+D lIKO\}WG-P > /"  \) }gNyX7Ko\949}/@P@R)y" vY=~)hsV~UoPA P@N3Nŋ^T'l S3 #)S [#IֈpwKHNk)CTՁϝFÕ$8^f$t{|!nt9 ;#-&fXDS3h@R-I8Rb>w#ڟ;u FX,-V%Z^'HAE. ~5b ?}j!9[ecTAA rox#fg;'p\)JsumP<yw %J>CDf%4kXR %B}q{ 9- 0 ro jyX ai #|}! Ë$ !BQ{cLIx Xl -c䐤mV>6K>I N$Wj^'~ww Ջpqw/}aqiݲ&^ĜrLևhZRn ,H49ypPA  MP~6%Ĝzfg6Z&?Z+VPA 5EyۋVF{j%vEX=o\SvF4:8O ,ě[Ys37kmO};YXeQhp/]:`R _3&%; t{xQG> 4;?;--PP.35Ea#T mcy)x!9W\ !49\u=PA @!̋q!f 6E_} D˅%-Y?+9tZ^wN^,I|" R!޹`'-X5vrn" %+9XIi7Mu3%bN1h?|^KZ.j X+]8>v'T #fKNj$w!{}9d݋YXd:UX^6N8R+~wh1\I)8ٚh]d{{NNCqӶsLJȴO4k%5?Ë5<(1'bN)y+DZ}W K%% dYX+T yv9b/\ }qJ=}=KD 3CJ>8SR%^3ċojG'm u$Z\k9\4ELs4mSEӷZ&%ɺ:^zIHB ϋV!L-7Kިs^5!A"IaYXU@ T["7 kĜJ"[d-0bAVnFj4)#ՁmևՁФo#_<+]^wrnRDqRd@69-% ANy,J"hX 2-u@~6[dGaqHiU2PKL;Ck 3XAHՁNVRbRۋ>q9@" }D.+yVФN-#r7Z'lNTgm*G J> WKwcP!$Z k30h%`d`Ro)V%'lB 0b"/ /" FkIyjHZ."`dZ E.Ԑi p)}IyMxQ :_TA<"T! xjݲyҰ*Aeb~|j!(o @h'wByċ3ukD'Y*=is\k-m š`u`ŋcE~5̋V[H`9Z}w t&g&o#T׋=/xRaP'`A{I(ssoR +o%DZ6}Yۋ A@R4{A;#V)@@R{D+ {Z&{ 3lI]qhǮzkCQi X As3[ƨI@ >yt+$Z0b3u PH@f$~5U!!X&"C׋FgT9qidBE{1yhg+h,J9%(Sj?} ?;<)D\XQq#X53.rŢ^Qi?g,ˆbMSs/9ŋ Jxzx=qҋ2oaŋIy #X18Rf0׎޸\`;VO"7)G"O ZG*>)))7RӷjTwK pjCTB%SxQ8$CmPujYkaVp!71 @N)7b(V>LJSuFWLyx1ɻ]KOv}@N9X1h"N  Y^6e@Ϟ0!=Zvs%dPUk#k6\MӋO\<]I*)D1?;&R6 WK'1i [_^+1Su Fffg9@BMbN'+@A o\" |)X9(s]%)HP3usIS3a]l 'mdWKxE{^KĚ@B:Qrow '+ыm[dɻ Ti :QSuD\k [#t{9#.#Te'+Qu-`B9:g̋ <TtC@B%E+c<,.^`i'CO%XfSP h2;|R`V'+x ?TnmLkDX48d.B|)[dNIg+$;oPY:N`wZ [d74` yQ&AfMPhWϋ:^M׋ؓ;eNh ŢN>5nRiTKq'^6< `B>5U@Ӌ2/cTk,J,U?EaGPbNViyR4z{dB ؔ6 33Zm^BvV3u/AH EK_ 7 ~wnV8,FXs" {!ˋ\jKOU?\ΗN7^M|jSuJ=E`)=Ea+n"7L^Ձ9ևE'z^+# 3#(syz j L\k )yE|PJФQiO )VJ21h.V 92< "RF'+GmC Zx=vNZ @- Tܬhg"c)%J}=' "  /mgqhA&$ANV 8Qi`Y @r +3feAI iyqɻ.1 hE6F!8R|) D/i5a$ v߾:+;nI1U? R;/\$ AM} և%2]&ff Gu` Fd{ڠ!|) ȴS42Rn\.V#:1h0b P | 1␋L̋t:bNlPb'++9 B BNNUӶRT{!mP9R-^6OD̋$Tc޹G+\jznAFݲ/. Vw P =/VhX#]r`9X&9>TRH#Ф:= H19K8Rb TLH1QVQF7!@A5+q x@)'ɺce7 u8莘Miyy[ AG":w:0w/Y7 8'Ea;)7R}\{6ˋQL2ϋ-!Gn 8O\ 3td f%kDy a ׍ N["A!pAT{$uËڠ KD+ y# &$N +U?J>= -mnl^H"IgmCؔV]/O]MO;m7khr\$)y3Ro_/ & 7Lo Ab ( kՋ-*=D}(1e^6Ѫ@1'AH (1 %QbNϞ MPE$NBՋcwLuI7&!21/l k `X/S+HVΘ ɺ J3!<)* ^-PS2Jh3#yr7@#`)m/cjP,^N\\\s3\hs%O\\V5@ jSroX[d D7z\17ϋC͒%`Q(ȴKCl̋oMP')y7L$A8N 6YXU@T7 = gm?}y@!cT{#Sw;#N 3/o @L̋V{/g [ )VF͒T'gɺ?G+2D@$BGm/ ePdQmaˋ`4 J`Aˋ Mx&tӶ< D)7޸ 7-bwn h1hRXYXԽD(1G)\fg+LJ\Roh!>zeLbNr^gB5hCe- LaS3`aG_aQRL[TAˋPt{\kWP!v @]T;_;1߾}J[ȵXnO\rQ'$> 3cTLI ^6%`@@@=h1ɋ "N=aq`MTGmT{ P*=}q 6$Õ_PPb`F m=?[aE^vSOߋbNU?7 - `L9x0PS3E ^ ax [dZuh8pcrlk+ T9l^+R! yi7qX&Gl9P?}}suYXbƨO88b1hv>w-P't9r-B~6fa/Tv#Dd\0cpe`X7KPՁH1/Hs0NVI+)7eU0bJAAF'NV苋/j=4JFst9ܬ16S߾iHO`RvPb] 9X,!3uf%L'l 0!\:^Ձ+*>*+DR*JMo?<KH1r Qi K׋*$)Ձj?YyR8 io.V*%ܬՂd׍5~v XuË1Lo^g+&+TvF1ӶJBbNۦ|kً.G\y `!푋 Vȋӷay\L/ߋVFtߋ7J _<FN"1$f6IٖPڀ&t<X>[yo|.-,HG})?Xٚ@#2ocP$[g /9RLoq|)E%NVѪNVɋ9xƨBы Ah UKM/Bqh^&fdZ?ݲ* : iyȴ : gx[ݲ"**"$*Z $ /[#i2+mӋcTiYp)**#"*G'wϋ!Hu52\ԽKu8Ѫڠ&$/*P990tXPbidZB ;#-p9;:%`T?VF)苋3u-q @@3#T/7bNv?VmP-l U#EW O}/IyZۦ.ًxa>wv(sTFgIy˅MP 0 u?Ög?;j2oPbPcTnT okC;dgbNtI7DRREm"=~wZ,PdɺB Aϋ(ALN0+J>VTmŢ8lTN`y^D4{n49nVXL/ XR{stgc z }j @B^6fby'+poR O\T =JL(1ǍlVEcfLomkԼ)5WB6CФd8ՋJ~y) 7 B 'Tև(,,#TA|kNÕ@ D 7)q և}/8UqA8 F%+ɺog+Ax q1<pbq>^ zg`t{#/PoXRh1`O- c G+S G+1ؔVr^6EYYXT}ٙ0bokHQ' -&gy  80@@3mi8!-L9|~}+n *0b!LlB*rj$['?>Ұ Nx^-ڠ ~w sJ-s% ST \DZz^)* Ǯ(ϳ3 +r-*j! C޸'+#Zi >wHs_<p, h^51';DU' /?vc&{t4{)޸u"%p!iX=eg+Iy3BI7JkRoCTGNnHsFe`3%`Zp-R)F;g]/S],G?j%=l1T.;#:^#X:h:^Xsc ^AR-/ٚGoqU?///P&f9t{ 7*OD'+߿yD^&f@ R4NzFU@K 8% x-%{F|J5`iyNs3 Hk>)!Θo<FrQi?ƨUf4cDTo9a{d4|DLJwLÕ:wK&f8R s;-)0ڠ5?rnOѪbsB!s R-~Η\e1wL v$oKu@XGl*j, <%a5JZf't)q7L^wؽJI.x :^=/~5@5V< kK*)Xyg~61}w4{u@ Cck}, H]N@1Vh1Ahs8RF0B{wK aHg ! z'l!!%su3q5U?ҰR^*>cX7+StEaZ 'IaOnveR9*=y' 'IsT:^LJ޸ O3)7c 7PgmpnBN{dj$)}4QA DNP[d=ӶT:Qi?}PbibNDSq&fe lJz|)0ڠS  %d&['}!Hnd>nnVS\XǮms3!U@-%`>id;싋 #pmZfu ,RoNj@k^P 3{e Tf xK/23: }6EI3V\?;S6V:^ƨ6=Ţ7K/UT{Scyiy!ً8JۦP^6ϝh2gJO}mɺNsE>pb}\*>dRst#`]ݲ 3 mBSTӶ =amP+gXH1A&-/Ro :^ΗNnVq%`Q'pw' >KL3.V%˅%d@@/&fmN %P!͑H{jo#T-H1;#a'[T)+)m1N/)iK B%a c%a,2+3'BV@#3GEN{&%]q'+׋W 7L2&%6"M3o]bȋQ'(sG);w4NVoФ=7 :^]2o7j5 ,J95ukD`K=/dR3v+Ղ~v(rI8z^|jJ \;e`y&J=sL?`AdZD1;<)Qgl@C7V_',J#7K(@][# JGw@Vm/\X{X߅9XϝsoL(@[es@f{ Ju =A6Fk wM) 5~w)x!$Mlfde Fh%j)%`bt1~A(G@Qhs?!ȴ\y*  Kw mP>߾5m;+hN9h~&{%@ffËNu*=;Zlzg AJ 3 APBȴM b}$즨 ::tz,Dl#:}9X{";#uPH+b=ipNgwlJ AV5\{Eyv@dPf%N{Vvq]Tc.7fkh\APyF].aZOZG;oL` D\lG+]}[޸?}2\4{g+-mCTN,Rm+CD#>w`FfZ/9Co| PcVGE`}DDr(rwdloA;enڠ 1i^QhOkdZz #Tt?RCL Η)+'6F PM^lJf!^5 ]?G+ 7+mևՋijQ'u@e}6 EBRcMP7Ĝ%YX@AT;c1&u.xvE iZ$ \*>FO\-\:'lyD>- bkr-@`?rn: ` $ZٚyUHR-U@.W`(sR-/^}ӷ9X@yFf,ol% CVEPedJF% e%e`" p+!@^Z聉]/Nih#{" zq Xb@L*C{nff6yRuE-p!bV%xRC !suɺ*>MM*>*$?.V FgyykxM^ ;ea4l1iy\-wL%gl;`$=Fg`N9{@ Q@aF`LI\ Ƽ)=qܬ"gC\).(C4{cn#FФ ^G++C+\ [d9W MǯQ(r3< B{9?;b,RCg+ajrC5QbL0!o4VCT%/^X͑@NRojRQJ$wz+wF=qq.V;d}/i8Xk 3 8"e`v7d[yٚ+b|R #P |)FZRyXٙ@6X9 YX$//m:b@3t9KK͒^^2nJ{{2-sɺ@sKK͑J^^2o 92-sؐL ܭh-rDJ) Z&%P!?}T' 1ꭑG+7 ƨz )׍F5'+*R % i!G-LM*)XRLI*=F)2-B{R-+FKn m z '?zUW-u@MP-! g+  y/%m>p 2-@]@M" --&p!ܬ&fѪ˅B( FEf }DPe3-@CP/qϤ)%u 'TM Iyl uRnEՁL J3  zȵ kFf*g3]AP Ky0@;0lJ': q'fF%}yW BH>rnM2yt׍S? yqj V  Vh'LH ;ud+H\Enro)n[,:n3ƨe-dZ#gfpv = *yXbeұ[e@ Yš/]/\% 8vȋDRDx͋@-)R#Tf @ jڠ2 TcT:2 T ȴy 3f7Z]F9-Ggj$K2^h LJ拋?;lGmڟBmWL!G1<D]>sGl>Zl]1ǮZ 3_<ՁB &˅"+]/7CTCT8R*>X_;Ns@ pb9FL*)**=,J>ՁFgm>7 D}ZPV;E`2cT)|7LfH4'mVFr)j+*!05?@ 9 *4:ֈk6[#E CyusuX#;7/2M>5+\4$pc]w"BMny2jALOq'iyyAX)P~C k!x~wTp#fO%YK)l}' L5?<j`A:T%-+o C@9sc-;" CTzj}X?)yX}p;e=S4޸S'+ϞsnF%RٚyAq}k  AS-!1R%E0b Zw34͑q' x"VǮS!{#)&%8 B3C@1*Gl7(C'0!<JVOS w cx9 qh{" mdB=q'hbNqi7k͑#qJV2.yT9;V=# |4)3eGyXR]{`B߾vx Q'gm8`rm^j=dfis}~l |swl^6Zoi7J =`@VJm-xbPNDP'+CTnI W^Wa@)tD>wvqheC4p =vBrRn@pH#L1=)mPw" V<-cw" Og`)hsmP"e4ΗB!9L_;Py3U" ;DcP_u" GAR\ @!mf%Admq'pϞoMX4:?('U0,-2ݲ@A#|)J0eӶ1@{-@;OMP;dF\VJ@nV}sAH8Du:^T@l1h'a)q'g+|)fgM),+1}u{#aXR 33oAd]qsuyu?7BN'NP@@RlI$RGmb9TzwDZ`B,\#T @@BEFX#BE`~wkV3VX1St`{@+DTLj}`=q%߾hPr^1'@ nU$Ln@f%jA)^dZZpcyZeؓa#I﵁#oYNA0Y'EJJ C>5PrGlX*Dm}uP)J:Ertv#H1<+DufgT{ WK>@ /RuyPb6=q)Th1stHEqe/\ 0!/1h# RQ C5@r`+ݳ]/r-`{eLC[dT{~gl 5@ [#{eama-LXR)Fg2V}I+a7ss#t`o{`B.V)|AKoNFRz^n9#,In7l:}6Z@>Dt{aAGscT-ny~A J=ҰT{`8o@*wmI7#燮#I)JxRy)I8\+^!G>Yܬm<=ptDK3p@WR fgPm2-}iy >,VF+)x4%V$7DƧ1bT`˅5Ëyuu/)b!Gӷƨt#sGVonVL +bN,RZ@}v'[T{QoJ`> LJ)? KԽh 5DǮfˋ&gf-Xq%Xؓ>wT{V5Cұh2by%! CAH׍e`@@<?7Lqi V'+  )_}L4jXۦ߃bH@T9k}0YX" f%fqD Jp}T叞T^w4{73AH}q .3DTt-kT)CT* s3e|j^ɻ`?!law v`glZ_D 4^wVFJLhhhT{z4{ 2DZ`'+TV&$Xg+ Bh r@;e Ʃ̋ n*=RQ'iyPb" V˅'hLV5<)oФ'`Qi u5u8塋Θ{'+<ʄ/p _}Vj@j+ҰˆApb1h It{Pw<)Yd@#9CF '5"uNK6}Cff%;{%AmIxEMӷglNo3!=qf#r-;d%O Mݳ\k9dkE<(ZaYXPWL ꋋŢ p]qݲEaAH\$^}46Լu'F&f{q@^+J+z\c]W^bNyX/G+:^$Z|!yYD)y'pblplq'l% h uݲ1h%bg @}q{eVFУb ymhJe}̋5j=k(XztۦڠՁ qhI3?3 ;PԼڠh.#LP՗Lc%\ " T?ҰLJФŢ.ĜtT}yTܬՁܬ#* Drzf-8;D YOP!5*>2**=u@"N|j@CTUr{e'+I1ܬNdDIy@@F%U?O\] tyCSw3ck<V|)yf,i # K@XRTc:;G0d_1 MPpcQ@?V%a8R}FV{%" wƨk$#QB\` J{KC61'xLxr|)AHes3SG>yi7`-P+ NpT+D#n`-aglQ33 B+'Vff NZ~NW q'@An* 82 Irh@yMg;n=b  B bVEqi)7 caIzΰh|D4JAA1''u?=f%a}q9c?nVhs PXҰFAHB}d09P o_;a mPmR-9h`Bl m-V]q,J@fXyX+/\)o*M-7cTi7d L}Ha; y(s*>j)7  *9 1jo \0o0{1'ӋKV73#f$q0Ccaov >m\-]Su 0}`B =O][#]P!qևJ d;-S^+vMPpK /%Nb MPMDy-\VM hsJe]{evMP =pHsy!)8Rx {^ncp! =2-o6$݋X&%_}u(s&fa{)R"ыxR491wT9}%0b! $ދI3.4 JAt9 C2ny)69s -H5r|jibУr-1 z0hSI>w=NV}qAiC=D3]/yM=SGr˅$3t]q`yXuvv2w~@{?;`v33_޸~w)' ŢZ Hx?4D-P+DbJ=6%Lx ]'+8{YQT.1'/ 1勋^6{wGopNz`>5E!P!GdRL% KC`<RgEQ   wK[NVt9-˅ H1O\(1 E,J]q'OwKbNN=) Ѫ1r9o6ښ*LHNHi7RJ>! Ҝ)<)Bcɻo]CCǮ' 3T\'H10}EZlI ;e-3"|dj>~-mAujN ڠmP"N6E0bXd^v0cpG+/ nH^8zT5?p {l~ D}&!h2b KuRSuGO'mxR7b>5KC:^r-% }}<ԼVVnt91m`(1}8Zls-@1+DnwK'K)5﬋f~vikomݲ>TTN\ 8on]/:^ ܬn(1RŢϞM4{vdlkz7 FV3|=AGVC9XAˊXbonT_}hKCLzsNVMf%";Lh|uys6͑Fl5PboQicoXy t{i8qoX >:Eo+)FևA_YL #m55ۥB '+}Geo7 Te :_2of'+ s3}+hlۚF<a ċa#vTs1xK` ևOpcs'ȴ*{Ձl[=ɺ}YiM4x?ՁXR>_9e4133?k|Ry !O@3-22HÛ ͯ 6 ̼ >AH˅=/}`PP`r |)WsmS3Gma CT`NP!`#r1 1hkd:s 4{Hs[Aea\5NًSu )nAELKw`@B'wVfJ`Xdϋ5‹{AyuLQW >MVCrnԽglT:Lw yR`a:ydՁ@ H WG+iދ|'Xc? w4{^5++fg%9ro 4|JpZ\g+_P {5o`BO͋߿ |aGfٚ׋D jO}pTsTҰLJ-j dZ:7ϋ{cO-Y\\ lB}p/`Ĝ9Jq\A'aHO\UZ?z{?.ًhnyIgmxR^vT:VE`BD1\kSuR0 8v 'l"s3?;z:|BgD.VDZ22-D 7@H箋8t>u(h~,36hMe"J0byӶ닋iH1-fy}1TTsX+Ф}f\]qGm8R, ?;d\kkCФNyH^a? ]Bou4\yǮ1y{# }Ϟ/7L)8W ' YX}I7RmP6|k N&NM21iVz^%(Z#`1~L95Q9#$ 8ٚ߾Z^ Hsi{< st'`+R-_}(1S3H`?I74%*L= j`X CBpO ԼN<^-BlA)}B ԼaH-,ŋ^v5ԼBu@ 7~wkjMY(RQ:\,@cH@8IGBuhC.WQBݐ)QF[1a"NB;@>ۭ \$I!QUtPaMøNENJp`EZLOLLL5YfV<R'%#? @3]e@5?4<]=[4ZWCMk& _ k{Ba+ڠ@^!:_ty0@+S 1igG-Bz#4i ]qT9A1i%%`YNApgXrHs IX Nb Dpc!;Mȴ)[#$Z^w LA`2n!9nwlF/LVm=[q'deR^5W@ !BIy^>0bNVaHo`ՐcSHs4 ^RL $j ,si5?Rpf˅ Q_5V^Ea\J=Ke`o; `7]z)7N% >w2~5^N/5}e1@KCy0!FZR- Xqh3m Ф3k\Xs3sevw+-;#S3 Vȴ)S3)cTn8\-$ZMFfL4z4{oTzGwZf\$ygj13 ۦ ~ %mP W K -WL:MP  9 TPIyS3b) 2 BN#jB# M~ ^ ~5 &= LJ V}qd @v1 mARG(r.0|mZ@WpNV\#{qiPd̋[)lb`iNtM5u怃-lYXGCT'+'A6 yX_ J<f% % X ߾D " zȴ >Dh Hu 9 w Rh*QiQFCT)G+33Լ&f3ɺ;F\]/X/H;2{߿ B$9AyQ0 N6;^DP<)7Ml-fVQ' P0<)bQPR'_a3tڟD!HFg$ܬ9Rևm;h1f!z45Bz ^5D hw G#nVR-BNn"Խ%]pVԼW "L<9oM5U@ VkFgCW}9(3yk<)I )u_x1Z1@+{nVlVU'um =q+Cdv::TTEof N˅j.@V e`7P`%/6S:kD=`kQ'/Fo/{ff8JA8Rkևg`?}i|j{BQ155 Y6 H>.'S[Y >a  C }*Щ^;  < 8= ,u+q ;,@ A {B /q   !TFQ?    ;(R , IC  C ӈ\C D ,u, pB zhPp  h }0F* x+   }(rG `H q4e (WI rhb cc o}tx[)  $ I}J5e탋rU{$~(eRX9*8@R$@@؀|'3"N "N-O q@ӎS|rߍ_^@G@Ae@)@"|@gӈ@@.ı4$    }J |4!#J#K |4QL ˈ  i SVX, SVM Qw155 Y6 H>.'S[Y >a  C }*Щ^;  < 8= ,u+w q ;,@ A { /w q   !TFQ?    ;(R , IC  C ӈ\C D ,u, pB zhPp  h }0F* x+   }(rG `H q4e (WI rhb cc o}tx[)  $ }J5e탋rU{$~(eRX9*8@R$@8؎|'rp3"N "N-O q@ӎS|rߍ_^@G@Ae@)@"|@gӈ@@.ı4$    }J vI!#J#K vIQL ˈ  i SVX, SVM nfAfb c nfĤATt.zx}l{~t{hrrtxvtu ы֋tYz{[V[yzU{^'(Ƌzk}x6}c   QZ %>, t T x|}w݀"!@ytwx~dhhd~6O ~puwnspww}xxRRY`L@LE9{zhuj Fߺ wwwoYsia56C5Rt@ " ,]@ vq|U~ ff ܀z}|w}{u} qRx XCyw嵀DJ߻x uj F ߺgdW녋賻3`36O ~puwnsp#\p ff@Ӣ@Rqg K hz~{9{ pSCCyw嵀DJ߻x uj F ߺgdW녋賻3`36O$i,@]us ]#q!@qf;n!L]Ē0޴`@9{zhk@r7)\;@@ mw@ڈي>>&v{@4@2뀋Wli V lEMgDxL@*K@%^fo>=g9%E€ً|{qWg՘~@& ?2&!mxevfNW, \ة@V[EGiYʋ(W@@ |jW~@+('2wf ntW?Xo/Q@ @(6'es/5| iʄ=۬\L$Tꋿ|{q]^X1s.4mB:j ŀmـ$&pVCm2 - 2^xw` @@[@Ou| 꺀ԫETw{j@ =ninzA]z@Eꋿ|{q]`@\@&Vq+bd1!8@ǀ~uffuy~m '[wN0txW@(zZw382q@@ `- u, ѕ   <FQg#4(CSg @Pu*Vpff Q d  : H n , Y  " J < Y [~3(HhS>JY~iu{CFe  / O W d !!I!!!!!"\"""""# ##$>$$%%&Q&'K'g''((D(j(()))2)o)))**>***+,x-8-g---..!.;.J.c.}......//#/5/D/0 0\001*2B2\2v23&383334F4i4445 55055556)696L66667!77778848g888889 919a9k999::}:;';k<<<{<<=f===>>>->?>Q>r>>?#?M???@@b@@@@AA@AAB)B9BBChCCCD,D?DrDDDEEJEREXEbEEFF>FgFFGG/GGGGH HXHfHHI|IJJ$JJKKKL&Lyayzzz{{\{{|Z||}J~O~p'>:ҁ~/u1!=c҆%‡Èω:Ƌ5D]cR{$Б!T“egQܖ/[–ؖ .˗GYkϙ*N\z&hDx͞Þ؟,ڠJn0Kf|[Y^֥Ii}˥٦3IZ B\l!lɩש@Q_s.gĬSjI[ڭ VmAگ аp#hpO`ٴyĵJG =]2Z!vɹѺ/TeieǾ+]%;DRXi¨VĢ|Ŗ?xƝ njȧɬj}$HVť̤e; 7? ϪϷ!/A\lЀ8aѠ$ҕҦ5_}"FNlԄԌԤԶLՍ\j.AڻoۥDZ܀ܣZtݩ,Dzޔޣ޶Q(L%8HUdz%P]k,:Ku/kgG>)= _[{,)j~k4T?jppjjppj Pgyyv}⋿{{~}} j `B DŎNÎP@}{}`B=}{}a?Fvfˎi Hvfʎ_E qbejŐ }w WX||sc~}~qU+Q;T[jClgi>>(ҍ|DD"L>>D >#@D҄{D?>>2cDD> yBQ/ } lrqmyq{t{~ hmoqnk Scu?Qyn^g^Ma h[nqxpuzq{EVm` ϑȕǔKKKlu mrrmmrrm Kz|| +. ' *  ߹58OW99\ b]pċ_pQedO\ ƛxegre/֩cK \'l\:-uy{~opzzˋ΋凙 >G;voeVufy{nqxu~xy ՗Lk+dmXpzb|yڲɋ l/ ٸ̋`J 􌵑݋eG hpoYQ}|/wc|zxztUUz|teMH!Fb@~v SFf]u|RNZvjuz{~vn``zy{ 쭼ȹ岏k'AZShb;-) 4 K{v|}x)2cenrhrmn f]QVbbSLaǥ  BA93]?<]\ [qAa96O\E  J]]\Sb`h >0CUr}}bV^ȼG8cIg[aS-RyЕ  =* mrrmmrrm  BI\w~o~A\x ynQ  BwmI\szA\m ztzxpnϊ[Injoo}Lkesi ^vv{~ fSjaj vfx$lw}{se^ȿ ))SAjL.F"壔Ya/hJ33=2 8KVE}zx|jw&= Edʋf /~ tcjoj:K_q}||aHM^@?uYmziutkqSY=nuz{_y|ͅ Xo[||f>5=I= ͋ʬ9O ?&Q|ebUzv[V[oyYtŋ {mB@RQln}cs^q qX[E0)<7''狸buct~weyySkV>&VJ!0JNjԔÏ} RǼ"TB0@@ S11TC"p&`bUz{[V[zyYtڋ T}l{tu{n+hvtu 0Ek@z{[V[syYtƋz{ky} ~~Y#^v ʇ 0 FmBzlO:ZzyYttY}͋ʋȋl{tu{nsYa vzu 0Y[=.ZM6 M˟{gyhTuZ|Ȃu}ytzh|p||jr>R2#/ꋾf{ x~v| XzUg^zUzrgRTzUbcUz{]X[yYtt]jMR`quattY X\oyYttYnXzU`]zUz{\ z||qyyopvvƋf-zUf]zUz{]*xN\ tR`ؽȹÝ~~/RUz\`~OzUe_}Uz{]VYzyYttYۉʋh~wx‹Ƌ zUtZ_}Uz[d_nyWyuzgqt y{j&I |w[`g|S|kY.2%yq$fzt~7z@sH~SYttZ{!}C0 |rV 2$\wdttYt+}N Rzrq4Dk|wAxC={xtD94@b{lettY}-or _xŒuzN[ R4$Eo =HY.Bt 7I 4R??*(".? ( bN;p~-)o`c bUzlO:ZtyYttYzq Y Wmf]n닰ts=YHYld9_LCd)1Z:w_{ 7 (. 7@,:=A' §ʽ<&QxebUzlO:ZtyYttYz@}ygO `ċÑ\jh-\M >QD/jwیÎԌ‹F: QUxȁwgSt{ԋ*+RX9ˋɋËjQ|~^K :;4;W\TJIEc^@ \ˋyoq|||uw}xnoi}ualyeuy[[ovYttYn ztqkn{mzYX >-_0M#34zvolfnmzx[-&G'/ ehqzy{s!xzwac]^lzqfKo`ܐP\zqZd zn`"~=UH+gN0zwgfislzuil~| ˻ B 5pzrkjqwqzzw~^-_&j3$ȖzstxnzzszxO{gk݇zwpmgpl mpsz|~y{w !0tzybcYOjz~E%`~|0aWHiiutpyB}+rs{w}xυtedm/szp[d [opYttYn(ږޯœztcbn{mzrz~uiOxkl\yo|/9zvol]bmzKs Tep 򋖋~oI[l[\Z^_cnTNAA8^[Wng|a{[vĊU<"NtlhW} kis8~~yzm K|zK} 9sxmpzwy~~~8k odWeK_dbSq yn[ xh|Cvzuyz}} nlg\VJ`loru|qvàmiKpq%aZwsoadc݌Wċy إ|Zr{}y~qxm EH &>&\>? Vb  nɋ+ ?#iMzYaaÎkm{Xlh m\`3$0ðqiw{a+L԰g ٸGS[dbS_#+ܫ _o 6&$͋zg~ q{X咭}htBzU2y uc{vtn9} 5)7 ĕqi^r1N孔d U> NZ4B{wmptwwt  ~؋P }|\v|spzoy zkn\3q+ ò@JePY RdBI>9 vf8EQ=<[ fZJLRcltBkj{Xmgpuwwz_cY`pxwwv ouunouun ^bH{mgmptwwt| Ϗ^bH{mgfFnNxctzsΤϨی ʋΆwcuvAWʇØ pjgZy{ZYU\|~kh{Xx\ptww|%w_v 咭kj{Xpdptwwt itrvWngkptwwtb \[fpswwrb\[fptwwt itrvW*n@gkptwwtb + 7* 1 (,d[{lwde{^;Q _i|xu.0ad ptwweOy} N$L;\xx k~j|XX| ͋\Or`g\Lw}rxpiO, TG'',!Gʋtkptwwkė |} αywosf|lo~x  p{jpX ngkpzwwj morc)gNRZdi lsgcum[b^ts}~tЋJm kV ý{wdlhQ~} `AV|~|8g g&x}bKbmt|rxri`bWdU~{n_=bɋzg~ q{h  yr~CM}A[~dhhd~xsm䐖P~xhht|~ ufgn~yn?E}@U~urffwypfI5}?X|?H~zq u}~uff{y~ryHF}b6vg}|w}{ UNSF}|yx r]x}  B]CH+}xtiԆۋxm`qim ͻ ~̧˖-d- E]MQbeUwweQ M~]E-d锔|KJ ϘBj KScu Q\GBJoK| ~ɋųŸTc ɘ-oB G~\QI[z VZ^ IY]^;/ [ ||nn ~Ldh pjjppjjp QcNj־ VӍɌre[ayrpbdY 7'(5| @~{ߑ:7zlX^_wz}~{ es΋܋ˋ؋ynwxmprm*v  6̋ cjt='E- I<5=I=Zo Ã͋ˬ= Xks< Ƌbtzm ]zUz{\X\oyYt #7pɅZ,#iY';?Mxg}rx|t}Sr!&5{z|AMQ\ Gv,B% q~ caWiǃ0|_nN'O^t|w~ Ox1_0M3zvolfnmzx[uV"T$/ Śywnlix ٙ|rrmr~~}o=v&x}bKbmt|rxri`bWdU~{n_=bɋzg~ q{ 3Czv~ݾ;>5\5"TSog`oy~|} Ό,2'I{wlutu|a{[v rVx} 5=r}z LEnR q`@yppwsp ynk 򋗋je | F| y$is{oj e j||$ ZI C&+IIrּI;i{/Z[E Up~H~~p ɶehhhlԋq?0&LY ÷Ȟxvhiqȋq1 Ai C?!*{w zy~y| {! 'L9সۘVUMCxs _wuzէ4A wnwqoox c\gcchbc yX{]}~uo{ ~mxyyX{]} `zrs{'g ~W66WKc~|k NjNjaufEEfb@~ ٸGS[dbS_#+ܫ  qɕ}jh rRrrLP ~dok}qpn ~ ZϏ^bH{mgPP|t FnNxctzsΤϨی \O#a~r|rxxiO, }}}u yXo'',!Gſ Wċym um\Z[fv~|H@@0 ]wnfYH\΋ۋÕqi\qXd ~ ~{x^t adO\fVfdrÅ{vphx׋`d ͋\Or`gdbj|rxpiO, X0TM?_y~mdvgb2z̗ }}}u yXo'',!Gʋt wqw$z mvszph"bʋx }y} 5~ldd}/0ԋƨ x od[Pe~^e]{Ɣ ~dhhd~wt$s` u\dSBPVѻl|f  ~xhht|~rv~ chhc~}notwwt Xrda z /[ '.4U64 S ! 咭kj{Xxd )$ 7 Sptwwt q{ c/hXouwwt>_ s}w||[̅`̈K& QcpKmٗhd isnc)cNVZ`i Rtz|xck| zszy|q md=WVfy ldymotwݗSe ŋE'b{p vcdENR &C|dhhd|pouwws Kpuwws}dhhd}p chhc~}notw ыɇߋ΋~Az@P1nӋF]  > d5c%{i8^$c&'Y=zw |yH!+P g&x}cLb}vzx|dr`Y zzyxyyzy q{EVm`ˋh[nqxpuz 9:j| 틕xx}gly syn }de U]Vi8 { yn {{}|z}yddetw}z Ht ~{nwyp~q\st|tt~ ts\qY\V_pw tvjpj`ċX[nyw{ux gvVafW_h noo}qoou _`c__df_ ~YSѰýruiYYu yn qdozsgeV `ddk_rllgw  sĕwqn rRr`^@ rttrrtvr rvtrrttr ~tlj]Yk|}v} *BZbZ*LMP~{~|W G[opYttYnH6*upfN xvyvZev~XarË|4]  6"K$L\}{v~Ë~}{vfd[ruqt:(5D%!F )\ ne_a Hj}v}}Ǥ, *vzu x ]yUz{\X\oyYttYn qzxzYH  r|{ C|{OjwXk{iutlo/LHu~~dy|ͅtcip aqsYttYnXz U`x ]zUz{\X\oyYttYo|  8ɘËy}pW\Bn.vGiQEmzU`]zUz{]k|Eivn\Wp}yzËVjMWon}p>[oyYttYn f{ijijPkmjrFN KEƳҔiVfYs ڋs^D{K ylE8:"0Jס cK4]m娳zroV^w z|ʼةzp-6I=[~ ejSTcй W[fddvx|KVs+r~V mq}hx ʇYXGBT~Zh`TkXv WeCqNP a\I--E.E]z䋿 tZh`TkXv -?>-Zl缯YZ ]#F) XGolRYZ rq_#F2  @rh{y܄ vyk{tovnuTbc>ax |o$!7'㙋3ۋKK\=s.=c hX^Y_!\kxNV4iut~ãʟ|y`IoYv[h5\5!TTog`oy~|} %Ì,t<roX|^A >t<rs||^A UZoyYtŋ΋ˬ; Xxsz"zU`]zUz{[ vli \iBXUF ^(J.(:ahv~~q`tr}ӅNjLFFA*AkS` xc~z{}n[k|" luq~d; trypdpwwwq vq{Zutpoj{n{|k~{>||y~rsB}owefo䘠 mswwt~v2o iogw}r~}|ؗr{jopt_ut4Zw{rv ydhhdy~l NjODbQws|mq~Ü\dcpstx~szx{ adOdlVfdrÅ{vphx̋ `d SY\~chhc~pouwws[Y_puwwschhcp qnk|{n{jVf¼̕tnn[Y otwwr~v2o iofw}r||ؗn{jopt_uu4Zw{qv ydhhdy~n ~`mjht}rb}tQoqpyww}w|S { -<]owwwtȋ ppvww{ yrt uc_2% trydp{wwv rzv r\y wnuwwsmtz vz xsn>q>vgxssruw~xhhy|~srHF}ڋ{J|abR fdI$F- hxd~ubglh~2(=LyUq hxd~ub M}yglh~2(=LyUq fd%I$F- vws~vDwj]/3 ic~}notw ыɇߋ΋~Az@@2F] phhWtopo}h|ppswvm~drhgrd~uc Z^n%~mhgzd~~gckn]gtysw~d|hgrd~tcglh~~h/~~ ۷ glh~ Ћ~nnib)m2۷;_~drhgrd~ub4\  8   &c`vuo`۷ NVh WW[z___o¹ vsjxl v{vp|#ht  vvj u{|~~| wypyvzyv{jyzu{}~~u r ~tIr-rx~ {uo{r{hz\st a'a.~]V9 ihJJʙg!@@@@XK)N@@[<<jj !kJ506܋* :< ~v}u}vddetw}z dsy\b|} I12| |\sdnz| ~}y~z}rjjfn~}z ~hLѺʮsfvfgg l}xxr{)g ~wtw|n´jcny{u yncjkbTgnw ˒ȔǔKKKlu vd[ xj) xj uzX0K&Sbyn ~ C@@wz @o@ K/fr/@fᙀ wruq'\}i {bXnjoo}x̓Ώ upwzz{y|zutK1; ^xu{~ XM JKz~} 2S3270_: Δ5HI5IDɗ @C^lc}|z[sMCUwS| SvofdhByYkmouv]W9H[߷ų{Kuhuhj unikxniex  X]YRq^[qo n{TsZUl̲d` cupnjqqv o}*}p    ~t ~s ]`G%% `]]깶 G]}`#%%[]`( dab^qx}}o|i~zu ||~~vh%z}~~~ ?[Nyv}~W~l{~OCshp|{X e[hh~us̑vtjyv{|~~mk${~~| vpjl{~~<n} ~r}5/Q[K vvjyu{|~~| nabex|{xlXipy|v}~jyu{~~on{~~on{~~ \^[oY[U} {|~~ |\Obbo ymt\Zq]ly{p}{wx~xtwm}}~Ĥ{s`} nt Iy |xkli]rwz{~|{wt{zc~cRP  BI\w~o~A\x BxmA\~wI\v{ B O`[_1Z{Q:f1=2c[V `D1~fCZ:21cxMV~}} uyx~| ͋ 颀m] %R@,== c}rv4:- Exmntwwt $~*⿓ pl yyv}}LlGx|ys Fe~FQeX~}A]Kd~z  nw|}~~|wz_}a|{z{   Ι͛W} y r|OgM|`~ofz x ~ vy wywd~plvxkv~|zx{~| zt{w ||vw uyzv gvietf~ wtnx{ QiS_s_xx}}xv}|~}  y{xzh}ve  {txz}~ s^xw~x{|  ~ |z{|w  }cjiwwtltrxws`ct{s} }   v~w K]A}XdR FeFsy|xHllnKe~|vx lpl Ɋjla uyznog_gykw  }}||vx}}kk Áŋ fte }~wyyu {zx{t|yw{||~{xz|}kxlp}~}d wzvyvy n|v~vsxw qlp$ k}}zxu{ wxyy{x~wx^w  {|w|} ctb {xszl   &bpv~t|ttwjyyv C@@Hz @o@ K/f/@fᙀ xpwmazxW^{_gm rzA z||qyyopvvƋ *⫼ލo  wtvws~vEwj]/3 o|o~}notw _i|x u.0ad fn}~xz~wotv|do>w|xz͚} rzy|bp ymvntwwt ntwwt mggptwwtc┸y{xmgg_f~ ʋpxx`TErlmgl~؛ _?y^Yq_vP=bp z~mvntwwt ntwwtptwwt咭|xxy +E? ZHxwxSb¬{|_gi{  ~f04Az xmvntwwt нJFm_~zazw xSb¬{|_gi{  ~+P :A4eX L}naQKuksSeymW h`ts}~tTi jWdrcc |l-pɜ c{~sr}}jsSqlwz&qh~uo z;RX^Vek  ٘ad>HWx} hxd~ubglh~ʅ Va ŋD'bgo hxd~ubglh~ Ћ~nnnb'mvws~v<xj]*3 vws~v<c~]*3 hxd~ubglh~fu alvZ> ڋoV|}̅abR"-"*  v}rzpetj}|s 0_^icvX~drhgrd~tcglh~~hlglh~~hl~drhgrd~sd ~hl~drhgrd~ubglh~ ~drhgrd~ubglh~ Ћ~nnib)m ~thheht]i;c0~(}mgd~vmtL{-u~rh~~hÌ*$ "{ -I.oh~~ hwۋ  ~dhgd~sc`Wcc~~bO l:b>TekY vrnaodM glh~~hlČxz{{w2Mz|@k ,2d[glw~y~ocxu 5 ~dhgd~riG0Iv~dphg}d~g glh~~hl~dhgd~x:///{~dzhg}d~}X(tp rrrrrrrr *ȋauDP4/Kwmvntwwt ڋPnw^`Ty^Yq_vP=bpwmvotwwt*؝ʋpxx`TEwmvotwwt uyx~|3|pw}M A cWMP_WPEbˠ  <;4,[96ZX Xo8^3/LU@ E\YXN[]e (MD,(<(H*%K= .**l;1_2** /~ɋʋEmNZ] w{mabSe_T{zxgon銿 w{mabSe_T{zxgon )>(ugx{~`~hpbrs tvte/GzϘڋu vy{ww{yv }p{ ̏s4 ̏p+쭍g㪍ixo'Jyo'b}qt5d}pp) zrv  yg{q{:hRh[jnu5\wͅu\}[ ͻKj gmStwZ  PhRWTVɪþpU QbdZon{Ƕ TVɪþpU QbdZon|Ƕ nrurnm~ fml klny\chǡ mtr~rvlillqpkdb_asbhr~~Mp\bKVoÊNj [uyyZxp }pz{sxy t|g{soxhyw~gtse }kzwo²ȭ{bywy} ܕotxiomյ %#74+Νps@mZ & <%W^\Woit9DQ0Wm o 3- wr}r~lr&INjxzs}pgv ~~tRTz{{qhxgnk||kx}|y{jp lxuozɋ}{\vakvr" *- 'Iq 1/7U$(: |ssmqwuv6W@L}opmqwrozq rrw'y{pxl{}~E6P~atmnwvn:-ok`xu}|z~1|{~| }ywmqwd}|s2nxzk||kx|ssxw}|zhzwvo}O llnnqx_`[jgcxtro~|8XL3|xtmËʉӋɋyckyl |F}X} U5U5 }Xo}F yt5 reϟqLtp5z y \}|vH BhongfʜU\ {XGulw}vkjl|rz ~q~]{r@o)WQ6 {r' JUʰzywuZlddAMP@ ܥ‹gu}nR4d~w1{~~~}' F xm]vnZ|̾Q8 vjƋŋqys zroRSpOXy} o} qldyukfy VruiokX vh:iqogXi mj:EMW}^V\~gaa fcpiS6ѾؿHQ^~JT` uvfEEfS_~ mao~ubglh~~hl il} M vd| Bssr}}jy`|t }yy/~nYq{ 8    &` <[΋ڋ½ӑ ׄN?@TR@ uos~~suƋ!~d~hfd~w R![ 9g|h[v$Gtȋ,,<[@cnmx#Ë~|u|~h>Եŋ  56Z^ Zh@:0 €̓RRT ՀA @@@ ˒ԔǔK?Kgr 咭up~o r5@&@rp]iW~~w otw@#<#'@wtrT @ v ~xhh|~~@U5@@]S l4 @~dhhd~@ $vpGotwwt@y@B vq|U~ f t*;                 ! ! " % & Z [ \ ] ^ _ n o o p       |"HPXft| (08@HP^lt  >  y4,    &M     V \ DFLTcyrlvgrek8latn)  !"#$%&'()*+,-MKD hSRB h)  !"#$%&'()*+,-*  !"#$%&'()*+,-)  !"#$%&'()*+,-(AZE CAT CRT DEU 4LAT TRK )  !"#$%&'()*+,-*  !"#$%&'()*+,-*  !"#$%&'()*+,-*  !"#$%&'()*+,-*  !"#$%&'()*+,-.c2sccaltcase,ccmp2cv01@cv02Fcv03Lcv06Rcv11Xcv21^cv27fcv47ncv80tcv81|cv82cv83cv90cv91dligdnomfrachligligalnumloclloclloclloclloclnumronumordnpnumsaltsinfsmcp ss01ss02ss05ss06$ss07*ss200subs6sups]EF[\!"$:@B<%&/?1 #qw "*2:BNV^fnv~&.>FNV^fnv~ (08nv~&6>FNV^px*.Pnrvz0  ( 2 6 H   !!`!!""""$"."H"R#R$R%R&Z&^&&&&&'<'r'')|)+^+|+++++,$,(,,,6,,,,,,,,--(-@-J-N-Z-d-h-z03333344:4X4v444455L55556$6L6l67J78(899999999999:::::(:,:::>:H:R:h:l:::>@BBCD D$D(D,D0D:FGHlK`LMM.M@MRMhM~MMMOOQQQRR6RXRRRRRGJwMM w--M 0w 1whp  6VW FFBPJ"    % "  $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|     $ * 0 6 < B H N T Z ` f l r x ~     & . 6 > D J P V \ b h n v ~     $ * 0 6 < B H N T Z ` f l r x ~     $ * 0 6 < B H P V \ b h n t z     " ( . 6 > D J P V \ b h n t z  $*06<BHNTZbjrz&.4:@FLRX^djpv| &,28>DJPV\bhntz  &,28>FNV^fnv~ &,28>DJPV\bhntz &.6>FLRZbjrx~"*2:BJRX^fnv~ "(08@FLT\dlt| &0:DNX`hr| (2<DLV`jt~ "(.6>DLRZ`flrx  &,28>FNT\bjpx~""""""$&&&&****/000006666:BBBBBBDFFFF    OPPPPPVVVVZZ"B"B"B$D$D$D$D%E &F&F&F&F&F(H(H(H(H)I* * * *J*+ ,L-M -M- M /O/O/OO 0P0P0P3S3S3S4T4T4T4T5U5U 6V6V6V6V6V6V8X:Z:;[;[;["B*J0P6V6V 6 V 6V 6 V "B "B (H,L0P0PwR (H/O" B " B"B& F&F* J*J0 P0P3 S3S6 V6V4T5U)I"B&F0P 0P 0P0P :Z   !               %  % % )  " B#C# C# C$D%E% E% E%E% E& F & F & F& F&F'G(H)I) I)I)I) I* J*  ,L, L, L- M- M- M- M.N.N. N/O/ O/ O/ O0 P 0P 0 P 0 P 1Q1Q3S3 S3 S3 S4T4 T4 T 4T 4 T5U5 U5 U5 U6 V6 V6 V6 V 6V 7W7 W8X8X8X8X8 X9Y9Y:Z;[; [; [IUXZB~?" B" B" B " B " B "B " B" B " B " B "B " B& F& F&F& F & F & F &F & F*  * J0 P0 P0 P 0 P 0 P 0P 0 P`a`a` a`a` a6 V6 Vopopo popo p:Z: Z: Z:Z                                                                                            %%%  %  %  %  % %      )))  )  )  )  ) )                       % % ) )            % % %   %   %   %   %  %            % % %   %   %   %   %  % )))  )  )  )  ) )  % % %   %   %   %   %  %      % ! ! !       % !   !   !        !   !   ! %%%  %  !!%%   !   !   ! ) )) ))     % !  !" )/4EYbf l s%y(> *. 12   JK  EMU CEGILM  JK  *    *    : %)< %)< %)  %)whm        g      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcGD_fg^vv`ab&'cefg                           ! " # $ % & ' ( ) * + , -  _fg^vv`ab&'cefgdefghijklmnopqrstuvwxyz{|}~_fg^vv`ab&'cefh . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  v s _fg^nn`vvabc&'dfg)99   99  . 0  . . HSZszV"#$%&'()*+,-./0123456789:;BCDEFGHIJKLMNOPQRSTUVWXYZ[   "$&()*,.024689;=?! V W X Y Z [ \V'(W"#$%&'()*+,-./0123456789:;BCDEFGHIJKLMNOPQRSTUVWXYZ[   "$&()*,.024689;=?! V W X Y Z [ \6)*  ~V ~W6   ,T;BCDEFGHIJKLMNOPQRSTUVWXYZ[)? T !  +K0!$BDFHNOPQRSTVWXY[ 3 ! ILCGQ    k{45    B  H & E - M U %         '  _5< " # %   ) v  ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~ _ ` a b c d e f g h i j k l m n o p q & ' ( ) * + , - . / 0 1 2 3 4 5 6 ^ 7 8 9 : ; < =  r s t u v w x y z { | } ~  $ ] BCDEFGHIJKLMNOPQRSTUVWXYZ[  !#%')+-/1357:<>?   !"#$%&'()*+,-.          " ~                   ! " # $ % & ' I K M O Q S U W Y [ ] _ a c e g i k m o q s u w y { }  > ? @ A B C D E F G H I J K L M N O P Q R S T U  % j a ` _ b d f i c k h e  $ $ q "#$%&'()*+,-./0123456789:;   "$&(*,.024689;=    " # % C  D l   j j S l U \UDTG G? ?G?UGGGHUGIG?JJG?K$*0KKPSE$*0LKFMMMMNJK OG?CILM$,2PB,LLB QCILM ??RhSG .69:;< > ?GfTU .69:;< > ?GjUG? .69:;< > ?JKfV .69:;< > ?MhWJK .69:;< > ? hXG? .69:;< > ?CILM"nYCILM .69:;< > ? fZ? .69:;< > ??  G hU  G?  G?  JK  G? CILM ?  G hU  G?  JK  G? CILM ?4   Z u ?U [U2R?B$.8     I5_2C"*,1 3;BGIILLNP SY#[[*+2APT[`dvyz{   !$1468?`aop     V \C"*,1 3;BGIILLNP SY#[[*+2APT[`dvyz{   !$1468?`aop     V \*`2C"*,1 3;BGIILLNP SY#[[*+2APT[`dvyz{   !$1468?`aop     V \>"*,1 3;BGIJLP SY%[[,-4CRafj|   !$1468?`aop !    $ & ( V \):"*,1 3;BGIJLP RY%[[-.5DSbgk}   !$1468?`aop   ) + V \,a2HKQZb2 +>^c ~ ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~ ] 22 2 2    eG? Vk  <> CC IM \^nn!"#$%&'()*+,-./0123456789!!:>?;=>?@##A%%B''C55D77E==F??GCCHEEIGGJIIKKKLMMMOONQQOSSPUUQWWRYYS[[T]]UooVqqWXYZ[\]_cdejklmnopqrstuvwxyz{  |  }~ !#$.067:<  &fG? VrCIJKLM!>?#%'57=?CEGIKMOQSUWY[]oq   RgG? VBDFHOSTWY[    h?x  <> CC IM \^nn+23456789:;<=>?@ABCDEFGHIJKLM  NOPQRST!!U))V++W--X//Y11Z55[77\::]<<^>>_##`%%a''b55c77d==e??fCCgEEhGGiIIjKKkMMlOOmQQnSSoUUpWWqYYr[[s]]toouqqvwxyz{|~     !#$.067:< "(i?CIJKLM !)+-/157:<>#%'57=?CEGIKMOQSUWY[]oq  "Tj?BDFHOSTWY[     G? V  G? V  G? V  ?  ?  ? &lG? V     G? Vn "#$%&'()*+,-./0123456789:;BCDEFGHIJKLMNOPQRSTUVWXYZ[   "$&()*,.024689;=? V W X Y Z [ \   $ p|"#$%&'()*+,-./0123456789:;   "$&(*,.024689;=|"#$%&'()*+,-./0123456789:;   "$&(*,.024689;= F95F9rF9-B5F9sB-5F9tF59u".4:@FvF9 5 - F F B F F DFLTcyrl2grekVlatnnMKD SRB (AZE (CAT (CRT (DEU (LAT (TRK (kern,lfbd8mark>mkmkDrtbdJsizePxtexT"ywxz {x_^fnv~&.6>FPX`&.6>FNV^fnv~&.6>FNV^fnv~&.6>FNV^fnv~ 08@HPH`<=>>>>?.?r??@"@j@@AAbAAAAB.BZBBC"CjCCDD:DZDBDHDNDTDbDnDvD~DDDDDDDDDDDDDDDDEEEEEE*EFtFTFFFG6G^GHFHI$IIJPJKKdKKLBLLMMtMNFNNO8O|OPPHPPQQ0QvQQR RLRRSSHSSTT@TnTTUUNUUUVHVVVW8WlWWXBXXYNYZZjZ["[\\^\]]t]^:^^_.^^^^^^_ __._@_R_d_v_______```*`<`N```r````````aaaa"a,a6a@aJaTa^ahara|aaaaaaaaaaaaabbbb$b,b4b<bDbTbdbtb|bbbbbbbbbbb bcHe f,gjwց.Ƌjr0\–2Xjt~ KH6$*-'`(y(2#A<(2##(AjF~2((7A<(tFFFxFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFK<<}_Zns~~PP7PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPz #""%%&&''-- .. 0011 33 5578::BBCDEEFFGGIIMMNOPQTT"WX$ZZ$   ""$$&&??FFOOQQRRTT__llnnrrsstt$$$##$135577CC%~&  !!!""## $$!%%                        ) . 9 9 I L      V V      l"   82;:$#* 4""##$$%'(()/001122335578 :: >>BBCCDFHHIIJK(LMNOPPQQRRSSTTUU9VVWYQZZC[[^^dihlnoj+s,.3/v<>?Z\be!f g&k'Bqpm((r)      1-0t7u!!""$$%%9&&))W++A--=//Y11@3355Q77[::^<<_>>??TT ``aappss ttCvvzzDE%FGHIJK     C  !!##C)*/455~L##%%''5577==??AAMCCEEGGIIKKMMOOQQSSUUWWYY[[]]__aacceeggiikkooqquuwwyyNOwPQQQQQRxSTUyczccbbbbb{V|}.~..,s}3  <  v  W]X  5!!6""##5$$6%%66"774:;4<<"YY( `             a `             a  ) . I L z z  "%&'-.013578:BCDEFGIMNOPQTWXZ"$&?FOQRT_lnrst#12357C~ !"#$%   ) * + , - . 9 I J K L   V F\ ~t~y~RRaaooqrssttuuvvwwyyzz{|}}~~ Ra H  ps uu%''))  pqrs " # $   m n |        f p } ~    %   m n |   %       f p } ~     "   m n |    "       f p } ~     #   m n |    #       f p } ~     $   m n |   $       f p } ~   " # $   m n |        f p } ~     m n |        f p } ~          f p } ~     %       f p } ~     "       f p } ~     #       f p } ~     $       f p } ~    "  #  $" & , = > D U $T; OO  OO  O  O . O T;   TT  yy  yy  yA  y  y  T ; ; & , = > D U(b  pqrs    f f m n p p |     f f m n p p | u !"#$%')&`! pqrs    f f m n p p | u !"#$%') pqrs pqrs"#1  g h k"$1  a j"%1   _ b c d f"&1 &`'5"$&lnBDEFHT &@(5"$&ln PRa !5&h)5"$&lnNOQSV[ 3pvz /01234_acgik&.*5"$&lnU%&<+5"$&ln WXY5&`,5"$&lnBDEFHT  &@-5"$&ln PRa !5 &h.5"$&lnNOQSV[ 3pvz /01234_acgik &./5"$&lnU% &<05"$&ln WXY5 &615"$&ln)*  `&625"$&ln)*  e i l m n&635"$&ln)*  g h k&645"$&ln)*  a j&655"$&ln)*   _ b c d f&665"$&ln)* &Z75"$&ln  a j&Z85"$&ln   _ b c d f&Z95"$&ln &>:5"$&ln  g h k&>;5"$&ln  a j&><5"$&ln   _ b c d f&>=5"$&ln &0>5"$&ln z `&0?5"$&ln z e i l m n&0@5"$&ln z g h k&0A5"$&ln z a j&0B5"$&ln z  _ b c d f&0C5"$&ln z&D78T  `&E78T  e i l m n&F78T  g h k&G78T  a j&H78T   _ b c d f&I78T 6J78T  a j6K78T   _ b c d f6L78T (M78T z `(N78T z e i l m n(O78T z g h k(P78T z a j(Q78T z  _ b c d f(R78T z&S:s  `&T:s  e i l m n&U:s  g h k&V:s  a j&W:s   _ b c d f&X:s 6Y:s  a j6Z:s   _ b c d f6[:s (\:s z `(]:s z e i l m n(^:s z g h k(_:s z a j(`:s z  _ b c d f(a:s zPb  _ n Pc  _ n Pd  _ n Pe  _ n Pf  _ n!$$Xg  9 _ n $Xh  9 _ n $Xi  9 _ n Pj  _ n $>kGR V PRa !5$^lGR VBDEFHT $4mGR V)* $^nGR VBDEFHT  $4oGR V)*  4pC PRa !5TqCBDEFHT *rC)* 4sC PRa !5 TtCBDEFHT  *uC)*  *v )* (1A1K1K15"$&ln5"$&lnx5"$&lnd5"$&lnd5"$&lns5"$&lns5"$&lnd5"$&lnP5"$&lnP5"$&ln<5"$&lnZ5"$&lnn5"$&ln}5"$&ln5"$&ln5"$&ln 5"$&ln5"$&ln<5"$&ln5"$&ln(5"$&ln<5"$&ln_5"$&ln25"$&lnP5"$&lnd5"$&lns5"$&ln5"$&ln5"$&ln78T-78TA78TP78Td78T78T78T78T<78T78T-78TA78TP78Td78T78T:s-:sA:sP:sd:s:s:s:s<:s:s-:sA:sP:sd:s:s       9  9  9 GR V_GR V_GR VKGR VPGR VdCsCCC-CKC ( &aO $ &,28>DJPV\bhntzu)))w<w  0       m n p | } ~ Z`flrx~RTMvMvvvMvRTMvvvMv 06<BHNTZ`flrx~""!"T"""e">"e"%z-h%z-h 0 & * , . 4 9 = > B D F L Q U " # $"""4> <BHNTZ`flrx~Trr mmhmnmmmmr mm>mm,mmJm mm>mm,mmJm %)0 & * , . 4 9 = > B D F L Q U % qLiLiLiF 28>DJPV\bhntznNN>NN,N$NJNNN>NN,N$NJN!%); ! & * , . 4 9 = > B D F L Q U          c d f m n p | } ~   $*06<;0;0B0L&&p7&A&;0;0L&&p7&A&  *  $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|k}VWUC}@;&&& &w&&&&&&&&&&V&&&&}+&&&&ks&&&U &&&d&&&&%&&&&&&&&&m<&&&&&%%k<w7nXkz&z&&&&&&&&&m}kk?&&&H&&&&&&&&&&1&&f&6&+&Y&&;&:&x&&&g&&    gBgggDgJgggggYgCg4gg4gggg9g#gg!g gggBgggDgJgggggYgCg4gg4gggg9g#gg!g ggzgzggDD%%&&&&d&s&kk& 4  k@&&  4 :"#$%&'()*+,-./0123456789:;BDFGHILMNOPQRSTUVWXYZ[  &?Q_`aopw~ !"#$%&'()*+,-./0123456JR0=ORTWY]bortuvwy|}JKRbcmqrstvwx  / z  ! $) , . :  ;  < _ n@ p pP r {Q [\rx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|&.&&&o&&o&m&2&Z&&k&;&;&d&fYcd&,g^<}H&4&t&)o&&o&t&&Y&,Z&.&&o&&o&m&k&;&;&H&4&t&)o&&o&t&j z "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|Nrc:rvNr).2sx ]rN:sNrrGppp ppr|ppUNcrH1r:2xJVA@8+<J4A.V@8+< rxu"#$%&()*,-./013456789:;BCDEFGIJLMNOPSTUVWXY[  &?F_`aop~ !"#$%'()*+,-./0123456J=ORTY]ortuvwy|}JKRbcvwxz z    ( &,28>DJPV\bhntzjejddYdddd2oj}c}UabQ<a 3hntz "(.4:@FLRX^djpv|cU$QQQ$QQ$p|p|Q3"&*06:BFJPVFOPW_`aop(5ORTt}K z   [ $*06<BHNTZ`flrx~ &,28>DJPV\bhntz|B d8/v,b|<#d,:),|BB8nm 1^"R nm 1^"R ,["$%&)*-.04569;BDEFIJMNPTUV[&?FOPW_`(5=ORT]tKRx z  rr "(.4:@FLRX^djpvp@Xr|r|X-EMU  $####6 %LRX^djpv| $|xR>4S93^i<>tXNioovu{{b'7A|xtXNioovu{'7A%    b f p t u v w x z { !    f p t u v w x { |  ! "(.4:@F4<tou]V p $ touV p $   &,28>DJPV\bhnt:Y+Z0.N:6xD:.N:6xD f t u v w {  s    &,28>DJPV\bhnt:='. .N:6rD: .N:6rD f t u v w {  r\\N>X  &,U64545 t w  y*:.N     } ~    | "(.4:@FLFFFF[[BBXXXXFFtt"$(+025789:RWXYk{ "$4568T_csX=GO]`ad (@lnpr !"#$%45BEG w_F[BX.XF "%',-025789:LQSUWXYZk{ "#$%'45678ITXY_s #>X7KOY]ad *,.02>PQRSTUVXZ\lnpruwy{} !"#$%45<=BEGno  95| 9-}&~ 9 -5 9 59 ~L  ~L8 L    LL  95 9-& 9 -5 9 59 ~L  ~L8 L    LL |%hpd5>51%>;(<$T"N2<(!t$g4)=)FN5N2N5d2B.-*%T,H-(&-)B[upu$0(#y##>  # #NC:# yudu#2A#&kd=+dX2+,"N2,,.~J.-yo,:5d))5r(b.TTTT-----Xl1B/###### #y######N2###.y#.y#.y#.y###- - - - *%*%TTTTT,HHHHJ-#-#-#-#NNN)C)C)C)C:#:#_(BB[y[y[yj8  8  .#8-###=-]` --#x)#Sv)C[:#313}[y#[#8`)}((;ZMks#j3.#T-###b #-- -#-##Mks#- %/#b #1#TT-#-#NN)C:#(%*%}#[-#[i#-#-#-#-#BC M#+#.2~&<Cy#v%V' (5"?.-#8s'm#>(##" Tn## ##  ##2I#?B?N?)NNC@u::#yyy {#(##b# #y ### ###(I I LLE0>5> ( 026#2###<2   <>>( > .6"2&>>22222,i(",>(a-fy 7>B![*%2T-$ ([#>'T#N-@#<#N-I#-@g## <T##02##2#7#2##<<#. -)TT,%#%}8B##%#%*%-$(.}(   C8.##boq #y# I#  bb#Ce-#XBBT##b ##o##%#%-#-#-#.}}}Cb#T&- # #0<[;8q h< X&  (bX bB*T,> (?9 F 5AEN  4 #BBB.y######>- *%*%*%*% *%TTHHHH    -#-#-#-#((NNNN)C)C)C)C)C:#:#:#:#  B[y[y[y:# '!############TT-#-#-#-#-#-#-#-#-#-#-#-#11111BBBB #B########N-N-N+N+N+N+y{66....2(###### "L2#2#2#2#2#2#2#2#@B##N-N-3@##2#2#########2#2#2#2#2#2#2#2#@B#######(@HQffyy*%//HTT //H<<77aa2#2#2#2#2#  >>>'Md MM &222d((((((#(-<<<2(<((<dddd82#d=d<dJ/T"P(,,,4,,, ,w {  L,,,/,,4,,,#,w w   5  LF LA Y#-8).^"H)kRV >'>'4 T1v OH.uZe e J y## 2'1'2'/*.+*02'2'22'2'2'2'!<$ $ X2X2-#d|d| F22N2N2N2DDNMN5-v-0;(;:(0((((I(C(;(I(((Q( (((j(d(\(j(@(X$[4)=)&y0|(l(((((8(d(e(4(W(c(g(d(\(p(u((((((&((((6-@--@-+ 7(r<N;(;:(: F2222H H( $r#*%[y)kJ#@#)[c$upu$upu$((cD2 2<(;(;:(: %  -$1suz ##) %R(T00#C _#d% 0<[R<;;8Xh<r<;&#X&  0(7. -9  d(M(j- * -&Cd :-M >g*Wi)C-\7>%7##D>@-0@->7(0 )" ~( & ( ,,8,,.,,4,,,#, *b b,6(qqF{( j"0SIEE? 9 LF L5A^ E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =U5>51%>;(<$T"N2<(!t$w4)=)FN5N2N5cD2% 0<[R<;;8Xh<r<;&#X&  0(upr$0(% 0<[R<;;8Xh<r<;&#X&  0(udu#2\#&kd+dX2Q5e"N2~J.-5dcD% % % % % % 0<;;;;[Xh<h<h<h<h<Xlh<XXXX\;% % % % % % 0<;;;;[Xh<h<h<h<h<N2h<XXXX% % % % % % 0<0<0<0<0<0<0<0<[[[[R<R<R<R<R<R<R<R<]];;;;;;;;;A::;;88 XXXXXXwwwh<h<h<h<h<h<BB;;;;;;;;&#&#&##&#&#XXXXXXXXXXXX  ((((((u;ZV#D 22>2z2T  !~-Q-&-y<00/C=1C=ddvdvdJ@;(% (h<; % X&h<v#&#Ni70X -% (h<; % X&h<v#&#Ni70X <-C _# #<>9(> ( 22>2% ;h<N-; ;NN% ;h<N-;N &22\;#Q5# #}-#  @'swsswsPs0<[s#;8q h<r< X&  0(0<[s#;8q h<r<u X&  0(N-PK! 9TdTd*mdc/resources/ebgaramondcaps12-regular.otfOTTO PCFF 7wKFFTM#), 2013 Siva Kalyan This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.Copyright 2010-2013, Georg A. Duffner (), 2013 Siva Kalyan This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.http://scripts.sil.org/OFLhttp://scripts.sil.org/OFLEB Garamond SCEB Garamond SC12 Regular12 RegularEB Garamond SC 12 RegularEB Garamond SC 12 RegularRegularRegularKyrillische alternative de, el und eljCyrillic alternate de, el and elj, , bb~>EQSW]adtz~_cpw "*.1:<CJMRX[eEMWY[]}    " ' * 7 : > D I K N W ` q !!!! !!!! !#!'!+!9!K!P!!!!!"""""""&"6"<"A"`"e"k"o""##*$%&&&~' 'S'W'g'*v+F,..%.)...;00 1CIQSWYk @QSW]adtz~bpr  &,03<>GMOV[b HPY[]_   $ * 2 9 < D G K N W ` p t !!!! !!!!!"!&!*!9!K!P!`!!!!"""""""#"6"<"A"`"d"j"n""##)$t%&&&~' 'S'W'f'*t+E,`..".(...:00&BIQSWYkpkhcba`_][ZWICB><0/~{aJ onmkgdb[ZXVI84%mjfde5@ܸ90.*XT`:`*`%`````___|'{ \ ~`>@EQQSSWW]]aaddttzz~~".4589<=_>bcpprw   "&*,.013:<<>CGJ MM ORVX[[be4 E:HM`PWfYYn[[o]]p_}q     ! "$ $ '' * *+ 2 7, 9 :2 < >4 D D7 G I8 K K; N N< W W= ` `> p q? t A \ i j k m n!!o!!q!!r! ! t!!u!!v!!x!! y!"!#|!&!'~!*!+!9!9!K!K!P!P!`!!!!!!!!!"""""""""""""#"&"6"6"<"<"A"A"`"`"d"e"j"k"n"o""""###)#*$t$%%&&&&&~&~ ' ' !'S'S$'W'W%'f'g&''(*t*v,+E+F/,`,1..Q.".%R.(.)V....X.:.;Y00[00 \&1`BClIInQQoSSpWWqYYrkkstvw|~LM   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_$pbcg&vni|thqeu jz alRk{)`!"87l23%w #ox2EBGaramondSC12-Regular;     fZm<WY $+28>ELRXcnx $+2=HLPV\cjpv} !$'.5;AN[agnu{&-8CNY_eoy~ &-4;BIPW\ahov} !(/6=DKRY`gnu|$+29?ELSZahov} %,3:AHOV]dkry !(/6=DKRY`gnu|      $ + 2 9 @ G N U \ c j q x     ' . 5 < C J Q X _ f m t {     # * 1 8 ? F M T [ b i p w ~     & - 4 ; B I P W ^ e l s z    ' . 5 < C J Q X _ f m t {  !(/6=DKRY`gnu| '3?IZ_chovz}!&+269>BGMTVX_adilsvy|#*18?FMT[bipw~ &-4;BIPW^elsz ")07>ELSZahov} %,3:AHOV]dkry !(/6=DKRY`gnu|$+29@GNU\cjqx  '.5<CJQX_fmt{#*18?FMT[bipw~ &-4;BIPW^elsz ")07>ELSZahov} %,3:AHOV]dkry !(/6=DKRY`gnu|$+29@GNU\cjqx %,3:AHOV]dkry !(/6=DKRY`gnu|      $ + 2 9 @ G N U \ c j q x  !! !!! !'!.!5!$E$L$S$Z$a$h$o$v$}$$$$$$$$$$$$$$$$$$%% %%%%%%,%3%:%A%G%M%T%[%b%i%r%y%%%%%%%%%%%%%%%%%%%&& &&&!&(&/&6&=&D&K&R&Y&`&g&n&u&|&&&&&&&&&&&&&&&&&&&'' ''''%','3':'A'M'T'['b'g'n'u'|''''''''''''''''''(((((($(+(2(9(@(G(N(U(\(c(j(q(z(((((((((((((((())))")))0)5)=)D)K)R)Y)`)g)o)v)}))))))))))))))))******$*+*2*9*@*G*N*U*\*c*j*q*x*******************++ +++ +'+.+5+<+C+J+Q+X+_+f+m+t+{++++++++++++++++++,, ,,,,&,-,4,;,B,I,P,W,^,e,l,s,z,,,,,,,,,,,,,,,,,,,-- ---"-)-0-7->-E-L-S-Z-a-h-o-v-}------------------.. ....%.,.3.:.A.H.O.V.].d.k.r.y..............////*/7/B/M/X/c/r/}/////////////00000%050D0S0d0t0000000001 11&151C1Q1_1d1i1r1{11111111112 222(232=2F2N2V2`2i2r2z22222222222222333 3333$3*30363<3B3H3N3T3Z3`3f3l3r3x3~333333333333444 4444$4*40464<4B4H4N4T4Z4`4f4l4r444444444445 55%505<5J5Z5h5w555555555555556666)626<6H6U6\6b6h6n6t6z666666666666666666666777'777F7P7V7\7b7h7n7t7z77777777777777777777888 8.8:8H8S8_8j8x88888888889999'919:9B9J9T9]9f9n9x999999999999999::: ::::$:*:0:6:<:B:H:N:T:Z:`:f:l:r::::::::::::::;;; ;;;;$;*;0;6;<;B;H;N;T;Z;`;f;t;|;;;;;;;;;;< <<$<0<> >>+>:>D>J>P>V>\>b>h>n>t>z>>>>>>>>>>>>>>>>>>>???"?.?ADAUA\AaAiAsA}AAAAAAAAABBB/B?BLB^BpBBBBBBBBBBBBC CCCC%C-C6C;C@CECOCTCZCbChCrCxC~CCCCCCCCCCD DD/D>DMD\DiDvDDDDDDDDE EE#E2EAENEbEqEEEEEEEEEFFF$F/F=FGFQF[FjFyFFFFFFFFFGGFGfGwuni00A0uni00ADuni00B2uni00B3uni00B9AmacronamacronAbreveabreveAogonekaogonekCacutecacuteCcircumflexccircumflexCdotaccentcdotaccentCcaronccaronDcarondcaronDcroatdcroatEmacronemacronEbreveebreveEdotaccentedotaccentEogonekeogonekEcaronecaronGcircumflexgcircumflexGbrevegbreveGdotaccentgdotaccentuni0122uni0123HcircumflexhcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonekIdotaccentIJijJcircumflexjcircumflexuni0136uni0137kgreenlandicLacutelacuteuni013Buni013CLcaronlcaronLdotldotNacutenacuteuni0145uni0146NcaronncaronnapostropheEngengOmacronomacronObreveobreveOhungarumlautohungarumlautRacuteracuteuni0156uni0157RcaronrcaronSacutesacuteScircumflexscircumflexScedillascedillauni0162uni0163TcarontcaronTbartbarUtildeutildeUmacronumacronUbreveubreveUringuringUhungarumlautuhungarumlautUogonekuogonekWcircumflexwcircumflexYcircumflexycircumflexZacutezacuteZdotaccentzdotaccentlongsuni0180uni0181uni0182uni0183uni0184uni0185uni0186uni0187uni0188uni0189uni018Auni018Buni018Cuni018Duni018Euni018Funi0190uni0191uni0193uni0194uni0195uni0196uni0197uni0198uni0199uni019Auni019Buni019Cuni019Duni019Euni019FOhornohornuni01A2uni01A3uni01A4uni01A5uni01A6uni01A7uni01A8uni01A9uni01AAuni01ABuni01ACuni01ADuni01AEUhornuhornuni01B1uni01B2uni01B3uni01B4uni01B5uni01B6uni01B7uni01B8uni01B9uni01BAuni01BBuni01BCuni01BDuni01BEuni01BFuni01C0uni01C1uni01C2uni01C3uni01C4uni01C5uni01C6uni01C7uni01C8uni01C9uni01CAuni01CBuni01CCuni01CDuni01CEuni01CFuni01D0uni01D1uni01D2uni01D3uni01D4uni01D5uni01D6uni01D7uni01D8uni01D9uni01DAuni01DBuni01DCuni01DDuni01DEuni01DFuni01E0uni01E1uni01E2uni01E3uni01E4uni01E5Gcarongcaronuni01E8uni01E9uni01EAuni01EBuni01ECuni01EDuni01EEuni01EFuni01F0uni01F1uni01F2uni01F3uni01F4uni01F5uni01F6uni01F7uni01F8uni01F9AringacutearingacuteAEacuteaeacuteOslashacuteoslashacuteuni0200uni0201uni0202uni0203uni0204uni0205uni0206uni0207uni0208uni0209uni020Auni020Buni020Cuni020Duni020Euni020Funi0210uni0211uni0212uni0213uni0214uni0215uni0216uni0217uni0218uni0219uni021Auni021Buni021Cuni021Duni021Euni021Funi0220uni0221uni0222uni0223uni0224uni0225uni0226uni0227uni0228uni0229uni022Auni022Buni022Cuni022Duni022Euni022Funi0230uni0231uni0232uni0233uni0234uni0235uni0236uni0237uni0238uni0239uni023Auni023Buni023Cuni023Duni023Euni023Funi0240uni0241uni0242uni0243uni0244uni0245uni0246uni0247uni0248uni0249uni024Auni024Buni024Cuni024Duni024Euni024Funi0250uni0251uni0252uni0253uni0254uni0255uni0256uni0257uni0258uni0259uni025Auni025Buni025Cuni025Duni025Euni025Funi0260uni0261uni0262uni0263uni0264uni0265uni0266uni0267uni0268uni0269uni026Auni026Buni026Cuni026Duni026Euni026Funi0270uni0271uni0272uni0273uni0274uni0275uni0276uni0277uni0278uni0279uni027Auni027Buni027Cuni027Duni027Euni027Funi0280uni0281uni0282uni0283uni0284uni0285uni0286uni0287uni0288uni0289uni028Auni028Buni028Cuni028Duni028Euni028Funi0290uni0291uni0292uni0293uni0294uni0295uni0296uni0297uni0298uni0299uni029Auni029Buni029Cuni029Duni029Euni029Funi02A0uni02A1uni02A2uni02A3uni02A4uni02A5uni02A6uni02A7uni02A8uni02A9uni02AAuni02ABuni02ACuni02ADuni02AEuni02AFuni02B0uni02B1uni02B2uni02B3uni02B4uni02B5uni02B6uni02B7uni02B8uni02B9uni02BAuni02BBuni02BCuni02BDuni02BEuni02BFuni02C4uni02C8uni02C9uni02CAuni02CBuni02CCuni02CDuni02CEuni02CFuni02D0uni02D1uni02DEuni02E0uni02E1uni02E2uni02E3uni02F7gravecombacutecombuni0302tildecombuni0304uni0305uni0306uni0307uni0308hookabovecombuni030Auni030Buni030Cuni030Duni030Euni030Funi0310uni0311uni0312uni0313uni0314uni0315uni0316uni0317uni0318uni0319uni031Auni031Buni031Cuni031Duni031Euni031Funi0320uni0321uni0322dotbelowcombuni0324uni0325uni0326uni0327uni0328uni0329uni032Auni032Buni032Cuni032Duni032Euni032Funi0330uni0331uni0332uni0333uni0334uni0335uni0336uni0337uni0338uni0339uni033Auni033Buni033Cuni033Duni033Euni0340uni0341uni0342uni0343uni0344uni0345uni0351uni0353uni0357uni035Duni0361uni0364uni0374uni037Auni037EtonosdieresistonosAlphatonosanoteleiaEpsilontonosEtatonosIotatonosOmicrontonosUpsilontonosOmegatonosiotadieresistonosAlphaBetaGammauni0394EpsilonZetaEtaThetaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonPhiChiPsiuni03A9IotadieresisUpsilondieresisalphatonosepsilontonosetatonosiotatonosupsilondieresistonosalphabetagammadeltaepsilonzetaetathetaiotakappalambdauni03BCnuxiomicronpirhosigmatauupsilonphichipsiomegaiotadieresisupsilondieresisomicrontonosupsilontonosomegatonostheta1Upsilon1uni03D3uni03D4phi1omega1uni03D9uni03DBuni03DCuni03DDuni03E1uni03F0uni03F1uni03F2uni03F9uni03FBuni0400uni0401uni0402uni0403uni0404uni0405uni0406uni0407uni0408uni0409uni040Auni040Buni040Cuni040Duni040Euni040Funi0410uni0411uni0412uni0413uni0414uni0415uni0416uni0417uni0418uni0419uni041Auni041Buni041Cuni041Duni041Euni041Funi0420uni0421uni0422uni0423uni0424uni0425uni0426uni0427uni0428uni0429uni042Auni042Buni042Cuni042Duni042Euni042Funi0430uni0431uni0432uni0433uni0434uni0435uni0436uni0437uni0438uni0439uni043Auni043Buni043Cuni043Duni043Euni043Funi0440uni0441uni0442uni0443uni0444uni0445uni0446uni0447uni0448uni0449uni044Auni044Buni044Cuni044Duni044Euni044Funi0450uni0451uni0452uni0453uni0454uni0455uni0456uni0457uni0458uni0459uni045Auni045Buni045Cuni045Duni045Euni045Funi0462uni0463uni0470uni0472uni0473uni0474uni0475uni0476uni0477uni0490uni0491uni04AEuni04AFuni04B0uni04B1uni04C0uni04C1uni04C2uni04D0uni04D1uni04D2uni04D3uni04D4uni04D5uni04D6uni04D7uni04D8uni04D9uni04DAuni04DBuni04DCuni04DDuni04DEuni04DFuni04E0uni04E1uni04E2uni04E3uni04E4uni04E5uni04E6uni04E7uni04E8uni04E9uni04EAuni04EBuni04ECuni04EDuni04EEuni04EFuni04F0uni04F1uni04F2uni04F3uni04F4uni04F5uni04F8uni04F9uni0510uni0511uni051Auni051Buni051Cuni051Duni1D00uni1D01uni1D02uni1D04uni1D05uni1D06uni1D07uni1D0Auni1D0Buni1D0Cuni1D0Duni1D0Funi1D18uni1D1Buni1D1Cuni1D20uni1D21uni1D22uni1D26uni1D27uni1D28uni1D29uni1D2Auni1D2Cuni1D2Duni1D2Euni1D30uni1D31uni1D33uni1D34uni1D35uni1D36uni1D37uni1D38uni1D39uni1D3Auni1D3Cuni1D3Euni1D3Funi1D40uni1D41uni1D42uni1D43uni1D47uni1D48uni1D49uni1D4Auni1D4Duni1D4Funi1D50uni1D51uni1D52uni1D56uni1D57uni1D58uni1D5Buni1D62uni1D63uni1D64uni1D65uni1D9Cuni1DA0uni1DBBuni1DD3uni1E00uni1E01uni1E02uni1E03uni1E04uni1E05uni1E06uni1E07uni1E08uni1E09uni1E0Auni1E0Buni1E0Cuni1E0Duni1E0Euni1E0Funi1E10uni1E11uni1E12uni1E13uni1E14uni1E15uni1E16uni1E17uni1E18uni1E19uni1E1Auni1E1Buni1E1Cuni1E1Duni1E1Euni1E1Funi1E20uni1E21uni1E22uni1E23uni1E24uni1E25uni1E26uni1E27uni1E28uni1E29uni1E2Auni1E2Buni1E2Cuni1E2Duni1E2Euni1E2Funi1E30uni1E31uni1E32uni1E33uni1E34uni1E35uni1E36uni1E37uni1E38uni1E39uni1E3Auni1E3Buni1E3Cuni1E3Duni1E3Euni1E3Funi1E40uni1E41uni1E42uni1E43uni1E44uni1E45uni1E46uni1E47uni1E48uni1E49uni1E4Auni1E4Buni1E4Cuni1E4Duni1E4Euni1E4Funi1E50uni1E51uni1E52uni1E53uni1E54uni1E55uni1E56uni1E57uni1E58uni1E59uni1E5Auni1E5Buni1E5Cuni1E5Duni1E5Euni1E5Funi1E60uni1E61uni1E62uni1E63uni1E64uni1E65uni1E66uni1E67uni1E68uni1E69uni1E6Auni1E6Buni1E6Cuni1E6Duni1E6Euni1E6Funi1E70uni1E71uni1E72uni1E73uni1E74uni1E75uni1E76uni1E77uni1E78uni1E79uni1E7Auni1E7Buni1E7Cuni1E7Duni1E7Euni1E7FWgravewgraveWacutewacuteWdieresiswdieresisuni1E86uni1E87uni1E88uni1E89uni1E8Auni1E8Buni1E8Cuni1E8Duni1E8Euni1E8Funi1E90uni1E91uni1E92uni1E93uni1E94uni1E95uni1E96uni1E97uni1E98uni1E99uni1E9Auni1E9Buni1E9Cuni1E9Duni1E9Euni1E9Funi1EA0uni1EA1uni1EA2uni1EA3uni1EA4uni1EA5uni1EA6uni1EA7uni1EA8uni1EA9uni1EAAuni1EABuni1EACuni1EADuni1EAEuni1EAFuni1EB0uni1EB1uni1EB2uni1EB3uni1EB4uni1EB5uni1EB6uni1EB7uni1EB8uni1EB9uni1EBAuni1EBBuni1EBCuni1EBDuni1EBEuni1EBFuni1EC0uni1EC1uni1EC2uni1EC3uni1EC4uni1EC5uni1EC6uni1EC7uni1EC8uni1EC9uni1ECAuni1ECBuni1ECCuni1ECDuni1ECEuni1ECFuni1ED0uni1ED1uni1ED2uni1ED3uni1ED4uni1ED5uni1ED6uni1ED7uni1ED8uni1ED9uni1EDAuni1EDBuni1EDCuni1EDDuni1EDEuni1EDFuni1EE0uni1EE1uni1EE2uni1EE3uni1EE4uni1EE5uni1EE6uni1EE7uni1EE8uni1EE9uni1EEAuni1EEBuni1EECuni1EEDuni1EEEuni1EEFuni1EF0uni1EF1Ygraveygraveuni1EF4uni1EF5uni1EF6uni1EF7uni1EF8uni1EF9uni1EFAuni1EFBuni1EFCuni1EFDuni1EFEuni1EFFuni1F00uni1F01uni1F02uni1F03uni1F04uni1F05uni1F06uni1F07uni1F08uni1F09uni1F0Auni1F0Buni1F0Cuni1F0Duni1F0Euni1F0Funi1F10uni1F11uni1F12uni1F13uni1F14uni1F15uni1F18uni1F19uni1F1Auni1F1Buni1F1Cuni1F1Duni1F20uni1F21uni1F22uni1F23uni1F24uni1F25uni1F26uni1F27uni1F28uni1F29uni1F2Auni1F2Buni1F2Cuni1F2Duni1F2Euni1F2Funi1F30uni1F31uni1F32uni1F33uni1F34uni1F35uni1F36uni1F37uni1F38uni1F39uni1F3Auni1F3Buni1F3Cuni1F3Duni1F3Euni1F3Funi1F40uni1F41uni1F42uni1F43uni1F44uni1F45uni1F48uni1F49uni1F4Auni1F4Buni1F4Cuni1F4Duni1F50uni1F51uni1F52uni1F53uni1F54uni1F55uni1F56uni1F57uni1F59uni1F5Buni1F5Duni1F5Funi1F60uni1F61uni1F62uni1F63uni1F64uni1F65uni1F66uni1F67uni1F68uni1F69uni1F6Auni1F6Buni1F6Cuni1F6Duni1F6Euni1F6Funi1F70uni1F71uni1F72uni1F73uni1F74uni1F75uni1F76uni1F77uni1F78uni1F79uni1F7Auni1F7Buni1F7Cuni1F7Duni1F80uni1F81uni1F82uni1F83uni1F84uni1F85uni1F86uni1F87uni1F88uni1F89uni1F8Auni1F8Buni1F8Cuni1F8Duni1F8Euni1F8Funi1F90uni1F91uni1F92uni1F93uni1F94uni1F95uni1F96uni1F97uni1F98uni1F99uni1F9Auni1F9Buni1F9Cuni1F9Duni1F9Euni1F9Funi1FA0uni1FA1uni1FA2uni1FA3uni1FA4uni1FA5uni1FA6uni1FA7uni1FA8uni1FA9uni1FAAuni1FABuni1FACuni1FADuni1FAEuni1FAFuni1FB0uni1FB1uni1FB2uni1FB3uni1FB4uni1FB6uni1FB7uni1FB8uni1FB9uni1FBAuni1FBBuni1FBCuni1FBDuni1FBEuni1FBFuni1FC0uni1FC1uni1FC2uni1FC3uni1FC4uni1FC6uni1FC7uni1FC8uni1FC9uni1FCAuni1FCBuni1FCCuni1FCDuni1FCEuni1FCFuni1FD0uni1FD1uni1FD2uni1FD3uni1FD6uni1FD7uni1FD8uni1FD9uni1FDAuni1FDBuni1FDDuni1FDEuni1FDFuni1FE0uni1FE1uni1FE2uni1FE3uni1FE4uni1FE5uni1FE6uni1FE7uni1FE8uni1FE9uni1FEAuni1FEBuni1FECuni1FEDuni1FEEuni1FEFuni1FF2uni1FF3uni1FF4uni1FF6uni1FF7uni1FF8uni1FF9uni1FFAuni1FFBuni1FFCuni1FFDuni1FFEuni2000uni2001uni2002uni2003uni2004uni2005uni2006uni2007uni2008uni2009uni200Auni200Buni200Cuni200Duni200Euni200Funi2010uni2011uni2015uni2016uni2027uni202Aminuteseconduni2034uni2035uni2036uni2037exclamdbluni203Duni203Euni2047uni2048uni2049uni204Buni204Euni2057uni2060uni2070uni2071uni2074uni2075uni2076uni2077uni2078uni2079uni207Auni207Buni207Cuni207Duni207Euni207Funi2080uni2081uni2082uni2083uni2084uni2085uni2086uni2087uni2088uni2089uni208Auni208Buni208Cuni208Duni208Euni2090uni2091uni2092uni2093uni2094uni2095uni2096uni2097uni2098uni2099uni209Auni209Buni209Cuni20A5uni20A8dongEurouni20B2uni20B9uni2100uni2101uni2103uni2105uni2106uni2109uni210Euni2112uni2113uni2116prescriptionuni211Funi2120uni2123Omegauni2127uni212Auni212Buni2139uni214Buni2150uni2160uni2161uni2162uni2163uni2164uni2165uni2166uni2167uni2168uni2169uni216Auni216Buni216Cuni216Duni216Euni216Funi2170uni2171uni2172uni2173uni2174uni2175uni2176uni2177uni2178uni2179uni217Auni217Buni217Cuni217Duni217Euni217Farrowleftarrowuparrowrightarrowdownarrowbotharrowupdnuni2196uni2197uni2198uni2199uni219Euni219Funi21A0uni21A1uni21A2arrowdblleftarrowdbluparrowdblrightarrowdbldownuni21DAuni21DBuni21DCuni21DDDeltagradientproductuni2210uni2213uni2215uni2216uni2219infinityuni2223uni2224uni2225uni2226uni2236similaruni2241notequallessequalgreaterequaluni226Auni226Buni226Euni226Fdotmathuni22EFuni2303angleleftanglerightuni2474uni2475uni2476uni2477uni2478uni2479uni247Auni247Buni247Cuni247Duni247Euni247Funi2480uni2481uni2482uni2483uni2484uni2485uni2486uni2487uni2488uni2489uni248Auni248Buni248Cuni248Duni248Euni248Funi2490uni2491uni2492uni2493uni2494uni2495uni2496uni2497uni2498uni2499uni249Auni249Buni249Cuni249Duni249Euni249Funi24A0uni24A1uni24A2uni24A3uni24A4uni24A5uni24A6uni24A7uni24A8uni24A9uni24AAuni24ABuni24ACuni24ADuni24AEuni24AFuni24B0uni24B1uni24B2uni24B3uni24B4uni24B5openbulletuni2619uni261Cuni261Duni261Euni267Euni270Auni270Buni270Cuni2753uni2757uni2766uni2767uni27E8uni27E9uni27EAuni27EBuni2A74uni2A75uni2A76uni2B45uni2B46uni2C60uni2C61uni2C62uni2C63uni2C64uni2C65uni2C66uni2C67uni2C68uni2C69uni2C6Auni2C6Buni2C6Cuni2C6Duni2C6Euni2C6Funi2C70uni2C71uni2C72uni2C73uni2C74uni2C75uni2C76uni2C77uni2C78uni2C79uni2C7Auni2C7Buni2C7Cuni2C7Duni2C7Euni2C7Funi2E18uni2E22uni2E23uni2E24uni2E25uni2E28uni2E29uni2E2Euni2E3Auni2E3Buni3003uni3008uni3009uni300Auni300BuniA726uniA727uniA728uniA729uniA72AuniA72BuniA72CuniA72DuniA72EuniA72FuniA730uniA731uniA742uniA743uniA749uniA751uniA753uniA757uniA759uniA76BuniA78DuniA78EuniA7AAuniA7FBuniA7FCuniA7FDuniA7FEuniA7FFuniE001uniE002uniE8BFuniF6BEuniFEFFuniFFFDu1F44Cu1F44DAdieresis.deuOdieresis.deuUdieresis.deuuni030C.capuni0302.capuni0302.flatuni030C.flatacutecomb.capgravecomb.capuni030C.alt1tildecomb.capuni0306.capuni0308.capuni030B.capuni0304.capquotesingle.altuni0311.capuni030A.capuni0307.capone.lnumtwo.lnumthree.lnumfour.lnumfive.lnumsix.lnumseven.lnumeight.lnumnine.lnumzero.lnumgermandbls.altuni0327.capuni0328.capL.scriptQ.longf.longzero.taboldstyleone.taboldstyletwo.taboldstylethree.taboldstylefour.taboldstylefive.taboldstylesix.taboldstyleseven.taboldstyleeight.taboldstylenine.taboldstyleone.tabliningtwo.tabliningthree.tabliningfour.tabliningfive.tabliningsix.tabliningseven.tabliningeight.tabliningnine.tabliningzero.tabliningEuro.tabliningi.TRKU.LATbullet.01bullet.03bullet.02exclam.subsquotedbl.subsnumbersign.subsdollar.subspercent.subsampersand.subsquotesingle.subsparenleft.subsparenright.subsasterisk.subsplus.subscomma.subshyphen.subsperiod.subsslash.subszero.subsone.substwo.substhree.subsfour.subsfive.subssix.subsseven.subseight.subsnine.subscolon.subssemicolon.subsless.subsequal.subsgreater.subsquestion.subsat.subsA.subsB.subsC.subsD.subsE.subsF.subsG.subsH.subsI.subsJ.subsK.subsL.subsM.subsN.subsO.subsP.subsQ.subsR.subsS.subsT.subsU.subsV.subsW.subsX.subsY.subsZ.subsbracketleft.subsbackslash.subsbracketright.subsasciicircum.subsunderscore.subsgrave.subsa.subsb.subsc.subsd.subse.subsf.subsg.subsh.subsi.subsj.subsk.subsl.subsm.subsn.subso.subsp.subsq.subsr.subss.subst.subsu.subsv.subsw.subsx.subsy.subsz.subsbraceleft.subsbar.subsbraceright.subsasciitilde.subsbrokenbar.subssection.subsparagraph.subsegrave.subsuni2016.subsdagger.subsdaggerdbl.subsexclam.sinfquotedbl.sinfnumbersign.sinfdollar.sinfpercent.sinfampersand.sinfquotesingle.sinfparenleft.sinfparenright.sinfasterisk.sinfplus.sinfcomma.sinfhyphen.sinfperiod.sinfslash.sinfzero.sinfone.sinftwo.sinfthree.sinffour.sinffive.sinfsix.sinfseven.sinfeight.sinfnine.sinfcolon.sinfsemicolon.sinfless.sinfequal.sinfgreater.sinfquestion.sinfat.sinfA.sinfB.sinfC.sinfD.sinfE.sinfF.sinfG.sinfH.sinfI.sinfJ.sinfK.sinfL.sinfM.sinfN.sinfO.sinfP.sinfQ.sinfR.sinfS.sinfT.sinfU.sinfV.sinfW.sinfX.sinfY.sinfZ.sinfbracketleft.sinfbackslash.sinfbracketright.sinfasciicircum.sinfunderscore.sinfgrave.sinfa.sinfb.sinfc.sinfd.sinfe.sinff.sinfg.sinfh.sinfi.sinfj.sinfk.sinfl.sinfm.sinfn.sinfo.sinfp.sinfq.sinfr.sinfs.sinft.sinfu.sinfv.sinfw.sinfx.sinfy.sinfz.sinfbraceleft.sinfbar.sinfbraceright.sinfasciitilde.sinfbrokenbar.sinfsection.sinfparagraph.sinfegrave.sinfuni2016.sinfdagger.sinfdaggerdbl.sinfexclam.ordnquotedbl.ordnnumbersign.ordndollar.ordnpercent.ordnampersand.ordnquotesingle.ordnparenleft.ordnparenright.ordnasterisk.ordnplus.ordncomma.ordnhyphen.ordnperiod.ordnslash.ordnzero.ordnone.ordntwo.ordnthree.ordnfour.ordnfive.ordnsix.ordnseven.ordneight.ordnnine.ordncolon.ordnsemicolon.ordnless.ordnequal.ordngreater.ordnquestion.ordnat.ordnA.ordnB.ordnC.ordnD.ordnE.ordnF.ordnG.ordnH.ordnI.ordnJ.ordnK.ordnL.ordnM.ordnN.ordnO.ordnP.ordnQ.ordnR.ordnS.ordnT.ordnU.ordnV.ordnW.ordnX.ordnY.ordnZ.ordnbracketleft.ordnbackslash.ordnbracketright.ordnasciicircum.ordnunderscore.ordngrave.ordna.ordnb.ordnc.ordnd.ordne.ordnf.ordng.ordnh.ordni.ordnj.ordnk.ordnl.ordnm.ordnn.ordno.ordnp.ordnq.ordnr.ordns.ordnt.ordnu.ordnv.ordnw.ordnx.ordny.ordnz.ordnbraceleft.ordnbar.ordnbraceright.ordnasciitilde.ordnbrokenbar.ordnsection.ordnparagraph.ordnegrave.ordnuni2016.ordndagger.ordndaggerdbl.ordnexclam.supsquotedbl.supsnumbersign.supsdollar.supspercent.supsampersand.supsquotesingle.supsparenleft.supsparenright.supsasterisk.supsplus.supscomma.supshyphen.supsperiod.supsslash.supszero.supsone.supstwo.supsthree.supsfour.supsfive.supssix.supsseven.supseight.supsnine.supscolon.supssemicolon.supsless.supsequal.supsgreater.supsquestion.supsat.supsA.supsB.supsC.supsD.supsE.supsF.supsG.supsH.supsI.supsJ.supsK.supsL.supsM.supsN.supsO.supsP.supsQ.supsR.supsS.supsT.supsU.supsV.supsW.supsX.supsY.supsZ.supsbracketleft.supsbackslash.supsbracketright.supsasciicircum.supsunderscore.supsgrave.supsa.supsb.supsc.supsd.supse.supsf.supsg.supsh.supsi.supsj.supsk.supsl.supsm.supsn.supso.supsp.supsq.supsr.supss.supst.supsu.supsv.supsw.supsx.supsy.supsz.supsbraceleft.supsbar.supsbraceright.supsasciitilde.supsbrokenbar.supssection.supsparagraph.supsegrave.supsuni2016.supsdagger.supsdaggerdbl.supsv.LATu.LATv.LATmediuni0306.cyruni0306.cyrcapuni0431.SRBuni0434.altuni043B.altuni0459.altuni0414.altuni041B.altuni0409.altgravecomb.stackacutecomb.stackuni0302.stacktildecomb.stackuni0304.stackuni0306.stackuni0307.stackhookabovecomb.stackuni030A.stackuni030C.stackgravecomb.flatacutecomb.flatuni0316.capuni0317.capdotbelowcomb.capuni0324.capuni0325.capuni032C.capuni032D.capuni032E.capuni032F.capuni0330.capuni0331.capuni030F.capat.01J.histquoteright.01U.LATscu.LATscone.01one.taboldstyle01Q.shortQ.lowq.longscuni2619.01uni2767.01paragraph.01guilsinglleft.altguilsinglright.altguillemotleft.altguillemotright.altgravecomb.grkuni0313.grkuni0314.grkuni0342.altgravecomb.grkstackuni0308.grkstackuni0313.grkstackuni0314.grkstackacutecomb.grkacutecomb.capstackgravecomb.capstacktildecomb.capstackhookabovecomb.capacutecomb.grkstackspace.stackuni0345.cap1uni0345.cap2uni0345.sc1uni0345.capAlpha.scBeta.scGamma.scuni0394.scEpsilon.scZeta.scEta.scTheta.scIota.scKappa.scLambda.scMu.scNu.scXi.scOmicron.scPi.scRho.scSigma.scTau.scUpsilon.scPhi.scChi.scPsi.scuni03A9.scsigma1.scuni0342.scuni0345.scgravecomb.stackscacutecomb.stackscuni0302.stacksctildecomb.stackscuni0304.stackscuni0306.stackscuni0307.stackschookabovecomb.stackscuni030A.stackscuni030C.stackscgravecomb.grkscuni0313.grkscuni0314.grkscuni0342.altscgravecomb.grkstackscuni0308.grkstackscuni0313.grkstackscuni0314.grkstackscacutecomb.grkscacutecomb.grkstackscalphatonos.scepsilontonos.scetatonos.sciotatonos.scomicrontonos.scupsilontonos.scomegatonos.sciotadieresistonos.sciotadieresis.scupsilondieresis.scupsilondieresistonos.scAlphatonos.scEpsilontonos.scEtatonos.scIotatonos.scOmicrontonos.scUpsilontonos.scOmegatonos.scIotadieresis.scUpsilondieresis.scuni2010.capuni2011.capfiguredash.capendash.capemdash.caphyphen.capgermandbls.alt1germandbls.alt2registered.supsperiodcentered.CATperiodcentered.CATucperiodcentered.CATscj.dotlessi.dotlessuni030C.altuni030C.altcap1uni030C.altcap0.016Created by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)EB Garamond SmallCaps 12 RegularEB Garamond SC 12h  !"#$%&'()*+,-./0123456789:;<=>?@|BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abgdfj}srx{     e !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@A~BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:oAuiwvpqtyklc      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  #&q .@f2Ee$3c|@Us  # 9 V w  ) ? \ l   p ~ ! = a  ? b }   4DSewz:iz'8><);>^Ix ? # W !!<!l!!!""J"# #7#c###$$%'%V%%%&,&d&&&''Y'{'''((I(r((()&)e))))**8*++1+`+++,,7,W,x,,,,--J-u---..Q.../#/X///00L00011A1g1223323T3v333344,4N4o44446616[666770788889'9X999:;#;K;t;;;<$=J>b>>>?)?[???@@2@S@@@@A AHAnBgC1CaCCCDD)D`DDDEE5E[EzEEEFF-FLFlFFFGrHHRIIJJKL6LVLMNO&P#PDPnQiRSSTUUW+X?XY[6\"\]]5]_^9^_`xawbbbc8cde*eff'fguhUij jjklmWnoRp'pqqqr*rGrrrs)sZsssttJtytttuu:u\uuvvUvvwwPwwxAx}xy'ypzD{p{{{||G|p||} }U}y}~_bX#R3k5g0a#Ih{ClR3T,`'s;b^sVeMu4 gb0/s]$h4Th8]=0h{,~ëBNj:l}Z3.ЯҿsӨԒզ/֑&ת؉آ7_܇5Ya!N~b/Fy!9<?BRUXC+7HYng{"4f <l7EYsK+8Ng<,;NZmTevFo<[= $:O/E[ /R CUn;dm k  J v   Y  , AC}(e"O||Df!B[wW{fm Z !u"m"#*#Z#z$j$$$$%$%H&&)&B&^&''m'''())*,,--;-k.D//G/s0M0m1 1o112#3 4B575[5q56q7889!999::5:;|;>>?8?i???@AAcAAABBLBlBBC3CXCqCCCDDDLDhDDDEE^EEEEFF&F9FgFFFGGGHUHlIsJ?JwKKKKLL$L9LULxLLLLMMM#MCMQMMMMN)NeNNNNNO O%OMOlOOOOP P#P9PvQQRRSgTMUSUUV7VWpWX)X<X^XrXY`YZeZZ[ [[[[\\k\\\]$]O]z]]^ ^C^n^^_(_l__``Z``a"aaaaabb=bebbbc c2cXcccddDdhdddde eKeueeffCfnffgg1ghgggh0h^hhhiiLiij'jwjjk*kekkkllElwllmmemmmnn:ninnooVooopp;p`ppppq/qXqqqrrMrrss9sgsssst t?tkttttuu?u]uuuuv v,vJvjvvvvw%wOwwxTyyzszzz{&{c{{|!|e||}@}~}}~;~w~~<O$_'h6]AoHG 8pDz)Vx1e?})OqS2^R3aZ:m+qd8]6q)OBI|"d6g:y5`H3g!@t 0iX!\_ Ej$Gkc \X=B_@#WAAv@*3q*keI_{:s$XIg#h8gBh˜)Mqä<bĘ=hŎŴ  !$6HUbpƒƪƿ'E ->W|BToʖVˊ;̀In͙͘ͷ-eϠ/WsЅИаLv(Ӆӿ4IkԅԗԩjՅՙ1G`wֵ֟ݳށ޴3pߜ/UBB)a(,Pq';_,Qu1@_ k:0o_n621Z$F -J*>Rdu?{%R-k  \   1   1 S v    # A     K  NT \+e:>z9m-^2I!%)*W*+,,--!-:-|--01223m34`56678:;N<*<=y>?@(@B+CDbE1EFGH!I@J`J}JJKL[LLLM4MLMeMMNN7NJN[NuNOPzQoR|RST]U:UVWXuXYZI[#\\]^I__`abcd?efbg@h]hrhshlppqIqzqqqrrr"rrrrrrs/s@sWsgststuv vw wGwwxx)x8x^y yyyz z,zQzhz|zzz{Z{|~}}~~~A]JK,RiDVh{%Iq*IWr$:Uy 2Op $:Nbq#GZ #Nk *=Sn0Th8Y *H^r Bc{9u $8Lc"In%;N`t3{ %<X 6J_s$K_&@X)<NdwAXx!/KZ|4Yv8Zx/DYj#H\+Xu=Qh,9Os Y6}#5FTr$:q(To"D^r$?],>Raw6Tt!:Qk1Vl4Tyf{Uhz sr!3EVgw-1oAT5 /?Vgx+=P_*CmXsœ´7Fbwë (8JYmĆĘĨĺ'7Gtŧ;_ƕƻI|ǡ4ZȃȑȟȬȹɥʴ&ˎ˝f $m$; }  !LEnR q`!qߋyppwsp xP|! ! F]\Pw0)jI`BpDŎNÎP@}{}`B=}{}a?FvfˎiHvfʎ_El>, }- \. m|1/ b0 1 v2 9Ro]I13 4 5 ^4vtX 6 uyx~| ͋ 颔m]l^%R1,==FQ|ŬQ7 [}|}8 >v9 6~PESY: ; < = v> ? DNt2@ }; - - '-&j A E+ vyB # C Y?C v]~D *} c f )E F G  h vfx$lw}{se^ȿ ))SAjL.F"壔Ya/hJ33=2 8KVE}zx|jw&= Edʋf/iFdH =I oƧ^VzJ fK L M |BN m3e O 6P cwzAfQ R rwpoNyS T U V T}}4lW X >Y YZ \2[ $'\ c߭xf] ^ v%Ips_ ` ha }vXxb c v}sd e zt{M^f g h Ư Ui <j Dvm_xk l ,m C{^sn ر o ]}ܬ)Vp q vr vO!s >t 7u ̵͉{v 8\֮*Rkis8~~yzm\w 8\ܧeoR9sxmpzwy~~~8kfx fJyn[UkFy ws5z { o[9 ,Q}v| e} ~ _;   }*Щ^ ͈  8 Ru>:n ȣ+T w +L:n W ވ ~(zh8   S= Q r! 2 rC   \C  Hu mW x >v!D44p  h d ʒv!_l t  }(r ` H4e (W rh c }vDS 4W |   }<Ǩ]\ Ԣ  |H| } vI!#J# vIQ    p gg pSV 8.æ Wͻ~̧˖-d-ЋE]MQbeUwweQM~]E-d锔|KJЋϘBjv8 8.æEWjBRIЋQ\GBJoK|~ɋųŸTcЋɘ-oBG~\QI[zfrL @  3v  >Hȋ||nnЁ ~Ldh }\QcNj־b VӍɌre[ayrpbdY 7'(5|\grvE}t@~{ߑ:7zlX^_wz}~{es΋܋ˋ؋ynwxmprm*v  6̋xcjt='E-Uֽ3I<l>, 5  c -$~bQu{{yy*wIWW8dgud}~uk&(&jbcjiccjLRVKKMRL+Smx?Qyn^g^M_ LtF:qfJ,={{dc|mnwmFơcXE\HwF OaFܳncدfXVib{l{vjv~iy}w||tiQ]~mtwo/U]#A pv>w0uv8^yȰii|_d;ReBs^jpV_iËnd~_a_7jk`z@slwW~م{kxvdӟ[|³֐o^f]nxppekoe\iӴط{|ETAG.A51%5얍|\kh]pv*- 4KFVaX}p-boqċ_x5ӪT4 j ' $w h vbww. B{}yՋ拥trtr|_U^UaS߉ʌ%9߻ 30z~}6tbww1. j0z~}1*ާqfJ,={{dc|mnwmFơcXE\Hwv"뺢wXa {}yՋ拥trtr| _U^UaSʌ% 9 30z~}0`r_fXVib{l{vkrmw~v||`fdQ]|~mrwn;Ic ½ NVIvvxxGj͋ʫ䋸聆~k~oykv}_swshZX2Sjzc /i"-F;dA M#H =I /i"-F);d(A ԍ#H =I /iFxd(|= H =I /i@^F{d$:_  2AH =I /i,Fvd, W H =I /i1F嵸d  oH =I ݆pmpCA3J {+ 3  c c  k c N nf-W;ūA Q zR nf-۲;jA ^Q zR nfFZ0= Q zR nfDXQ W `BIQ z`R Yꪫ-;20iA 8Z Yꪫ-H;()A xZ YꪧQ0= Z Yꪵے W Z m#  }z^϶j_  e&Jb c v}철-;\3A d e v}철-_;A d e v}천= cd e v}첾^$N_  !d e v}첪 W God e ~v{ |x##)*##$#}s   ]}ܬ-;4V(:A sp q ]}ܬ-=;V(A p q ]}ܬV(Q .p q ]}ܬV, W 2p q 謫-M;7(A su ܬh7yj׾<>Q}XYfw|fcn‹ݜ݋ -pqxxzUx]bUzrdV[nyYttYn}<Ǩ]]€  @ € B   U15 bz { U1l5 qbz { ]m|5 {z { ӠP[58   Zz { Z5T& E z { ݥᴔ5~   t z { m>Dr[7 *xg  w g*g©  Ru>:nU B1ȣ 2, r Ru>:nU ֟1Yȣ $, r Ru>:n] Smiȣ .> r Ru>:n.Gȣ7& E `Qf q` r!U1E0+ Ȓ r!U F1(9 Є r!]m'0/ Ȏ r!֑4& E .# ͈FE +T 8 }!ݠP_g   a@L b@ @ }(U1  ` }(U1  ` }(]m  ` }(ؠP*X 2 *  ` }(t& E H ` ҽ| {iqvwqrvwrrvvrrvvr}(M  K= }U֎1 RQ }U1 DQ }]֟m N }օ,y& E  p UgW1( Md IɩeȪ (W~drhgrd~ubglh~~hlnǷXL[t\[u94bwp v֢4J& E ( /iHFsd( ;H =I q5H z { /i)Fd( H =I .~5[  z { /giF)dK !H =I nղ5 &z { |-Y;ͰA N }*U 1 6 |= N }*]m 4 |H - a0N }* * ` | AN }*Ml 1 m쪴~(g ԉQO 6P ͈M yl( Ԁ 8 m#  ͈FE +T 8 nfBU5 j7Q zR Ru>:n G^ȣ+ _@ r nfObL MQ zR Ru>:n T,qģ@>  x` r nfۡ- >SQ zR Ru>:n ։ȣ* )j r gnfફ ^?Q >R Rnu>:n ֢թȣ V:nM Rlkȣ /; r T}}㱝l= RW X ~(z]m~h    T}}㱨 l CW X ~(zΩ.h  A 耊  T}}㱫]l$- qIW X ~(z h*    T%㶰}l zW yX %㷩(zUh z y z ۽= +Y S=] ֞m  \dTlHzUg^zUzrgOzUbcUz{]PU[yYtt]jMR`quattYψS= Q Y^J(y_  (9Z r!ݠPH, 4 ,  YR0 EwZ r!20   YꪲE0 Z r!ֳ   Yg Z rn!|6 h Yꪵ,0>- cZ r! 2 \-52[ XZ C! G  \P0= ȡ[ rC]m'0/ h $%㿨0 \ $\C   Lܤ{4%w_vwcuvAWʇØpjgZy{\\U\|~^bH{mgjptww|nߪ-M;v.A  ] j^ HuU ]1P e j %㿨nߪ5 ZM] :^ H$u n Zt : nMU\[ҭ$+ YU] Z^ HuU 1Ȋ${ /- Z ndYﭭ$]2 -] Z^ wѴ/咭kj{Xpdptwwt c߭xazUtZ_}Uz[Cq|}̣M_nyWyuzgqty{j&Ij>>LHu m+ x }z籦-`;ܶA jhb c }!U_1 e>T i  }%㳠* :1b Zc %㶠!_>и 5r 9 U }z籵̶ j@b c }!M_l eI i  }Ug++_(). SP U  }bm'F`zN[Rzrq4Dk|wAxC={xtD94@~yLettY}-o4r|e-mHon|w}uzmyc{s٤w Eh5     v} o]d e }(h " ` v}첧 sd e }(復.{  ?B ` v}첬-$M   d e }(Uo(   `  }mwzsA`VNC(".? (sN{Ƌz{ky}~~Y#^vT}l{tu{n+hvtuS0kdoklt 7IR4$E{őQ|xI1pMwϋֆ狒w~nqnb;m|v|z|v<rlf':jmp$!xz~~u|{nS xDvm逸-ۮ;A jk l ,m }vDSU ֣1v  Ld u  D%㯹mDp :k Zl ,m %㶭vDS  ]M =  Dvm勇B|, j}k l ,m }vDSM Vl  W u  C{-;l(dA Ԛ0n  }Vb~ pɋ+ ?#iI]X܆oƧv:^V#j1fgi{[V[oyYtŋ~K 4J~J j{mB?ERQlk}cs^qoƚo }1f\ 6v 5  u}v rx c`Vbe pɋ+ ?#iI]X'6kuqm`fmpY =I{ w!AV47oƚ }x\ h{}Ta=zvl\ \oyYtxÃ͋ˬ= Xksu}v w cVb|nɋ+ ?#iMzYaaÕ|[[eh||uæ$2,K[sg}rx|t}Sr(R??-P+m}wgStqns;HY.B|BL% @e~rja[v{N{kySkV>&VJ0UNjՏÏ}qX[E0)H@'dW狸buct~}B\~elZLWVWgnt~3$0ðqiw{a+L԰Ƌyz5ًՋm#  |Xv9=Q(r0qtBǖtAdwW[zyYtڋS"n_ n1fbi{\Ҭoe}^ldZ,Q؞wM9C 쓷tYoX֋zUz]m`rj}Ƌt<kxzqh :l}wՏby rxxr]x} w{ky_o 6&$͋zg~oq{X娢}spSЩp eϋ&.\_uowqmuo`-2j $7*A !KOYcgxwhTnWQTOqˋʓƶƋLVcwzĤAXv{^#Y~~y{yPqtYsVz@kE0 eep~xh+num{wct|ˮ0h P p}˹dQ   r\pwpoN*xN\z||qyyopvvƋ8l{tu{nsYavzuʇT FmBzlOp[6r؋Pnw^4B{xmv$bhpzr`su{qmt{ƨᚸؕ ~p}}㱗4l YfgaWvzN{+YVB!UT6+Tڋʰ䪓{gyhTuZ|Ȃu}ytzhmy}^o>3,742 )ꋾf{x~v|noTJra~soq{v~\!r@hLZυb ov[JτFJV$;VJ%>=A<^Ƈ睖|\q\oyYttYnq׋zU.`y$C:!J&0G5)'3'Ͳw&5=q.=O,G2ndptwwt咭juYffih{Vi'',!Gņz\v:͕܋Ihj+@h1fgi{ZTZtyYttYzo[O{K\gv{ghy_i|xu.0ad #ζU~lj5*-*>ptwweOy} N$L;\xxԨԪ^f}zbJ^Q¢~ierhXoȋȋ]:cV~|hoͅ}  p wv1 eaiO2Vt{zx >ʩʘvakyx}ug_s:}|ywygQVRoVs˻[Q}2Hfhpzr`su{qmt{ƨᚸȋ{wdlhQ~܁bAV|~|8gTv-rw6n1fgiuy[[ovYttYn[̍ˋyoq|||uw}xnz}˻[/2ζU~lj5+-'Lwm8gý{wdlhQئؗ~\/ߏ{ >ᘋvTgyxo`V\p:̍ˋyoq|||uw}xnoi}ualyeuyg}ܬ)V@h   x{ԫiԽJ | r}3ֶTc]flz}{v{FVZ( F :5+:\9Ƀ툼zqcdeEiZ~G5"X?/ ԢV}ܬo0B#=qg|wO}Nj ;27)$Dzvolfnmzx[#5d$Td]{x}lzn^\\W}ufQS/l\yo|/9zvol]bmzKs Tep([opYttYn(ڝX尿W}b6vg}|w}{u}OFZ\inepo͉{򋖋~oI[l[\Z^_cn ǹAA8^[Wng|a{[vĊN/YCYD~|\J[IO9tlhW}4(vٰw ۋ@NSF}|yx  jWp`qb@~}sfrgoc}xtiԆۋxm`qimp}ݯs: }᳓w`0,x6qZwU|<Cxo.vpxQx:TG܋܏|noE\rL2Kصrvஙwrqy{[+G ո}vc|bvޕjsCMSmzpft4xW65 ) Ë&_OvݭwM@=FkEK}Ѳ}os{';@Ta]@EসۘVUMCxs _wuzǵbACK{IWe΋ċSEt䳣Ū~.ԾbT/GJt|zˆF6 zB@ڋP+Bp{}hoͷK#xVnWƋbtzmp]zUz{\uT~~ԦB55k*"TZog`oy~|} ܌,  tc8vp` L؊luq~d^trypdsazߺ57- v O 6P kpM-3 ] E @z { /i,Fad "+- mH =I G5 > :&% 䀩z { ݆pmpCpA2 1pX {)p 1p p ap pap p ip v5Dr< 2: *x j  T}ޭ4k0Y[=.ZM6 M˟R{gyhTuZ|Ȃu}:{tCl}s}}jr>R2#/ꋾf{X %޳}dBXтV;sXVkQJ^~@vf0òNOJePYRfɻ90}ċp{w~wau`40Q'6_|trx}}|\v|spzoy|x~}x3qӋs@+kKT}}㱰l ZW X ~(zMlh    $}h S\ \CM yl  v^W[W *d e c(  ` vc7E Z i>d e c(Ch N i ` p}ݯsr  m &t:ȭMlW @& q@' @( 5@ @) rCMl%0. i Ȅm̵y3Ұbmv O 6P 愮jvٰw|3Ӭw UNSF}|yx/ w B]CH+}xtiԆۋxm`qimO 6P }g}vٰuw y * 3S7q{X咭}htBzU2y[< UNSF}|yxr]x} B]CH+}xtiԆۋxm`qimT}}㱡-n;lA NW X ~(zU"1nh c   }iwxm?zUg^zUzrgRTzUbcUz{]X[yYtt]jM(^*& :xzkri}m,-{.!_XHe&qxў+E%/H1`<1 X:nUmȣ/ / , q nfOb]0 HQ zR Ru>:n T*oģ@1 Pv qP Yꪺ1u0 - Q. Z r!Up0e/ /  YE0]0 #7Z r!ֱ1  v}첯1%- Q. yd e }(Up(/ / 4 ` v}z]0 Md e }(۠徫*}1 A ` Dvm勇1_|- Q. fgk l ,m }vDSUq4 / / d s  DvmK]0 jk l ,m }vDS X* D1 @t r@  ]}ܬ1ۚV(- Q. p q }UR(/ / Q ]}ܬV(]0 ,:p q }֠*1 a C%㴬K n  %㶢<Ǩ]; r i r %㿨رmo t o %|s*y t m\]6\F (FK+î͋ދ.,NCg_ith{湰֋ыGE6]3erxˋկ@;M!Hqyyyopv&WUUV[y{nqnyu~xkʹJI*tjsvswM7Ī˾ًBDDd_otmq~[W۽ +fY S=( ֏|-2  vb-Nx}of0c]p{utukVDT;E[ff||~uts[z{\X\oyYtNjƋ}T`wi?R{hof|qjlwDa|nr־ndRZhfa}I咭}htBzU2y_o 6&$͋|&}3 }wQE:C֋ܔ9DV.7[f0_(Y$\#41ڲҾ#^{u0OS`EiKhDzԭ``$@8j@4Aa}VyR>KŰŸ{r?I8>U[;P>J0 N* ::ŋBr{+[WaP_˾XY?8`B;;Q%퀀ȵh{{c@>!@~@(/@L@xl싟mOHOjN@HgNAA8^[W]ۢs|a{[vĊ?5ONtlhW}؋D)ivٰw xttxXX{Ax@7z‡"UNSF}|yx  B]CH+}xti',ӀLU4@ԧ@W@4ـ/i,Fd- mH =I 5* vz { mnfr ^mQ >R Rru>:n ϽȣF Vp : v}첪 #~& W ȀGod e }(Ƚ+4^ %] E ȀH ` v}첾^  !=D  Ā!d e }(mĿ fo S4 "5 6 Ā ` v}첪NK- yd e }(* L ` v}첪aK "+- yd e }(G^ ":&% [ ` >b70V U1u p &C0> 6 j~w17 C_o\ZnRw`xܼfdkkoz3咭kj{Xpd~_Bw E;7 C9I\ZnRw`xܼfdkkoz(*cJLLansu r iୄngkpuwwtbڻhQ'~E[='Eސ8 ށb>V|x\ZnRw`xܼfdkkozc7 $9 }^vw:B咭}htBzU2y_o 6&$͋zt? _pɋ+ ?#iI]XEH &>&\>?ٸGS[d`S_#+ܫekwр@ʜ: @; ^< @TG'',!GʋtkptwweOy} N$L;\xxCi}dLT]tcjovb `)xyzXzy{q}||aHM^@?uYmziu`@t h؋Y=nuz{_y|ͅ >Y~|Br[o''~jqX[ET[dvht~xyzmVySkV>&V%MG uNjԔÏ}1}氾w' y԰ԋ^u{xzm{z{3UXg^;~ðqiw{aejq"c!߭|q_nyWyuzgqty{j&Iq);jzUtZ_}Uz[cOYرQ4[ovYE0)w1Ɗypq|||uw}xnxyzjQՋoi}ualyeuyetYnjT Uu[>ӭʘvakyy~ysZ{$^JmkV= lsgcum[b^tq|n4vٰwdUj ^NSF}|yx 쟥 B]CH+}xti?{Toӭʘvakyy~ysE'ӹ+-K2_q{mB@RQln}cs^q}Xo||f>5=I=?[oyYtŋ}K ?&Q|ebUzv[;z}|Ь )U M/34#o-&G'/JՌؑ獳ztqkn{mzYXB4\-zvolfnmzx[Vz'F/L&iu~cy|ͅtcjoj:K_{}{HM^@?uYmziutkqcwz!A?\hh\nN}l{wz|s ixyzp\i(=Ek@z{[VgL~|tcFƋz{ky}R  }gꪽw_v z fY3zÕqi`rhmsFvu{xzm|yx5)JVel{P[79}n\V$2z||qyyopvvƋf*AkzUf]zUz{]k!{t*xN\H)D> 3zo! YᘋvTgycpriZz:A}n`yykV;VJ>΋ŘX%ZV0F5)'3&WSwCwр; R@퀌|}TG'',!Gʋt)>ʩʘvakyx}ug_s8Nvm8_|7§ʽ<&QxebUzlON7{tTZtyYttYz8xylOl ,>QK/jwیԌ‹F::,JAp_{tpzwwjFαywosf|lo~x? p{jpX䬄ng߆P7@h|r~vypyo|bjep([opYttYn(Ě1œztcbn{mzrz~uQlzvol]bmzKsy8zb^ ]}Y=|u}ċR~uff{y~ry$chhc~xs]^{tԋ_n>b6vg}|w}{}ID}ȍڎu\{}"_q3}owuY@!_@" & !@\-g% t[pG~6</Ď<@@jqV#2'΋0@P)}}k@@il\+/{VLs^ukK­=Sg(9ؖwh}]wl\O#a~r|rxxiO,S7Ŗ}}}ulyXo'',!GſWċymm}v{wKM# @? - @b g!SZBXWbFn;82@9Nno@n}h}W~ր)W⨀o}v  cTVb| pɋ+ ?#iI]XζU~lj5--'}:(,d[{lwde{^Yxjxws}fx+ HM@~@1@a Y @3=}X|4z^nhzg_do?eog{kp{ϸ[^MUl`fv԰ԋgm\`3Z]hfwCw y3 % >ًʩʘvakyx}ug_s:咭}htBzU2y_o 6&$͋~j}y UζU~lj5+-'Ry_o 6&$͋zg~|q{}`}9osvË`u6-KTbjq8tM*kQ4A@@`@Ax@@rjڋ/F}KQ@ $ {}sԿQذzyy9y'5[foYmYO+IIrmbbu|uzwZI rzomstx~znvY}&Y&U")^PigglBD]Bep}_@@A B C ?}@v}APN/bQws|mq~ä\dchstx~szx{D OD@}@v}APԞ@cnyYSbQws|mq~ä\dchstx~szx{D @rzomstx~znv;}A&xRO]eU3]üZdchstx~szx{ad ׋`d;D+ 8H)D> w}͋\Or`gdbj|rxpiO, K3TM?_y~mdvgb2zζU~lj5--'Xtdt'',!Gʋt|}w͋\Or`gdbj|rxpiO, X0TM?_y~mdvgb2z̗ܐ}}}uyXo'',!Gʋtd!T3d?wqw$zmvszph"bʋx}y} 5~ldd}/0ԋƨxBȇ }E $)VF G H *}vSi-?}stkkzыBE܋$֋^>mW @a,@B@{@;^:=+@@ }Wc`^wov1="m\rިj۫w_/dU~{o_=aʋijsxmuwwjI g&x}cLb}vzx|dr`Yw_e$puwwz_cY`pxwwvvXJLRcltζU~lj5+-'nh0$ζU~lj5--'#oswwu[hQm-)$ bhkwr`s|k{ƨᚸދ`JL4\xx,<J ^bH{mgPP|tptwwtL}Ԥ%n^bH{mge]eȨmzwÈ,chhc~}notwwtyw}dei咭kj{XpdLVqGptwwtx؎ۏw}K kr|ut咭kj{XpdReeVUm҈_ptwwtww # >ʩʘvakyx}ug_r:咭kj{XpdPt]ѥw}H& ' {! 'L9সۘVUMCxs+呭kj{Xpdptwwto_wuzէ4Av|ԫwW\FI Wg&x}hMb|urwii`f.@0oYI Wg&x}eJc{trwoi`f.@0oWdU~{q_=b'ʋŨGayڋɵzg~q{yݫwY[FI g&x}iNbzurwji`g.@0/ZI g&x}fKcytrwsi`b-@1tXdU~{q_Adʋayڋŵ|muwwjs٤wVXFgJLQntp{n[ʩʘvakyx}ug_s:[JLBans  ngkpuwwtbڿhQp}0Fr5Aʿ&?rp]iW~~wxotw)#<׋#'ߋ!wtrTza}C/Sd[{lwde{^@TބԋA: NL )|uI5pOwϋى苒w|rg9m}v|z|v:nlf*:mm}rz$%{|z~v|iS t?}O:K&Z% 47-28.ۋavŋ FHtC;_g􋟒Ëslr~`\q\^[bLEyn !M N rO nwlǤA^bH{mg#Hezkwtzwxkwy}krpq{kwl(wA䒭kj{XpeCHezkwtzwxkwy}]pP nwCA A( >ʩʘvakyx}ug_s:^bH{mg#Hezkwtzwxkwy}_J4αywosf|lo~xp{jpXvngpzwwjnwJA  >ʩʘvakyx}ug_s:αywosf|lo~x? p{jpXng_2>1*9pzwwjYΟywo_Z2ow}ywkzHYpjwwz9>F}tx[)c/hXouwwt>_s}w||[̅`̈K&$QcpKmٗhdF3#cB~|mnt^bH{lh\X|l}νpn~xhh|~wufdrbRez˳uRjwC Jxj\g}JmkV‹@Q ltgcylShi{P >͋ͩʘvakyx{uqe:)чВI:ʖʋR~^dP' Ћ>O}>Q^nsu{qmtxHeR|^tgIP|t FnNxctzsΤϨیZͶU~lj50-'mwѩ? 2[O[u˼H >ʩʘvakyx}ug_s:n$c6D7-ζU~lj5,-' ^>LrqqEB_NXmՋŽkbwZEڌ<R ss33NSYwAQpi(p_pvz|aMsw[ # >ʩʘvakyx}ug_s:ܐ8 ܁b>V|x}{ %wiMVbmt|rxri`b.zg&x}b,idU~{n3l~};=bɋzg~vq{ҪZ.a}.~xhht|~j6Od[{lwde{^;QŚ罙~dhhd~xa`rPR 7* xlF}䫜wiFV*& 9xzdnxv}qf^-v,!_aBdU~{n($w.}M}[xy}w{u^k2=P}joow(%wI~mwmw|wE}Usx|vn5}Xxz}אΆwu}#( Gpsns}pb+X~kqnwyF}X~x}yw|ش࠯*VXA| v ~xhh|~~9U5Ggq]]S l3 L~dhhd~( $vpGotwwt>y.B4wQvٰwb  $3 >ʩʘvakyx}ug_sߋxm`qim UNSF}|yx  B]CH+}xti4ԯ7vٰwTVUNSF}|yx  B]CH+}xtiiipӛϸ{^\`YpPS &tOvݭwH& s' ( 7 ) (1Ovݭwk2p[\dO^qǧpîL9সۘVUMCxs _wuzՋ4AzyxaZ_FF_CN^Ћɰttx~vl |Q,E`Vmxu}SRIAptwwtJً@G>N4YDoo\gJptwwtb[mk`ʋδ΋gm\`&C2}>w P䒩kj{Xpe)IPxwLhHbIHYjozzfӋNddym\`6J8,ðqio{ajN\g}58,<,F%/?=0 B/AK:KE ,EA;J- >.'S[YT >aU V CW ?}?[*LwU}* 0D&g8VudTv6GfVW֚s~t}xpnƺ(,dwy!Q+3Gkc>vpw$zmvszph"bʋx}y}AΟu|o-]">jyoz/3ԋƨxp;(RX Y2/:FkbwZEڌLϏ^bH{mgf]?LrqqEB_NXmՋVyJ @R ^ytsZdy~t{N4.OYDoo\gsD|vptwwt>[mk`ʋδ΋gm\`&CZ}gݰuw.:Y DPzinۋxm`qim UNSF}|yx咭}htBzU2y_o 6&$͋3 qtRtwz+y U-咭}htBzU2y_o 6&$͋zg~ਗq{d_w|qէ4AC?!*{wI' {! 'P9সۘVUMCutZ}kԯpuw7:Y U TNSF7}|yx咭}htBzU2y_o 6&$͋ziw׊iipӛϸ{^\`YpPV|S {ʻ[`Vmk[‹ispc)nNVZ`iηltg~hGX?Y)ΗI~b>V|xV$cl˻[#{wdlhQQt{ƨᚸ6ζU~lj5,-'G~ށb>V|x|8g+'ehpzr`su{qm=}@[;{Jyouqi]]eo!ɋǩìerϸe^IWqZn{԰gm\`3hindtcy^lhQ禑ϐ8 ׁb>V|x|8gHܻ[wBh(Alrv\ ~؋Pnw^4B{wmvptwwuegoplfb\ouwwu[hQm-)$ bhkwr`s|k{ƨᚸދ`JL4\xxE}vwѾ\ p#ЋJmkV‹Q ltgckpSFL[Îkm{XlhaVb~ DsݰwA+咭kj{XpdptwxԆۋxm`qim UNSF}|yyy A8vx qZ Z %v9d[ [ vn#_i&;O[dVut澋n7)=aʋijsxmuwwj\ wCvn#_ i&;O[dVut澋n7)=aʋijs0yv{jyzvPcov~y|~}q{ ffBSƹìzklohأϾs2{y&~rmyvryv{jyzu{U@@.mȪ@(4@#kwqnnxpp􏀑8h qZ }~<x]uX~v}Ĭ׎W;d/`(P|$ xP|! ! >-*^ > yn[XbSEV`p.4 _ B4#BZgBB^BMcfx c@` w\cra Ec` !{!b U1r U1r Ѡv* *@ * * * q{vwp/Hkλrzomstx~znvBȇ }E $)VF G H vvjyl{|~~|`zĻdvrqWemaerv|{wwmwrq}}؏~֋b{yicv@[Kyv}~T~l{~LCriy|{X@ROc `d e \U1r \U1r S]m nvPY   ~ f aɩ. { n E g t  \Ur  [Ml C% 󀘒sC%h h \Ur/ / a }z~rQ֚uwhsgncrwvrrwvrqvɫ*q1 i xWAPKSbynlϿi lj j  tvjpj`ċX[nyw{uxUf1/r U^17r I Hv&w|{`+}xTI+&!x}.H,}x < 2s{|ȿŢlnqry}yfj k ۳\w|{͋ͩʘvakyx{uqe:T"% S0 D 5l m %    K)&w|{c4|!_|yHp4Tŏl\]{\]gxu7ɋM⡖yEd]m3sm|| i |~{mesm]m- kɩ.!n ɩ.VfEEfSY~ir@ROc `d e !!b !!o ý!o !o frL @  ${t${t)\. \.  4p 4_x}p^4x}@ڳ, x} m6<ÞCPŹc}V]pF{]VrH' q lloEDyUXjliroo\cra ei`Tr s `t p3crP3a "u Yv rw s sk ' q s p ZZΪٸwJe-}11-Jw~^lgvHl=^~̱}e=H~՝ڬzMac]gqfouljWe^WP|$ rw '-&j A E+ \cra L3crPKa "u Yv /i`cFVd(0a EH =I *- ؆nc;wA a /Q uR !c?w(a 1Y  gc?wPa XZ }fcBwvsPa Ud e gc)wPa +x 9cHBPa Dy r!3cPr=a )"u Yv $ /iFdH =I oƧ^VzJ fK L M w߲ofz { | z } ~ nfAfQ R ̵͉{v >Y }ѹvyR4$Eo =HY.Bo 3He |wu){}a~fye~{}|YZ $'\ ' {%Ips_ ` ha }zXxb c v̽wNҥˤ>@I~r|knplboye‹~@qJ|\~hyi@~@@垃ҋ~v~@zgjuVN?@{t~>|}~]}vxy;sv}sd e ޳o (    zt{M^f g h ͚v  p ر o ^Խx :Ŭ>LM!={@&50(z;fcoYttYn&' %zU`]zUzw#{/' 8!>t d. ŬBy Yꪵۓ W Z ^Խx۝4 W  %x c5a gqz { Ru>:nc ֜ȣa - r S=c a b r!c U(Ba { $3c+Qra )"u Yv " s5z { o[9 ,Q}v| e} ~ _;    qw AT*   $3w 0 Ru>:n ȣ+T w pSV S= Q |F> I g r! 2 ~\C  Hw' >z!D<4p  d h }!_l t  fv0 ʣG8`2 x`b `x` ` x`vzncG09` : =` }(r ` 舧q {0    H4e (W u wYаO ZhB90[P ̓RRTzAgJAX|H| $ {  @o    ʈ~   h r!֑4 E . $3֒4e E  }(ca  ` $cV(a Ts  ca y >}ݳz"NjIMH1{o;O+HH,- 5^>a|}wtenqem|H[hu^Խx gc)wPa +x ^Խx۝4 W  %x pvTw.U]9rpmegj73 ?.99`87ҏluyn|Z:2) +?suq}qww$yi~V91U9i[{|~grYI7'㙋3ۋ}sBaUD]Xˋw_k;=cvyk{tovnuTbc>axٝxΔɦrol}JC} Lmuq싍zޤߋ]#F)*-?>-Zl缯YZRIٜwa1!?/Ԑyd\VC~ywnsr3Wo}|nmwZar\oNyS T U V v|NC*4qW}q؄rh{y܄Ԉ֋V{ ~؋ptsW6a-v<8nkuqfF3 gXSO+kj)a_^=`~ՏՋ%xF|ރxtwjlmXzyyoo^drv~Zh`TkXvWko|eY`vxfsb_KO˶³֏qXgLpЋv;XGolRYZtrq_#F2 @rh{y܄}rhZF)ՒhjQxYZl~|BN vعtMykHj}v}}{usvfk[^tukdmuywh`Pku g5=B=rsCȳ|j>5=B=rsW2ц͋ŋ݋= Xhr%zUg^zUzrg<>zUbcUz{]X[yYtt]jkm`quatdk(G Xdp|Eݍˋpxw|}in:OK^]Roi}ualyeuyZZpvYttYn*>6YvYttYymësa-;A  j ꪫ-;4VA  cЬLKG  s٪ x tYtXzUc]zUz{[OxnzghltXzU`]zUz{\X x5}j{j/iFdH =I oƚo}1ff 6v 5  oƧ^VzJ fK L M w߲ofz { | 7̴p-`?#uitumw})zU|_.:-fewzye -"UZ,{|՛cwt؋o:nfAfQ R 9yr«saKdK  d  ,  d  p}ϹdQ   *f ꪲK G ymësap l @}<ܴp_l"uiYaosYttYnXzU`,.;-fewzyeW Hcgtzopjr!{%Ips_ ` ha >Y v}sd e ߰qapsYttYnXzU`.CBAF-bUz{\X\oyYttYn΍̋ފzt{M^f g h |BN ر o cЬLz ^pլe˪YZQ I;VcoYttYn= 2(7zU`]zUzws;+.9>t s٪۬|voL]zU`]zUz{[OntghltXzU`]zUz{\X |Bĝx8zwtwtۋ#1 s٪|zU`]zUz{ZNngM'lvVzU`]zUz{[X |tYnXzU`]zUz{[O|ntgh&Ss٪ܳ~U_[zU`]zUz{[Ontgh&S^zU`]zUz{ZNngM'lvVzU`]zUz{[X ~y͡rtwt֋ ܲo5L fZJZoq`rj|ȋucUZoyYtŋ΋ˬ; XMs"zU`ӚOL  Z OL>t<roX|^AVXMs"zU`]zUz{[UZoyYtŋ΋ˬ; |xt3    r}moG,<,F%/?=0 g tYnR ?'AK:KE,EA)~> TwzU`]zUz{\X\oyYt+ym-y<}}uzFfyYmyqm8<# YC5ꃛ:x`*mOqW_ċ>j=|aotYttYnXzU`co`} w F}w9q(,da{lwdmu^;bڊR솂{<̓ϙw}{GX+OCNBy ]J* <ZSvdH>.'S[YT >aU V CW Kvp(4  9ެrʳѓۘjppyuy-{|ʡcU~||yy隟~npƘyrtetrydvDsouoh'}g_vi    lId~ d  , >:v}9Hn  b ֫z }, ? |@orwwt{dhhmo;GbEQmv~~~rh}owego͘Q]qm}qk'}g_vi    '}g_vi    G8wl=6C1&`X#R+LYh}|#5kj{XsH_Optwwz]͋`5KҲp(4  }#oAت{|yL|{c}}حϋvqma`3$0Ϣqiw{a4bmj} UD= lsgcum[b^ts}~tЋJmkVܤ>6F^bH{mgmptwwt|+J r! 2 :$9 .mJ }KFl#"/ y7rqetrydvDso}}{xupquwݜwppvw٣-_xgj˪pITemRxo:r%>"$yehhd{p&/zehhd{pouww{ 7p}w٣-_xgj˪pIScnTxoc8w`?vYJLRclt #5kj{XsH_Optwwz_dX`pxwwtl]yUz{\X\oyYttYnWصLUr+‹ƌquuXv{vzW[trypdpwwwqؖ7u (Lb}|xhhw||yr~9{};|dhhd|yrm9c2ptwwtŬV[opYttYn5ږݠŮztgfn{mzurqQrhj]ys}|/9zvol]bmzKs T+{r (Lb%}|xhhw||yr~9{};|dhhd|yrzx:{ttu{2ptwwtYZ 9yr«saҲݟޟ a  a  )  a  lIdԫdΤ̽ m a  ) /i)FKxd,s H =I }˫^n*T *r w /i,Fvd, W H =I } w ݆pmpCA3J {+ 3  c c  k }Og)N{Wr{}w~qxmW~ġ~fxPwZwRnlhI{q#\Zusqadcόq}׋ˌkfdc__ƘJWjY{sznhwVJ_loru|qvànfL.@' JQ zR '}g˫ɒUq     |ˮ0h P )}KQ@ $ |ˮh W  P )}KQ@ $ 9yr«saے W a  a  )  a  lId~ d  , p}Ϲd]Q  W @:}9Hn  p}ݯs: &t:ȭH& s' ( 7 )  v b ꪵ W  b v}첪 W God e a}2L zl v}p l X a}C.S  ML v} W ! l X a}C.S  ML |xt U W @\ @ @ @ }%raˠϸ  άt cЬL(U vm ( cЬL,q W N ( cЬ-LxM   ( #ۈy W * 2I7 ӚH W B  Z ԈM"  b  p}˹dQ   Y}&Y&U"@@PglBD]Bep}_@@A B C Ư Ui <j |w; -TG'',!Gʋtkptwwkė< {O!s (Iufgn~yn?E}@U~urffwypfI5}?X|?H~zq(w15|Y{wqgj}rwd~|zux5swxv5Dr[7 *x o  }[])VW(j{zeW~NhRuzmr|ƟR=}nxsft^bGlh{nldd?`j_KzISi|P~}uJm}x̷~Sv}}*Щ^   8 yFE +T 8 1u>:n ȣ+T w rC   \C  .u m+ x zhPp  h }(r ` H4e (W ı4$    } |4!#J# |4Q pSV KҲp(4  Cw͸ smU    ؖH4e (W ʈ~  '8l ' ݆pmpCA3J {+ 3  c c  k {L-ٽhz _l z  ! m߿ oB z?4ٿ ~ T ]w("  >9e Y QR $H6  }ܿ pÎ p ̬ x }6'2 p  vl kK g/ ,y5 x { 䫍.n ]ο7  Ko n~||~xnRCiumgfʜZ\5${XGulw}vkjl|rztj^w~ {~r}\wl@o)WQ6~ Tu~~{xbNQJU~wwyoajccAMOA4t|vgwwPQZntyo_l,yww}eqɴ` \` RShOXq}o}xm]wgV{Q8vjȋ‹ŋicogqkjdymkfyȀVruiobXg\Mvpjwl{~~<n} ~r}}dj/hoPUP Lnabex|{xlXipy|v}~jxyu{~~on{~~on{~~s٤ Eh5     xX4 l lLz$)rHOXerGT{|~~xcHbbo BeGnt I{ hzB o xr Am7"ltIr-rx~{uo{r{hz\s4vu\Pa'a.~YR9OQ  F] _@( zB o x  (d\Pr JMSÿzwzpYlŵvwmo@MO@Le2ܥ‹gu}nR4d~wr1{~~~}'ؑFS}n\EfZ_QQwqwwEDkkgzzxԳ D7{woro^woRDwPEX_Dklo ͐A̡̺p/hʯiFɵd   H =I ک籦5i5l m 7z { oƧمV - tJ fK L M o[9 /Q &| e} ~ _;   aoƧٔV,- <J fK ]L M o8ǩ[98,Q% u| e} v~ _; u v E oƧ ^V# : 4J fK [L M oǩ[9],Qb uĀ| e} v~ _; u v c-Y;6A t iN g*U 15© V4 i m쪯w- @O 6P ͈ ֦ *  8 ma[,- 5lO 6P 8Ǫ<% lA" 8 mEۓ O 6P Ǫab l! 8 mk^4 $O 6P ffߙ W}f ti 8 moۘo oO 6P ]Ǫm%2 lN 8 nfBp@" >} 0j7Q y0R Ru>:n; sȣ@(# ^ i; p nf Bpl@ Al 0j7Q y0R Ru>:n; ֱwȣ@(  ^ i; p onf=c'o ^Q >R R]§u>:n ^m^ȣ- V# : M^nfBiM @ /`Q `R R@Rۧu>:n HIȣOc @d e +`w ` mnfO$L @& ]0mQ =0R Rru>:n T轔qģ>  @ U(p 9( r\oۙɫ- bS T U V +L:n   Ӏ T}}l -W X ~(zshx    !!*- UY S= *  a2;,- WY TS= "% B ۻ W GKY S= ֌o& E  mr zkY rS= l{ zu d#& ]Y k6S= ֞.!n ]^ YM^EtM H 4-sZ r@Rۧ!>Oc Hd e 4 Yꪵ-;4ے )R W Z r!;ZUA1 )( E .# $-;A F\ \CU ֿ1  $a,- \ S\C !% : $E ۂv x> \  \C t% b x9 anߪۼ@,- Z#*] :^ HSu ֚f!% Z|o : anߪbۼ@  - R#*] 2^ HSu3֚  S% R|o 2 E nߪZۭM ZF] :^ H u J b Zn : onߪ_߭Io Z] :^ H]u `m, ZMz : {묨-/;I5A d _ ` ba >z!U1D<4 dv/  a b {묲-IU- d_ ` ba >z!D<4* d{  a b a{XI*,- 4+_ T` 2a >SԠ!D<4!% 4 T 1 2 }z籰O//- ja/b c }!_׸* eC i  }a٠I5),- :g}b Zc Tؠ!_߸"% 5z 9 U }Eж :b Zc !ؠ!_7!b 5 9 U }o֠Զo :b Zc ]!_m- 5K 9 U v}첾^ p  "-  Ā!d e }(mĶ; C ''4 "5 6 Ā ` v}첾^0- 2 W !dg  @!d e }(m'0 | E i4 !5 6 @ ` v}p-?" $>} o]d e }(;b(# $^  ` v} p $Al o]d e }(;$( $ ^  ` zt-۱; A Owf g h H4eU ֯1^ @d zt۠ - /f g h H4e ֙* E Dvm况۝- jtk l ,m }vDS ֍ * Q u  Daչm{ ,- :8k Zl ,m TحvDS "% ]Uq =  Daչm>{ 1 ]- 48k Tl ,m TحvDS K/ % Z@Uq :@  DEmۖ :Tk Zl ,m !حvDS qA"!b ]p =  C{ؼ- zn  }<Ǩћ]$u* r! ɢ ң Caڬحu,- n  Tآ<Ǩё]3"% r+ i r C{ ؚpE - $Ru ɪn  }< Ǩxp?]K% "P Ȁ @ Ȁ C{a\6- $ n  }<5Ǩbs4]C{% ")! Ȁ' @ Ȁ Caڬح,- |- in  Tآ<Ǩё0]u* I% h+ d@ h ر'0- ̮So l-H0* c aر.,- lYo Tq1Hq"% lq E رIMa l/uo !!=H!b lp oرNI]o lCo ]§7m(H- lg| ]aܬۮV" W rJ p qq Sظքx0 D rQ ]M^ܬ۷V欳A(- @/t  * ? >欳}x4 W %t  /a& E  謵<7(- SMu p gA(* R ̵͉L= ?v p]m ^ a̵F,- @v pSnn!% sC E ̵E e v p  b B !S= և8!b z ֑է4N& E  |4    p K~֣:t   P  4;́5^_  z {  }<Ǩћ]$u* r! ɢ ң )w4ͭIiڋPnw^4B{\Njotwwtܣ$mx^K4daN~|id^xmotwwt*ׯڋP6}uñ|%S%Ыg<3=4={[sxutڐ؇u{q!΋~<ۋ}o^Q<^;;.h&gR RTu>:n ֘ȣd"% VR : nf´Ȕv 0{1Q y0R Ru>:n ֞ȊȣC,g `sl r` nf^N]_  `Q y`R Ru>:nݠP AHȣ@ @ @ 4 p nfFY43@ v8 0Q y0R Ru>:n5Y; Psff  \ Pw> qP nf4MFZT @g8 Q xR Ru>:n5Y;\Psfȣ # @\ w> p nf@FZU @l Q xR Ru>:n5T PsfszN @V  w> p nf^F]   @R2 Q xR Ru>:n5mPsfȣF4 5 6  ( Xw> pX anfFc0= @- ]0EYQ =0R RTu>:n] Sm(ȣ @g% U0R 90 YꪻM6 ȠqZ r! E,,g ) Ya,>,- hcZ rT!0"% h% vaܲAX,- 3d e Tد("% ^ ` v}첰o+ Wd e }(,g DN ` v}천Y4zr $v8 cd e }(5Y;sw`? $\ @ ` v}천}4X "g8 cd e }(5Y;lls]# "\ @ ` v}천@vȐh "l @cd e }(5TsjtN "V  @@ ` v}천^N  "R2 Ācd e }(5ms PF4 5  6 !( Ā@ ` vaܲ천iX=  - i3d e Tد(]m/ `% i^ ` }-_;7 Ye = l}հU1}r c  s> }-;\37 cYe = l}հUݏ1}r q  s> }o+ e = l}հ봒}Bg   s> }^NU  H;e = l}հàPݎ}j    @ s> aܲAX,- de = lTةհ}X"% z y s>z ]aܽܬ7V,- tp rq Tظ"% z ]}ܬMV6 tp Ȁq }괒ʷ,g  g}ܬ-=;V(7 ڼ   x{ԫU1Խr H, k g}ܬ-;4V(:7    x{ԫUn1Խr V, k g}ܬMV6 @f  @ x{ԫʴȴԽGg  i g}ܬ^V$UU  ʀ ɀ ʀ x{ԫԠPmrԽj   $ b gaܽܬ/ V,- u s u T{ԫԽe"% [yh ; 謫-S;-70A 3u p U!140 [d a.7,- le_u pS ]0]!% hp 謻]Ⱦ76 ɐ+u p gV,V,g М ^JZ7(_  u p ޠP Y,. 4 , \ sְonf[d_zVhjHj]zUz{\X\oyYtN ۆuzgqt^y{j)IkzUtZA-w, [N咭kj{Xpd},咭kj{Xpd}Y~}[ptwwt[,[ptwwta}R ?f * ;;x{{<,dW{lwde{^;QuѩzB}"wUJF#*& $ozcx~ds[^-}!0d 22.ѝzcdZ +ztgfn{mzppw.|zvol]bmzlR(}quHG^HZhܚ}u?^~w]tibrw(r_4G[d,掆MlMБ,9O#OǠ~xhhy|~srHF}:n ֵȣgi O> r Ru>:n qȣj +> r Ru>:nc]* nxȣ  @<i > p Ru>:nc]*mֵxȣ  j Xr> pX Ru>:nc]* nxȣ a @i > p Ru>:nc]*mֵxȣ a -j Xr> pX 놨nˣA i zQ uR 톨nˣwZA j zQ uR lnc]쮝A@R <i 8*Q r8R lnc]쮝wA@R j 8Q r8R lnc]쮝A@,a i 8*Q r8R lnc]쮝wA@,a -j 8Q r8R S= i $ S= ˿j  S=c]* ȿ"  <i @k S=c]* ք"  j @G S=c]* ȿa  i @k S=c]* քa  -j @G S=Ǡi ֈb,r s t @K!  & S=Ǡi ֈc%b,r s t @K"   i |Y  wZj h|Y !c]𪝟!R <i Y !c]𪝟w!R j Y !c]𪝟!,a i Y !c]𪝟w!,a -j Y ǍiwIr s t 0K! ``Y yǍiwcr s t 0K" ``Y r! n( i Н r!m0Dj y r!c]*pn! <i  r!c]*n! j  r!c]*pn![a i  r!c]*n![a -j  r!ǠiGw,r  s t 0K!  r!Ǡicx,r  s t 1K" y (Ti beZ *TwZj @eZ gc]𪝟BR ,<i LZ gc]𪝟wBR ,j LZ gc]𪝟B,a ,i LZ gc]𪝟wB,a ,-j LZ DǍiwIr  s t aK! Z DǍiwcr  s t aK" mZ }(3i s  ` }(Aj  ` }(c]*㿞! <i Ā,  ` }(c]*埿! j ĀP  ` }(c]*㿞!a i Ā,  ` }(c]*埿!a -j ĀP  ` }SysPi d e }Swsj d e }fc]󲒟vsBR ,<i Hd e }fc]󲒟wvsBR ,j $d e }fc]󲒟vsB,a ,i Hd e }fc]󲒟wvsB,a ,-j $d e $o(i v $}l0j R $c]*zoo! <i ½ $c]*6o! j ™ $c]*zoo!a i ½ $c]*6o!a -j ™ $Ǡi:HxH,r  s t 0K! x $Ǡi:cwH,r  s t 1K" R džTw"j x =gc]ڽwBR ,j x =gc]ڽwB,a ,-j x 7DwiwcZr  s t aK" @x  8i &  6j   c]*连!. <i Ām  c]*㤿!. j ĀI  c]*连!a i Ām  c]*㤿!a -j ĀI  Ǡin,r  s t 0K! @(  ǠicAn,r  s t 0K" @ &Bi y &wBj sy 39c]BBR ,<i  y 39c]wBBR ,j y 39c]BB,a ,i  y 39c]wBB,a ,-j y 7ǖtiwBr  s t aK! sy -ǖtiwcBr  s t aK" sy c5 oqz { c5a gqz { Ru>:nc nȣ 5 r Ru>:nc ֜ȣa - r S=c  b S=c a b r!c<0: ȃ r!c U(Ba { }(c  ` }(ca  ` $cz;0 \s $cV(a Ts  c y  ca y n-5 i yw tc`z { n-ѿe5 j yw tc`z { n-c]*οhx5  <i @yw qc`z { n-c]*x5  j @yw qc`z { n-c]*οhx5 a i @yw qc`z { n-c]*x5 a -j @yw qc`z { n-ǠiO͈5@8,r @s @t  K!  gw pc`z { n-Ǡicp5@8,r @s @t  K" gw pc`z { /?iMF d&i t,w ifH =I /?iMFA* dHj R,w ifH =I /?i`c]*F dV  <i @Ew b fH =I /?i`c]*{eFV dV j @Ew a fH =I /?i`c]*F d0a  i @Ew b fH =I /?i`c]*{eFV d0a -j @Ew a fH =I /?i=ǠiwFW dr s t @K!  w `fH =I /?i=ǠiFb dr s t @K"  w `fH =I n-S= v i yw to n-S= ˿n j yw to n-S=c]* ȿqv " <i @ yw qo n-S=c]* քv " j @yw qo n-S=c]* ȿqv a i @ yw qo n-S=c]* քv a -j @yw qo n-S=Ǡi ֈF@b,r @s @t  K!  gw po n-S=Ǡi ֈcy@b,r @s @t  K" gw po ?@.i ,w ~DY  ?wZ@.j ~,w ~DY ?!c]𪝟@.R  <i  Ew dP~DY ?!c]𪝟w@.R  j  Ew dP~DY ?!c]𪝟@.,a  i  Ew dP~DY ?!c]𪝟w@.,a  -j  Ew dP~DY ?ǍiwI@.r s t @K! w d(~DY y?Ǎiwc@.r s t @K" w d(~DY n0  vi yw i(X n0 nj yw i(X n0 c]*qv@.  <i  yw b (X n0 c]*㤿v@.  j yw b (X n0 c]*qv@a  i  yw b (X n0 c]*㤿v@a  -j yw b (X n0 ǠiFn,r s t  K! @gw a(X n0 Ǡicyn,r s t @K"  gw a(X ?&GMi =,w <1y ?&wGMj ,w <1y 3?9c]GM!R <i @Ew H<1y 3?9c]wGM!R j @Ew H<1y 3?9c]GM!,a i @Ew H<1y 3?9c]wGM!,a -j @Ew H<1y 7?ǖtiwGMr s t 0K!  xw HP<1y -?ǖtiwcGMr s t 0K"  Hw HP<1y .~5[ z { q5H z { n-c45  =w tc`z { n-5w c`z { n-cf5 a =w tc`z { i[5 8r s  t Vz { n-iO58r  s t "w r@c`z { /i)Fd( H =I /iHFsd( ;H =I /i`cFVd(V H =I /i`cFVd(0a EH =I /?iF d?w fH =I >-*^ }w8*# $ li evi`er s `t \i/(( r Hs (t g E n-S=c =  =w to n-S= w o n-S=c ] a =w to S=i ֈ| br s  t G n-S=i ֈFbr  s t ""w r@o ؆nc;wA  /Q uR ؆nc;wA a /Q uR !c?w( Z1Y !c?w(a 1Y ?@.T?w ~DY ~Hc]*^ p<i ~Hc]*^^a pi eHǠir (s t K! r!ֲ  r!10 ! r!3csE֟1 ).u Yv $ r!3cPr=a )"u Yv $ r!iGr (s t  r!i/H֑ <r s  t $g E . Yꪲ@0 Z YM0 @wZ  gc?wP 2Z  gc?wPa XZ ~Hc]*^ pj ~Hc]*^^a p-j eHǠicr (s t K" $Mֳk  $@20X % $3c+sD֠ ).u Yv " $3c+Qra )"u Yv " H4ẹ mi  H4ẹn(Cj  $i:HHr (s t X $i3/I֒ I<r s  t $g E  ^ԽxE0 )x ^ԽkR0 x gc)wP x gc)wPa +x zUtwZ{$j wf g h L3csP? .u Yv L3crPKa "u Yv  pc n0 c= =w i(X n0  w (X n0 c ]a =w i(X  inr $s t ʅ^ n0 iF nr s  t ""w d(X }fcBwvsP Ud e }fcBwvsPa Ud e 9cHBP eDy 9cHBPa Dy ?ŬGMQ?w <1y  pca lj fcfc`I``>l>% >l>% I& M' 1M( Mxj?8 % >-) >-*^ '-*^  >-) F)  >-*^ F^  '-*^ F^ *YB:YPpzy|xHJmJ[lax|{xx{H* `olu|xwpHlw~tHZkwaPʟyz*YY9wB:Y7pl)wtZiwayzzyyJJ)[layzyx{Y* Lnlt|omVhpsI{unal\vzytIJYwpYsIw̋wyYZpwZHHVYccYYccY}- :} - x- '}  p- x- x- AM2kMYN@@S@S@@@S5555S@P|$ 'P|$ W$ P|pX$ W$ W$ UkFy UkFFy y UkFFFp"y y y B$wcm~FITf%N|pXH~SW_B$wm_iW_S6ؾƦ%TFͅ~6ciJ}  ! !    *}  fy+ , }~~{- . W ǽDf {p\/ } c f f@=)E F @G @ E F G  } c f !)  E F G  } c ! f)E F G    xg/nrvxp]k6@6HPHZ}[~֑Ȓ_>ӺkeppzpuvYw HM' ( 0) * P|$ W$ W$ W$ EŤ*40 r1 Ou~}}iСyv!{z~~xJ] =`{~yՊ拥trtr|`T^VaSɌ/`91B2 >,q3 RvtZ{{|!wzZuC٘\\4 Ũ5 6 7 ~8 Pv91 HŤ*4@2S3270_:r1 ?@ciX|jbrpċ_R:tFrfI,={{dc|mnwmpǡcXE\IwG PaGܰkfدfXaMaj|ukrmw~v||ngQ]~mtwo2v𓉴>C|}yՋ拥trtr|_U^UaSʌ/ L\2 J,q=3 tu~vy)e{]uJ٘\\y4 Ũ5 6 7 ~8 n1: l Lz$FD T=E  (bĻF &BlGG  ˝vwK#$JA5[qE }ز& ^k B)`crp}}zoYZ_rysg3%P060 Rgً~}~2@+ Va0]iFNcfvumtrvkΠngkp}}n`c7c &^k( Z1J'%N`9qyi^\qJmkV‹Q ltgclShws4UM金=&QxebUzlO:ZtyYttYz@}ygO`{ċ?یĎԌ‹:RQzgopsuqzUmylý w* q{=:ޒ}htBzYy}ٸGS[dbS_#+ܫZyn|whòioK.+<#d0l}z|||U}zЌ*1NjՏ{y|idtdu]|d0oׂjoctzbyySkTf( kK&O,l l[Bq*!BcuRP=qtpFKںQyI( ;pE=O:6VM{gyhTd|u}ytzh|p|| OpV$28YZT(-?F @ ?X n'j$<j74켋UUvZU"Mv+j|rG;O`Ābh4U^مyh7{t rWa~@{tCp}wzzsumzm|wJ)K\/ H I J bK8ĻY|F 5/ H I |BN ІX*JJ F l 4/ PzB0J  c  J / r\oNyS T U V }>fu|w zdJ4V4b{Hum|~et!wd}u˳׭ts>JxGus|{~\grvE}t K L xM e} }tϋ `"OdO1W~eun]]x2Mk}=R[_qZl$B]2˥]NNs7ː˱\e:ȺtE!vzӪTX8" j ' G)Zb c ,vm_x§ʽ<&QxebUzlO:ZtyYttYz@}y,БA Q0&Srǀ@8Q 5Ë6 j`/R;H" *L[9`ċÑ\jh訟E뎀}l^Q=VGl8u`-싀@j@O|2,38pXQ:",m 2v9lDAw 4߀W}|w)lk>2?{ p@y(/ s7,Ý߅ !WֹًuE | Ww{zgN}~T>K\ȔC{}Ƌ94b]ohxd~ubglh~  zf֬ a N O P ow.nn y Q ȑvI(#J#~dzhg}d~}VNOvxU =€>z]cqQ@R }!ch4jY@&#&~dhgd~}p-es{Urq1M W ZˈmEoqT~F ~ŬBy }B$\A) F%!D5(:B%f{}yymuofuzjSmt~\$"66;  ˏSi{ufoumryayX$'\ /i1F嵸d  oH =I  S2}skaG{~袆yhk}rnqsuuz)ilrcikpd|3yZ ǩdz|WVhhthaoRVjӋȋ]NPA.g5z߻yQlS}NtgZLLcϳ_x|Ћ43.^LLG~Xo@TH]֋]Ns:E~{}q|l{DrjX#Q lR / YZ 'WZ Z iZ Z Z u{mr Xw(Z |r q|lXZ r |lTZ XZ r |lRZ TZ XZ r nlWTt 'Z >t nl2Z Xt ʆnl3pZ Z Xt nߪ߭f] x^ |BN m3e O 6P {%Ips_ ` ha r! 2 舧! m  ,! 8   |! ## p  |4!#J# |!!#hX   |!!#d h   R|!!#b: d h   戧o  `G     戧o <b ` !o <  ` Hu mW x }*Щ^ ͈  8 >z!D<4p  d h cS (4vvwX:PRc؆~c>RRPRɣ@.jesc[aMYiiz{{{ige[sMس>RRƅ(G\ؠXRR>đMs[egi@{{z.iYMcVige[sMس>RRƅMYiɌRPRR>c~cRPsej(2vvwXhjesPRc؆~c>RRPRɣiYMRR>đMs[eginO ɓȦybGGFFGGbyȒȌjr5(\MNώϡЌFuGG`bypȄ)r\MNpϋψuuЈϋpNNZtOopȉybGGuFСώϋ`NNZtcsejV?;C˅4glr4gmˑsejɌ˘˘r˅ɌRPRR>c~cRP(4vvwX9PRc؆~c>RRPRɣ˅ro˘R ˘Յɣxfjes 4g+ro4g˅CV?;jesc\aMYi'4˘4@˘6>@MYiz{{ige[sM4g6>@4g@4@C'4W?@ige[sMس>RRƅ(I[ؠXRR>đMs[egiW?@'4C44g6>4g@Ms[egix{{zfiYM6>˘4˘'4iYMcS c[1Mkh  )s3RPRR>c~cRPX)#h-_< IԽ k K ͐Yۍ&% K +D k I(w@|1z{{t#WRlJE ijؑ>RR !乚 W 9kVz{{Z  +C 3%^{_;c[@2z{{@#@;@@@س>RRƅ @ ;@܀_Vz{{[ +@ @@_@(2@@ F@ F PRRRc>~cRPą@ Fl@@#bi J^ k K@ Y&@ K k + J c8ƹƹ `B `BbX< mPZ dZ Ls3RPRR>c~cRP L` d mP4`B `BFe /nVb 7haTG (4vvwƹƹV GTaiT7.b nV  e`B `BN4 m %il !􌋐 PRc؆~c>RRPRF l} % C m~<X`B `Bc8ƹƹfX`@`@@D@(س>RRƅ[(ZD@s@`@`@ b@*z{{vn@ c(I\ؠƹƹ c @@nv{{z.@c {`@`@@@@"RR>đF _`@`@z } ~ Ry}YH ޳o (    oި (]zUtZ]zUzy\X\v{YtxtYzXzUsY^zUzsa||rr[cvdxrS?Q^gdv^My~qu_[y~quc\. \w *- hz/ˋ\CPWSLMVcŅE8h`gmKCEɋFQ[a:$B()/6㋺ܧ?P܋L/3\ ? % Nxt& u@  % #|nnx( v& / b0 QK1 4% 4xm!& Ri1 1 4% ̈unx@& `2 1 4% R#nx] & ]3 @4 5 Q1 4% >I1Xx. & @6 @X ^@Y HRg1 4% Q1lx: & j7 Q1 4% }rҡx)} 8& 8 Q01 4% ߈zx2& `9 1 4% ~p3x=PES*& w: ; `< = v> `? aQ1 4% N9mx5t8& `u@ HC1 4% |qbxMO & / b0 a 2 2P% w}(<(- po1 }+vc- pU'2 Ro]D{- 3 4 5 I&VXD2- 6 X ^Y Q&|Ŭ~- (7 1}g8D- 8 +}M- {m9 #}PES- r9: ; l< r= v> l? 1N.tB- @ |c(n( @8- / b0 ,K1 }(m<I- ho1 p1 9}(unc- 2U'2 L1 R(n]@- 3 4 5 ,1 I&(X@S- 6 X ^Y &Rg1 Q&(l:@- (7 ,1 R}g(ҡ)@- 8 ,01 L}(z- 0{m9 L1 D}p3=PES - J@9: ; I< J@= v> I? 4Q1 RN.(m5t@@- @ &C1 (|c+bvO @- / b0 4 2 qxus5t& z {  o% [9{x,Q@& T| e} ~ _;     ^% "}*vxЩ!u& |E % M{x!&  8 ^% ҈u>:n{xȣ& ; p ^% L:n{x & ^  % D~(zvxh@& L]     k% rS={x& a  % -!{x"& ; eW% -C{x"& a ?% *\C{x}&   m% Ȉu{xm& _ c  % z!{xcD<4@& b  ` a  % J}!{x߾_@& a b   i% Z}(vx!& P ` % Ȉ4e{x(& ^  % drvx!&  c % }vDS{x4@& ^ q  V% }B"& ^ % x*"&  3v% w**/jNZZNNZȼZNhibbiibbi'TF߸UhÝ!I}ou{wujj{m{Xh}4Z{z{൯ଋc}yyj||x8JE=bluvxbW&rZ[WpoZvIW@z4tlKPiifvblvv}__ mRySz~cgoiޫ@lZ [ A\  ] 8^ Xw}_ X` 8@a ]0b 8@c d e f g h i j ƀ|!k 8l 8m Zn $o p q j~r F s 8t u _}Yv~uChhzݫ\u6~y_{p~![~q}|}q"  "{}I|h ~{ {||{}~zu~~w~|uzq{u{ ~ӆPvxx~wxxo{kguc}x}}Rt}pqokNNctb"P|xszl.F|ralXjrd_r[{|`u`z"Pyvh v  }||zrk{}~_M_ gSySzgިnpʁlw L{,x Ly z  {  |  B}  ~   ,р  LB  B    hvg   utor   .   vm M pzz|L   R LJ  c v]VPlg[cmqŇ^8t`jkVdƫYQw`[AcT)GAċVaճjGRldyXO}Rvdwԭr[r;j@@}~}~xw@@{py{jyyr}yx}`ta~~|ˆxx0we|z}u+v}q{u!~{~Rvxx~wxxo{kguc}x}}y}ra|xo z@d~y ^{p~$![~q}|}(q  }0dCkr{{îÞ\vguhr~qyW {xsyl~}vmխXt}pqok~{8@|w|~uxv]c{m͍m~{pw}~Zi{~b[Xgvvxx~wxxo|kguc}y}u}ogx{|ez{8X~~i|ralXjud_t[k~usr|u}%X^zyviv X@0{ys}Rv kTdwwg׫[r@`Wyzx}w~ra|Ztscs~Շǁ{@  ~jqk}TfM$ osg{|`u`z4yvh( "@h}||zhF $ { p~"n~y`+p}krlk~qzr|ttu~s{}}~ xx|y{|uzq{uh~j(~$4vxx~wxxo|kguc~x|}Α`~v|qpnj~{c|`;n*?*"I+vhyjn_ĊoMzuon}PmWz\̋_vw}qԡËfOi]cdfl_dgm_n*w*"Ktn{YZx[`Kdhl_dgk_ jåwTF߸Uh<`bMcu퀪viszxkXe|kp}r|wh4\*:4z@͠{oyyyz{|s[uZ&dWrqx}l}ybhjb퐋]jp]gaie}~LK|}}~lwqufkn'I{`jbju{əQvuvlvzƚ˫}l|twh4\4z@vZop{oyyz|s[Wu[rZ&WbdWrqvlbJ8xl||yy}}ybh]a{z{Z4ie}}h~XLK|lqrUwpAV rUwŴ,W 8ApAV V 8AŴb,W W p p `C Y?C  - - x- - +# 6C Y?C ?C Y?C # C Y?C ?C Y?C ?C Y?C cVutu)w Y͋3&%S3t9I@PԢ <` 2- Ѫ` xY`B `BsxR;AcNV|34g33ٙg3ٚffœ3S3G>c~cYœ@@ƀـ怋@@@`@`@. w @: 1NW@z{{no߭>  F8] N^ wjPP6咭kj{Xpd:X}zkX}zzptwwtznur߭f] N^  >   z.-t{EZtyYttYz, Y bN;p~-)o`cbUzlOV,,\"/gf}ygO`ċÑ\jh-\M金§ʽ<&QxebUzlOAᘋvTgyxo`V\p=_Gm }Ἵw2!|Zr{}y~q|trVpqo4.nl~uzx|pVJ`loru|qvàZZwsoa`>݌Wċy;}˻[w/75*Vu{xve~}`AV|~|vz|W.~ȋý{wdvu~۵>_zUg^zUzrgRTzUbcUz{]X[yYtt]jMR`quatx8zwtwtۋoCuw_ўV~~yy隡~yruZJLRcltBkj{Xmgpuwwz_cY`pxw$,w8zwtwtʋoCkؽȹÝ~kEVUz\`~OzUe_}Uz{]VYzyYttYۉʋh~wxM{wʋyV~~yy靚ywuvAWʇØpjgZy{ZYU\|~kh{Xx\ptww|%w_v̵͍G~䋭ًw8zwtwtً\J^_cnSNAA8^[Wng|a{[vĊT=!NtlhW}؋4vvٰwxv V}{|yy隡kdUNSF}|yx.  B]CH+}xtiZ|vt3X2/G0H5)'3&WS>J,zzR{T:6V;VJ>㋺vrltYn+%d>3M-r)Y>rqtm]}n\݋BM)j|w0g|S|kY.2%yq$fzt~7z@sH~SYttZ{#}C0|rV'ldF</=z~;,_M?zj`_fgyzwn~l'q}Sy|tًzsad^Io^|vvj0;,'A*#0C;>XL\v{Yt‹‹bV2VJ$>CGXnp{tsrltsrzy\v$W"}A[~dhhd~xsm䐖^\infpov]Oğx}lzše^\]vh#Y+d(j3$ȖzstxnzzszxO{gk݇zwpmgplzn`"~=UH+gN0zwgfislzmql~| ˻ B wW}@U~urffwypfI5}?X|?H~zqII^\inepo(v4Fئzŷ mq^&x**5gZ?Fm䐖P~xhht|~yr~CM}T'D([e:+ ޱshTYdT{|Z^,<Jc󘋄|}9-7 cٵhw~VZzyYttY}͋ʋȋދ\{tu{nFOzU`]zUz{\c/w otwwtvws~vEchhc~}n}mNX)8%*.DrB zpwwzozz}gGz8H+/TK ^ӹ6gzslpiT[`;4=b}g_ y25)77/9*;T*B싙╮qi\m-q-t` qi^r1N孔dU>{luc{vtn9}c@g@Ymwl Aj6KVocuzؼc(Hezkwtzwxkwy}]pP a}' qvȴᴫ1_`c_3՜scVpe#n?TAŋ(,d[{lh8 tA}  f_L r' 7L9%$moqstF|O\nȸq+wvq y7xxvvw|xyy|s{x$~z*h}~tXr~cng}EM7oxH z@A !+"5@upQ, |Z] |r CRBs@M[Rӭʘvakyy~ysZ{8^tn tn qx~UG@ʘvakyy~@:!)CPNAA8^[Wng|a{[vĊT=!NtlhM@J" ½ Nf,MbwJHRPg{}{˃~knoykv}_swsxZT!Z 8=v0p9ki8=veepk9sx8\4"[s8~~yz8\eC[pzwy~~~8A0tT% l% @f+u& g& J} cϾ N)jazjjSSf5XZssvynk~eLojͬόtzc MxjEMxj eyU]AAA m rApAV rAŴ,W 8ApAV V 8AŴb,W W \->1zUg^zUzrgRTzUbcUz{]X[yYtt]jM'xN\z||qyyopvvƋЋ8zwh/bkj{Xmgoswwu[hQm-)$ bhkwr`s|k{ƨᚸދ`JL;]xx\8s E}H73Czv~ݾ;>5\5"TYiV$cg~oy~|} Ό,2'I{wlutu|a{[vMOo ~{ХvvwK]@[Gp^wuy׋.ACiVQgs|jsOu~y|{ƩP8ࣲC|~yxpwmazxW^{_gm>eαf7Zf&"0*6k=^p*[G]ꮕ|{2$Uc‹碖t~p|>dyv'R`]1fzozjoruzXpdm+kLՋxyu~xnqy{ufVeovG;>J`ٸ/lɋ ڲR\]z " uyx~|{w fs⚋!/ V++݋4M^X < uyx~|׋{<(]S$ )I=І􌵑݋2]'[b =ei|qyyopvv\-ʾ] '+   " uyx~|{wt​@@ V+,݋4ML-X f +  < uyx~|׋܀<@@@$ )I=􌵑݋2]@@b =€|qyyopvv:/w q wtvws~vEwj]/3o|o~}notw85=K}}}f1׆TG'',!GʋtKXc^jhrGZ|t$ptwwk(&WTT^qhd|}-; (vV5c[[JdfYg{p~ڲ͋VNطËZXKTX}hj^mhlnqvNR`quattYXzUg^zUzrgRTzUbcUz{]wZw} K : >ʩʘvakyx}ug_r:kr|ut咭kj{XpdReeVUm҈͆v.olI P@fgiMX[yYtt]jMR`quattYXzUg^zUzrgRTzUbroNީʏЋԋtYlO:ZyzUtZeUz͋ʋȋ~vvt{zz{vl{~t{lrtxvzuz=VzU`co`# AC -p;Xߋ}uzK[mmYttY먐wI)kZ~iwÚY.2%pI򃰋sdwߜ@HýzUgfUz`q~/x!|@CWW0zrVЅ$zUb]zUzvb+NYD\oyYttYnzU`]zUz{\K[y0c~s:}h~HLowzygf_`jzk;j_x_x `s}xtZgc~g<\~s:}zcep`o (Ⱥȴ|hȤw\LqiPutqh+  t( `y  t  t r2 Jr2 "Ep) Ep Ep P Ep$ qd qd p"p cepo~ (tuPҖOv@wȪ}x~Ⱥ *N )p " p 2p  pniz$ p $ poouo$P p $$p $`p Pdp !p   pV 7v/Vw(USnj_tdvxnqk|u~{R; ɑXapqr|}TG'',!Gʋtkptwwk[[JdfYg{p~ڲ͋VNطɋZY$9 *}  fy+ , }~~{- . W }vvwwsvq[vc0__wx_kr~srl}Sprsipzyvh @ 0{z}og~[~z||YFYgc|zsesskfu~}tuP~}ḽvqn~oy}x{Pj4|w|~uxv]c{m͍m~{pw}@~Zi{~b[Xg~vvxx~wxxo|kguc~yz{ss  cugr~qyW{\dҝsn|0z{d_t[x|s`yze~vz<xxuqus~}{w|y}zpl}{Lyyz]<u}j~~\Uxj zt~qi}p{q y{z~~yqQm~y{f |s}y}s}TWz~~}qyWot~tx~vyLzqn>zvxx~wxt{{yvxayfz|v'iFZ?d0tcjoj:K_q}||aHM^@?uYmziu蜗tkqSY=nuz{_y|ͅH ,  v}69Z. 4R??*(".? (d  Ȱ ]}1Vp q T7  P == Q&}p5||~5HD&2 A-;A A-;;A > 'RI~wPOPO]-]-ɩ{ny{y~k 8+Q_^^_ ` H K W M-M  g >u[s znnzxp]0 P  K- C uaPTx_ċ^WTgr^jQWv±‹ɋNM7-ml?E6̅|rc~Rgcefnu94æ΋T'4&ly>efиwy&"*H6ٸċKIR,hZTD$Wt~zز:>8BL8iuvtnuR-]xwQv{~yrl܇Ñ݋2cL{mċl\  >ewO @ sދ䫭ì̋싿iD^8Oș咿9KN{v~w}_i8,;7A'oܻ[NZ4B{wmptwwtؕ ~؋PM}п2 ++ + + W60:@P;6FM^^1 M2 MR]13 4 5 MI_X 6 X ^Y MQ|Q7 M}|}8 M9 M~PES_: ; < = v> ? MNt2@ RZgrZyQy,u|{|suumċlvs{TRv΋ċVE 72ml?Eꋾυ}rc~Rhbefiu}̺r\P+Bp{Refwy#%*A=ٸċBS2FTkB}ZTD$Wt~z9?=TG&iuvunuR-]xwx{~y~|~}؉Ñ݋2cL{mċl\  ReO : sދ䫭ì̋싿iD^8Oș咿owQ|v~w}_iIv in  ݱ ~ /  ;w3;< :w A== ˥' *v>mD9 3Ѻ    ~o zŤ*40 r1 ;Q ~F Pa   v𓉭>  A ~ 4J 5 vrR }ţ\_* è   w  u!ow S  t . 3g踜 c K 'ӷ˷t: ; K ǃFҬ!   =ۭi ]  /8l ' <{L-ٽhz _l z  ! "" f߿ oB 9e Ȉ 0R ,H6 2}ܿ pÎ p v̬ x i6' p  nT kK Cg/ )k , 5~y5~ x { }fN O P &䫡w.n Nο7 &v řv =E @: & Գ" |o =" h>T6 hB  KoH I n^w  5 JJ tj^w~r { ~ ʼnB SR ϋLe2  &T󟅥\`ȉ    w Ȁ aSDw@ OQ  F] Q, |Z] g\w?A  wB UP LC aM> xX4 l l! Lz$D T=E  O"['6o ܖ ȋ@( ⇩bĻ|F BeGG  hzB o x  vy\Pr 8v{h ` vq`? }$ݣr Su /m߽; Ⱥ /mH; fWx`  `  Ⱥ \ [;@1 I #$2㨴.   ʼn    ȺȺ  *_Z(w@Zh9$~w{d ! d" p# d$ p% d& ' d( h) *U^] w@[c* + *, - ). Y/ L0 I1 2 I3 J4 I5 6 Y7 ,    $ } B_ /l<| 0   yQ O4~/-ոʹ߹+ z { -PgRW { r-n`>I in ~ ݱ  /  3<  A= ;'; ')>m9 |Ѻ a a ,A ~@ 5Ť*4S0 r1 &;VQ #~F *Pa*   3ۓ>W  A 1w ,4 5 .rR 2ţ\_ è   w  :!o S  , . |g c K 'C˷: ; K ,FҬ  =ۭ ]  /'8lI ' <'{L-ٽhzl _l z  ! "- f(߿D oB <'z?4ٿ ~ g'D0ڿ -s E, ]w(z  '>9e7 'N RO ,'H6x 2'}ܿX pÎ p /̬. x i/6' p  n, kK C'g/# D , 51y51 x { }/fN O P $䫍.n@ N,ο7L &-< +g ='E '@: &'  Գ |@ = hT6n hm  )Ko)H I n+^r 5 &JoJ t-j^~ { ~ &̩ SR $Lp'#  T󟅥\`&    w Ȁ a$S0-@ $OQ*  F] @Qȓ |Z] g$\A $*B U%P L)C a$M.> x)X4 l l Lz$FD T=E  E['6 ܖ $@ (bĻF &BlGG  h%zB o) x  +d\P 8-fh  $\? }ݣ $Su m߽ɢ Ⱥ mH fx`"  `  Ⱥ_ \ [;@ I #2㨴   &p   zȺȺ  *Z@Zh9~w{d ! d" p# d$ p% d& ' d( h) *Z^]@[c5* + *, - ). Y/ L0 I1 2 I3 J4 I5 6 Y7 1    $ }G B_ l<$ 0   yQ O~/-ոʹ߹ z { -PgRW { rn`>I in ~ ݱ  /  ?3S< > AU= ' '>m\9 TѺ    ~ Ť*40 r1 ;Q ~F Pa   ۓ>  A ( 4b 5 rR ţ\_B è   w  !o S   . Tg c K6 '˷: ; K6 FҬ9  3=ۭ ]  /8l ' <{L-ٽhz _l z  ! ": f߿ oB 9e  QR ,H6  2}ܿ pÎ p ̬ x i6'2 p  nl kK Cg/  , 5y5 x { }fN O P 䫍.n Nο7 &  =E @:- & 2Գ: | 2=: hVT6 h?c  KoH I n^# 5 J J tj^~ { ~ Z SR Lp'  T󟅥\`    w Ȁ aS0@ OQ  F] QD |Z] g\WA B UP LC aM> xX4 l l Lz$D T=E  E['6 ܖ @@ bĻF BlGG  hzB o x  d\P 8fh x \x? }ݣ Su Pm߽S Ⱥ( PmHS fox`  `  Ⱥ \ ,[;@I I #2㨴O   !   zȺȺ(  *wZ@Zh9<~w{d ! d" p# d$ p% d& ' d( h) *v^]@[c* + *, - ). Y/ L0 I1 2 I3 J4 I5 6 Y7 D  V d $ }: B_ Al< 0   yQ O<~/-ոʹ߹E z { -PgRW { rCn`>I. in ~ ݱ  /V d ߟ3< ޟ A= ' 'G>m9 Ѻ]   D ~0 ;Ť*40 r1 J;Q M~FA FPaF   =ۓ>  A ? D4 5 Br_R >ţ\_ è   w  6!o/ S  D, . g] c K '˷,: ; K DFҬ  ӭ=ۭ! ]  /I8l ' 9e I R ,IH6 2I}ܿ pÎ p A̬v x iA6' p  nD  kK CIg/M , , 5?y5? x { }AfVN O P L䫍.n NDο7 &C E =IE\ I@: &Ie ҡԳ |0 ҡ= hT6 h߯ Yg GKoGH I nE^ 5 JJJ tCj^~* { ~ J SR LLp'k  T󟅥\`J    w Ȁ aLS0~@ LOQ{  F] Q |Z] gL\A L{B UKP LzC aLM> xGX4G l l Lz$D T=E  E['6' ܖ L@ HbĻ4F JBlGlG  hKzB oG x  Ed\P* 8Cfh  L\? }ݣ* LSu@ m߽ Ⱥ mH fx`j  `  Ⱥ \ ̸[;@ I #2㨴   J   zȺȺ  *Z@Zh9~w{d ! d" p# d$ p% d& ' d( h) *^]@[c* + *, - ). Y/ L0 I1 2 I3 J4 I5 6 Y7 (v$8 (v$8 x{ԫwiD3g&x}bKbmt|rxri`bWdU~{n_=bɋzg~lq{ha  HK S}עwpSdV{lxeg}`KU4(2j I0‹~ŌƋw}Iu^YLP`PGb^9wʴxuAwt隡k~b{zux5soxspnwwu-{|Փ3 d|_tppCw͸ ODwuzN7aru~IKzux5swx{wtqd|KI`ywxud˰[T0!  pv}}x{EHrbr|z{P\w}t{xoUZ,{|̛rvwt؋oh0 ɬɖV"5RJ@fqـr%?)= XCm||-|{OjwXk{iutlo/LHu~~dy|\;k# \;k S5s dm`^4 5 `6 ~ a8 % yv򴗼 d+ , S5s! pG"  p k-;;k -; a,- a" W h   \= oo d&  O0 M^^M ` E P1&- Q. W?R0Cϙ{vzz{u~s|%:4hԐx|bvouuHK&+Kz]Aze=X`UO9I-A"$>s6X:&:41W6 }yc4[iyYZ \x{Wfy`֭h[nqxpuzvI!#J# |4!#J# %wJ9 M^9  UWmf]z͋s~|eJ]^Xig9_LCd)1Z:w_{<j Ⱥ  UWpcJEqx]5:6[yb;_LCd)1Z:w_{<j vhePGNj'؍ X(v3)%"偑ǣЋ;'  0j!(W F cep`o (Ⱥȴ|hȤw\LqiPutqh+  t( `y  t  t r2 Jr2 "Ep) Ep Ep P Ep$ qd qd p"p cepo~ (tuPҖOv@wȪ}x~Ⱥ *N )p " p 2p  pniz$ p $ poouo$P p $$p $`p Pdp !p   pV eʹщ}Txyش|wWZuxvxt xk-{zrw} $wx`m:  $wxv^; $w`m: \: $w>^; \; \cr b>wϿi b>wj *< \cr pu Yv \Ժ! \" \cra 4` 49` dU^d©~dh`rIrfYSj҂fv ϴ \cra c}w8*# $ Z r! 2 rw s5z { o[9 ,Q}v| e} ~ _;    q} AT*   $ 0 Ru>:n ȣ+T w pSV S= Q |F> I g r! 2 ~\C  4' >z!D<4p  d h }!_l t  f0 ʣG8`2 x`b `x` ` x`vzncG09` : =` }(r ` 舧q {0    H4e (W uYаO = > ? |H| $ {  @o    ʈ~   h uYаO = > ? ei`Tr s `t rw \;k# \;k S5s dm`^4 5 `6 ~ a8 % yv򴗼 d+ , S5s! \cr b>wϿi b>wj *< \cr pu Yv \Ժ! \" \cra \cra c5a gSz { Ru>:nc ֜ȣa -; r S=c a D r!c U(Ba { }(ca  ` $cV(a TU  ca [ r!3cKr8a )"u Yv ) r!֑4 E . $3֒4e E  $3c,Rra )"u Yv # c5a gSz { Ru>:nc ֜ȣa -; r S=c a D r!c U(Ba { }(ca  ` $cV(a TU  ca [ r!֑4 E . $3֒4e E  x@ x@ & ' 1( x@ ~w`GgN|ptww|e.ӳ^PXxSTL焋~}r\~zGD/| Y(O$}<Ǩ]]€  @ € B   \H`@|yr{{qwvM{P[[PP[ƻ[Pwd[[dd[[d^2 :2 aOpttooutprC   r! 2 U% @ A@@}yy}~]@÷ufzzz}@4@ U% u, ѕ   <FXj-Zt$6b|r*r]p#FTzPp  f v CQ:&ePU8\-i}X3 J !`"e""####$N$$$$%W%%&F&a&w&&&'(()*+, ,9,A,Y,k,},,,--:-b-t---.V.t..//*/I/[/m////00^0h00151112V2s22333(3:3L3^334'455d5556616G6s66677@777788999'9m9999::K:d:::;M;;;;<&<4>>>???@9@O@@@AA>AuAAAABBLB^BpBBBC!CMCCCCCCDDWDDDDEUEnEEEFFLFgFFFG GG-GIGVGcGH H6HSHdHHHHIJJK K\KoKKKLLL!L9LKLaLLMM2MTMfMxMMMN%N-NENWNiN{NO0PPCPNPPQ QRRRaRoS\ST"TCTPTnTUU>UWUVOVfVqVVVVW-WAWLWX.X^Ϥ!BoJ\ƦަIǨ ( h{(߮7~ݯ:Nf~ΰݰ)b_rʵ9_˵ٵ):HUftζ#1BWF6ajppjjppj Pgyyv}⋿{{~}} 0U+5/3a8 -HKy5_^tȤڲ Pgyyv}⋿{{~}} }D>i>>(ҍ|DD"L>>D >#@D҄{D?>>2cDD> yBQ/ } lrqmyq{t{~ hmoqnk h[nqxpuzq{EVm` ϑȕǔKKKlu mrrmmrrm Kz|| +. ' *  ߹58OW99\ b]pċ_pQedO\ ƛxegre/֩cK \'l\:-uy{~opzzˋ΋凙 >G;voeVufy{nqxu~xy ՗Lk+dmXpzb|yڲɋ l/ ٸ̋`J 􌵑݋eG hpoYQ}|/wc|zxztUUz|teMH!Fb@~v SFf]u|RNZvjuz{~vn``zy{ 쭼ȹ岏k'AZShb;-) 4 K{v|}x)2cenrhrmn f]QVbbSLaǥ  BA93]?<]\ [qAa96O\E  J]]\Sb`h >0CUr}}bV^ȼG8cIg[aS-RyЕ  =* mrrmmrrm  BI\w~o~A\x ynQ  BwmI\szA\m ztzxpnϊ[Injoo}Lkesi ^vv{~ fSjaj /~ tcjoj:K_q}||aHM^@?uYmziutkqSY=nuz{_y|ͅ Xo[||f>5=I= ͋ʬ9O ?&Q|ebUzv[V[oyYtŋ {mB@RQln}cs^q qX[E0)<7''狸buct~weyySkV>&VJ!0JNjԔÏ} RǼ"TB0@@ S11TC"p&`bUz{[V[zyYtڋ T}l{tu{n+hvtu 0Ek@z{[V[syYtƋz{ky} ~~Y#^v ʇ 0 FmBzlO:ZzyYttY}͋ʋȋl{tu{nsYa vzu 0Y[=.ZM6 M˟{gyhTuZ|Ȃu}ytzh|p||jr>R2#/ꋾf{ x~v| XzUg^zUzrgRTzUbcUz{]X[yYtt]jMR`quattY X\oyYttYnXzU`]zUz{\ z||qyyopvvƋf-zUf]zUz{]*xN\ tR`ؽȹÝ~~/RUz\`~OzUe_}Uz{]VYzyYttYۉʋh~wx‹Ƌ zUtZ_}Uz[d_nyWyuzgqt y{j&I |w[`g|S|kY.2%yq$fzt~7z@sH~SYttZ{!}C0 |rV 2$\wdttYt+}N Rzrq4Dk|wAxC={xtD94@b{lettY}-or _xŒuzN[ R4$Eo =HY.Bt 7I 4R??*(".? ( bN;p~-)o`c bUzlO:ZtyYttYzq Y Wmf]n닰ts=YHYld9_LCd)1Z:w_{ 7 (. 7@,:=A' §ʽ<&QxebUzlO:ZtyYttYz@}ygO `ċÑ\jh-\M >QD/jwیÎԌ‹F: QUxȁwgSt{ԋ*+RX9ˋɋËjQ|~^K :;4;W\TJIEc^@ \ˋyoq|||uw}xnoi}ualyeuy[[ovYttYn ztqkn{mzYX >-_0M#34zvolfnmzx[-&G'/ ehqzy{s!xzwac]^lzqfKo`ܐP\zqZd zn`"~=UH+gN0zwgfislzuil~| ˻ B 5pzrkjqwqzzw~^-_&j3$ȖzstxnzzszxO{gk݇zwpmgpl mpsz|~y{w !0tzybcYOjz~E%`~|0aWHiiutpyB}+rs{w}xυtedm/szp[d [opYttYn(ږޯœztcbn{mzrz~uiOxkl\yo|/9zvol]bmzKs Tep 򋖋~oI[l[\Z^_cnTNAA8^[Wng|a{[vĊU<"NtlhW} K|zK} odWeK_dbSq xh|Cvzuyz}} |l-pɜ c{~sr}}jsSqlwz&qh~uo z;RX^Vek  ٘ad>HWx} hxd~ubglh~ʅ Va ŋD'bgo "-"*NjޣЋrYMoZ>ڋ{J|abR fdI$F- hxd~ubglh~2(=LyUq hxd~ubglh~ Ћ~nnnb'mvws~v<xj]*3 vws~v<c~]*3 hxd~ubglh~fu alvZ> ڋoV|}̅abR"-"*  v}rzpetj}|s 0_^icvX~drhgrd~tcglh~~hlglh~~hl~drhgrd~sd ~hl~drhgrd~ubglh~ phhWtopo}h|ppswvm~drhgrd~uc Z^n%~mhgzd~~gckn]gtysw~d|hgrd~tcglh~~h/~~ ~drhgrd~ubglh~ Ћ~nnib)m ~thheht]i;c0~(}mgd~vmtL{-u~rh~~hÌ*$ "{ -I.oh~~ hwۋ  ~dhgd~sc`Wcc~~bO l:b>TekY vrnaodM glh~~hlČxz{{w2Mz|@k ~dhgd~ub-N^D/` #~dzhgsd~tc48% ~dzhg}d~}UkX~dhgd~}p4es:] {~zirg}d~}|t<|v44W~Z||l|~uu%J"~|\||t|~rx`4bz}h{}Z~py=W& ,2d[glw~y~ocxu 5 ~dhgd~riG0Iv~dphg}d~g glh~~hl~dhgd~x:///{~dzhg}d~}X(tp pt_TJ d}wtG~ʋztzr}̋ތx~nnib KScu VZ^ IY]^;/ [ pjjppjjp rrrrrrrr ;;;;;;;; % %' '&&% % ~8CÃ⋨FITf%N|pZF QYyn uzyviH |zy ANMAC[PJ YW[xa__m¹ ~}j ؼƦ%TFͅn4QCS8/s ciX}p-bppċ_ 0 sqp}_}iem _}pdqcsc ݳ|b)x||xz)8 ü~lh rFrrP^tՁ ouuoouuo upr|rrou ]^n]`qba || vzu `& GJa|ho[aciu tngɣ!?]szZt  z{ky} ~Q#^w-l{~xsma msnrzZt|z߻eol; S"0NW.p&`bUz{[XPn[zyYtڋ -;7-uxyrtsv}X);jǻ11 XKC??*BI^ Wl݋o =Hn\};<O;7t 7I5?Q@A ދhN m}͋Ћ ( ~Mxrs{}&j srxjM| me{FwwjG|  Ʉԕ}ih rRrrLA moksmox _`c__df_ .7 ΋ׇ勒{w~ aCk|y~trj].}| i.XYoyɁTwkoqs|{wrn[gmyi{ vgq~xqj~}xunkl3 hxd~ub M}yglh~2(=LyUq fd%I$F- jef&\>?  [||f>5=I=Zo Ã͋ˬ= Xks< Ƌbtzm ]zUz{\X\oyYt ٸGS[dbS_#+ܫ #7pɅZ,#iY';?Mxg}rx|t}Sr!&5{z|AMQ\ Gv,B% q~ caWiǃ0|_nN'O^t|w~ Ox1_0M3zvolfnmzx[uV"T$/ Śywnlix ٙ|rrmr~~}o=v&x}bKbmt|rxri`bWdU~{n_=bɋzg~ q{ r]x} 3Czv~ݾ;>5\5"TSog`oy~|} Ό,2'I{wlutu|a{[v rVx} 5=r}z LEnR q`@yppwsp ynk {si}$Kyx 򋗋je | F| y$is{oj e j||$ ZI C&+IIrּI;i{/Z[E ouunouun C?!*{w zy~y| {! 'L9সۘVUMCxs _wuzէ4A _o 6&$͋zg~ wnwqoox c\gcchbc yX{]}~uo{ ~mxyyX{]} `zrs{'g ~W66WKc~|k NjNjaufEEfb@~ Up~H~~p ٸGS[dbS_#+ܫ  qɕ}jh rRrrLP ~dok}qpn ~ Ϗ^bH{mgfFnNxctzsΤϨی _i|xu.0ad ͋\Or`g\Lw}rxpiO, |} morc)gNRZdi ZϏ^bH{mgPP|t FnNxctzsΤϨی  um\Z[fv~|H@@0 ]wnfYH\΋ۋÕqi\qXd ~ ~{x^t adO\fVfdrÅ{vphx׋`d od[Pe~^e]{Ɣ ~dhhd~wt$s` u\dSBPVѻl|f  ~xhht|~rv~  ouunouun Xrda + 7* 1 /[ '.4U64 S ! 咭kj{Xxd )$ 7 Sptwwt q{ isnc)cNVZ`i Rtz|xck| zszy|q md=WVfy ldymotwݗSe ŋE'b{p vcdENR &C|dhhd|pouwws Kpuwws}dhhd}p  > d5c%{i8^$c&'Y=zw |yH!+P g&x}cLb}vzx|dr`Y zzyxyyzy q{EVm`ˋh[nqxpuz ys}aZekle}|}ԸNM 9:j| 틕xx}gly syn }de U]Vi8 { yn {{}|z}yddetw}z Ht ~{nwyp~q\st|tt~ ts\qY\V_pw gvVafW_h noo}qoou _`c__df_ ~YSѰýruiYYu yn qdozsgeV `ddk_rllgw  sĕwqn rRr`^@ rttrrtvr rvtrrttr ~tlj]Yk|}v} *BZbZ*LMP~{~|W G[opYttYnH6*upfN xvyvZev~XarË|4]  6"K$L\}{v~Ë~}{vfd[ruqt:(5D%!F )\ *vzu x ]yUz{\X\oyYttYn qzxzYH  r|{ C|{OjwXk{iutlo/LHu~~dy|ͅtcip aqsYttYnXz U`x ]zUz{\X\oyYttYo|  8ɘËy}pW\Bn.vGiQEmzU`]zUz{]k|Eivn\Wp}yzËVjMWon}p>[oyYttYn glh~~hl0w\SHE\k4fOHS\_>` mao~ubglh~~hl il} M vd| Bssr}}jy`|t }yy/~nYq{ 8    &Եŋ  56Z^ hX^Y_!\kxNV4iut~ãʟ|y`IoYv[h5\5!TTog`oy~|} %Ì,t<roX|^A >t<rs||^A UZoyYtŋ΋ˬ; Xxsz"zU`]zUz{[ vli \iBXUF ^(J.(:ahv~~q`tr}ӅNjLFFA*AkS` xc~z{}n[k|" nlg\VJ`loru|qvàmiKpq%aZwsoadc݌Wċy إ|Zr{}y~qxm luq~d; trypdpwwwq uc{vtn9} 5)7 ĕqi^r1N孔d U> vq{Zutpoj{n{|k~{>||y~rsB}owefo䘠 mswwt~v2o iogw}r~}|ؗr{jopt_ut4Zw{rv ydhhdy~l NjODbQws|mq~Ü\dcpstx~szx{ adOdlVfdrÅ{vphx̋ `d SY\~chhc~pouwws[Y_puwwschhcp qnk|{n{jVf¼̕tnn[Y otwwr~v2o iofw}r||ؗn{jopt_uu4Zw{qv ydhhdy~n ~`mjht}rb}tQoqpyww}w|S { -<]owwwtȋ ppvww{ yrt uc_2% trydp{wwv k~j|XX| rzv r\y wnuwwsmtz vz xsn>q>vgxssruw~xhhy|~srHF}c`vuo`۷ NVh WW[z___o¹ vsjxl v{vp|#ht  vvj u{|~~| wypyvzyv{jyzu{}~~u r ~tIr-rx~ {uo{r{hz\st a'a.~]V9 !kJ506܋* :< ~v}u}vddetw}z dsy\b|} I12| |\sdnz| ~}y~z}rjjfn~}z ~hLѺʮsfvfgg l}xxr{)g ~wtw|n´jcny{u yncjkbTgnw ne_a Hj}v}}Ǥ, ˒ȔǔKKKlu vd[ xj) xj uzX0K&Sbyn ~ {bXnjoo}x̓Ώ upwzz{y|zutK1; ^xu{~ XM JKz~} 2S3270_: Δ5HI5IDɗ @C^lc}|z[sMCUwS| SvofdhByYkmouv]W9H[߷ų{Kuhuhj unikxniex  X]YRq^[qo n{TsZUl̲d` cupnjqqv o}*}p    ~t ~s ]`G%% `]]깶 G]}`#%%[]`( dab^qx}}o|i~zu ||~~vh%z}~~~ ?[Nyv}~W~l{~OCshp|{X e[hh~us̑vtjyv{|~~mk${~~| vpjl{~~<n} ~r}5/Q[K vvjyu{|~~| nabex|{xlXipy|v}~jyu{~~on{~~on{~~ \^[oY[U} {|~~ |\Obbo ymt\Zq]ly{p}{wx~xtwm}}~Ĥ{s`} nt Iy |xkli]rwz{~|{wt{zc~cRP  BI\w~o~A\x BxmA\~wI\v{ B O`[_1Z{Q:f1=2c[V `D1~fCZ:21cxMV~}} uyx~| ͋ 颀m] %R@,== pl yyv}}LlGx|ys Fe~FQeX~}A]Kd~z  nw|}~~|wz_}a|{z{   Ι͛W} y r|OgM|`~ofz x ~ vy wywd~plvxkv~|zx{~| zt{w ||vw uyzv gvietf~ wtnx{ QiS_s_xx}}xv}|~}  y{xzh}ve  {txz}~ s^xw~x{|  ~ |z{|w  }cjiwwtltrxws`ct{s} }   v~w K]A}XdR FeFsy|xHllnKe~|vx lpl Ɋjla uyznog_gykw  }}||vx}}kk Áŋ fte }~wyyu {zx{t|yw{||~{xz|}kxlp}~}d wzvyvy n|v~vsxw qlp$ k}}zxu{ wxyy{x~wx^w  {|w|} ctb {xszl   &bpv~t|ttwjyyv rzA z||qyyopvvƋ *⫼ލo  _i|x u.0ad fn}~xz~wotv|do>w|xz͚} rzy|otxiomյ %#74+Νps@mZ & <%W^\Woit9DQ0Wm o 3- wr}r~lr&INjxzs}pgv ~~tRTz{{qhxgnk||kx}|y{jp lxuozɋ}{\vakvr" *- 'Iq 1/7U$(: |ssmqwuv6W@L}opmqwrozq rrw'y{pxl{}~E6P~atmnwvn:-ok`xu}|z~1|{~| }ywmqwd}|s2nxzk||kx|ssxw}|zhzwvo}O llnnqx_`[jgcxtro~|8XL3|xtmËʉӋɋyckyl |F}X} U5U5 }Xo}F yt5 reϟqLtp5z y \}|vH BhongfʜU\ {XGulw}vkjl|rz ~q~]{r@o)WQ6 {r' JUʰzywuZlddAMP@ ܥ‹gu}nR4d~w1{~~~}' F xm]vnZ|̾Q8 vjƋŋqys zroRSpOXy} o} qldyukfy VruiokX vh:iqogXi mj:EMW}^V\~gaa fcpiS6ѾؿHQ^~JT` uvfEEfS_~ Zh@:0 €̓RRT ՀA @@@ ˒ԔǔK?Kgr & W X Y Z ` a x y         DFLTcyrlhgreklatn\"  !"#$%&MKD ZSRB Z"  !"#$%&#  !"#$%&"  !"#$%&(AZE rCAT CRT rDEU  LAT VTRK r"  !"#$%&#  !"#$%&#  !"#$%&#  !"#$%&#  !"#$%&'c2sccaltcaseccmpcv01cv02cv03"cv06(cv11.cv214cv27:cv80@cv81Hcv82Pcv90Xcv91^dnomdfracjligarlnumxlocl~loclloclloclloclnumronumordnpnumsinfsmcpss01ss02ss05ss20subssupstnumxtex,-1789;  #$'(%&)*0+-0!=>~ ",4<DLT\dt|L\dlt|P^bh6d"J` * !""""""#4#j###%j%''"'(','0'''(((((2(R(\(`(l(v(z))* **(*,*L*h*****+ +<+l+v+++,,",,-^-.,./ />266*6R6666669V:\:=??r?AA CC8CZCCC rJwMM w--M rw swo60 x m n o p q r s t u v w Y X &,28>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~      & , 2 8 > D J P V \ b h n t z     & . 4 : @ F L R X ^ f n t z      & , 2 8 > D J P V \ b h n t z    & , 2 8 @ F L R X ^ d j p v |     & . 4 : @ F L R X ^ d j p v |  &,28>DJRZbjrz$*06<BHNTZ`flrz "(.4:@FLRX^djrz "(.6>FNV^fnv~ "(.4:@FLRX^djpv|&.6<BJRZbhnv~ "*2:BHNV^fnv~  (06<DLT\dlrx  *4>HPXblv",4<FPZdnx &.4<BJPV\bhpx"(.6>DLRZ`hntz""""""$&&&&****/000006666:BBBBBBDFFFF    OPPPPPVVVVZZ"B"B"B$D$D$D$D%E &F&F&F&F&F(H(H(H(H)I* * * *J*+ ,L--M- M /O/O/OO 0P0P0P3S3S3S4T4T4T4T5U56V6V6V6V6V6V8X:Z:;[;[;["B*J0P6V6V e6 lV b6V j6 kV a"B e"B g e(H,L0P0PwR (H/O" lB i l" xB"B& xF&F* xJ*J0 xP0P3 xS3S6 xV6V4T5U)I"B&F0P e0P d e0P0P g e:Z              $ $ $ (  " qB#C# oC# wC$D%E% oE% wE%E% sE& kF e a& lF e b& sF& vF&F'G(H)I) oI)I)I) tI* vJ*  b,L, oL, wL- oM- oM- wM- sM.N.N. oN/O/ oO/ wO/ sO0 lP d b0P d0 kP e a0 lP e b1Q1Q3S3 oS3 oS3 wS4T4 oT4 lT l g4T j g4 oT5U5 oU5 wU5 sU6 pV6 vV6 sV6 lV d b6V e7W7 oW8X8X8X8X8 oX9Y9Y:Z;[; o[; w[IUXZB~?" oB" B" B c b" B c a" B c h"B c d" oB" B f b" B f a" B f h"B f d" oB& oF& F&F& F c b& F c a& F c h&F c d& oF*  * oJ0 oP0 P0 P c b0 P c a0 P c h0P c d0 oP`a`a` a`a` oa6 oV6 Vopopo popo op:Z: oZ: Z:Z                                                    $$$ $ $ $ $ $    ((( ( ( ( ( (                   $ $ ( (                             ((( ( ( ( ( (                                  $$$ $ !!$$     ( (( ((       # )/4EYbfg k r$x(> )-01 JK X XEMUCEGILM&  X X&  c l6 $(8 $(8 $(  $( L !"#$% A\_@fgDvvFGH$%IKLA\_@fgDvvFGH$%IKL&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdenA\_@fgDvvFGH$%IKM                           ! " # $ % & ' ( ) * + , - . / J K L M N O P Q R S T 8 A\_@fgDnnFvvGHI$%JL'77  77  . . . . ` ^ _ [ \ ]GRYryV"#$%&'()*+,-./0123456789:;BCDEFGHIJKLMNOPQRSTUVWXYZ[   "$&()*,.024689;=? U V W {VW"#$%&'()*+,-./0123456789:;BCDEFGHIJKLMNOPQRSTUVWXYZ[   "$&()*,.024689;=? U V W {6V6 'VT8BCDEFGHIJKLMNOPQRSTUVWXYZ[)? U V W X! O+"#BDFHNOPQRSTVWXY[ 3 U V\ k{23  ~  E - M        ' vT'T W KJ'?  )*+,- V a b c d e f g h i j @  X   !#%*- Y Y/ m x0 < > ?. EU/H  GG??G?UGGUGG?JG?K$*KPSE$*KFMMJKG?CILM&,B,LLBCILM??bG .69:;< X X> c l?GbU .69:;< X X> c l?GdG? .69:;< X X> c l?JK` .69:;< X X> c l?MdJK .69:;< X X> c l?dG? .69:;< X X> c l?CILMjCILM .69:;< X X> c l?b? .69:;< X X> c l??z22:"*,1 3;BGIILLNP SY#[[*+2APT[`dvyz{   !$1468?`aop V W:"*,1 3;BGIILLNP SY#[[*+2APT[`dvyz{   !$1468?`aop V W|32:"*,1 3;BGIILLNP SY#[[*+2APT[`dvyz{   !$1468?`aop V W4"*,1 3;BGIJLP SY%[[,-4CRafj|   !$1468?`aop  V W3"*,1 3;BGIJLP RY%[[-.5DSbgk}   !$1468?`aop  V W42HKQZ52 +>^6R B[ !"%%#''$s2s2 N2 O2 0RG=k  <> CC IM \^nn!"#$%&'()*+,-./0123456789!!:>?;=>?@!!A##B%%C33D55E;;F==GAAHCCIEEJGGKIILKKMMMNOOOQQPSSQUURWWSYYT[[UmmVooWXYZ[\]_cdejklmnopqrstuvwxyz{  |  }~!",.458: TG=rCIJKLM!>?!#%35;=ACEGIKMOQSUWY[mo  JG=BDFHOSTWY[  U X X?x  <> CC IM \^nn+23456789:;<=>?@ABCDEFGHIJKLM  NOPQRST!!U))V++W--X//Y11Z55[77\::]<<^>>_!!`##a%%b33c55d;;e==fAAgCChEEiGGjIIkKKlMMmOOnQQoSSpUUqWWrYYs[[tmmuoovwxyz{|~    !",.458: T"?CIJKLM !)+-/157:<>!#%35;=ACEGIKMOQSUWY[mo  N?BDFHOSTWY[  U X XG=: U V"#$%&'()*+,-./0123456789:;BCDEFGHIJKLMNOPQRSTUVWXYZ[   "$&()*,.024689;=? U V W U$ <|"#$%&'()*+,-./0123456789:;   "$&(*,.024689;=|"#$%&'()*+,-./0123456789:;   "$&(*,.024689;= F95F9F9-B5F9B-5F9F59*04:@F95B- DFLTcyrl2grekVlatnnMKD SRB (AZE (CAT (CRT (DEU (LAT (TRK (kern,lfbd8mark>mkmkDrtbdJsizePxtexT"xvwy zx_|FNV^fnv~&.8@H&.6>FNV^fnv~&.6>FNV^fnv~&.6>FNV^fnv~9;;;;<<4>N>n>>>??LxLLMM@MlMMMN6NhNNNO*O\OOOPPHPzPPQQDQnQQRR8RbRSSTSSTFTTU:UVVdVWWnWX4X~XY(XXXXXXXYY"Y4YFYXYjY|YYYYYYYZ ZZ0ZBZTZfZxZZZZZZZZ[[ [[ [*[4[>[H[R[\[f[p[z[[[[[[[[[[[[[\\\\\"\(\.\8\B\L\R\Z\b\j\r\z\\\\\ \^H_j`brl\s.tw:wz{L||}jJT^4*j,l'`(y(2#A<(2##(Aj~F2((7A<(tFFFxFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFK<<}_Zns~~PP7PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPU #""%%&&''-- .. 0011 33 5578::BBCDEEFFGGIIMMNOPQSSTT"UUVVWX$ZZ$   ""$$&&??FFOOQQRRTT__llnnrrsstt$$$##$135577CC%~& !  !! ""!##G"   82;:$#* 4""##$$%'(()/001122335578 :: >>BBCCDFGGHHIIJK(LMNOPPQQRRSSTTUU9VVWYQZZC[[^^chgkmni+r,.3/u<>?Z\ad!e f&j'Bpol((q)      1-0s7t!!""$$%%9&&))W++A--=//Y11@3355Q77[::^<<_>>??TT ``aappss ttCvvzzDE%FGHIJK     C  !!##C)*/455~L!!##%%3355;;==??MAACCEEGGIIKKMMOOQQSSUUWWYY[[]]__aacceeggiimmoossuuwwNOvPQQQQQRwSTUxbybbaaaaazV{|.}.~.,r|3<  u    W]X56  !!5""6##44"554894::"WW( n "%&'-.013578:BCDEFGIMNOPQSTUVWXZ"$&?FOQRT_lnrst#12357C~ !"#F\ ~t~y~QQ``nnpqrrssttuuvvxxyyz{||}} [ ]Q` H  nq uu$&&((  nopq                                                                 "(  T; OO  OO  O  O . O T;   TT  yy  yy  yA  y  y  T ; ;( (V  nopq      u !"#$&(&T! nopq   u !"#$&( nopq nopq #1B $1B %1B &1B&`'5"$&lnBDEFHT &@(5"$&ln PRa !5&h)5"$&lnNOQSV[ 3pvz /01234]_aegi&.*5"$&lnU%&<+5"$&ln WXY5&`,5"$&lnBDEFHT  &@-5"$&ln PRa !5 &h.5"$&lnNOQSV[ 3pvz /01234]_aegi &./5"$&lnU% &<05"$&ln WXY5 &615"$&ln)* &625"$&ln)*  &635"$&ln)* &645"$&ln)* &655"$&ln)* &665"$&ln)* &B75"$&ln CEFGILMNOQSV&B85"$&ln CEFGILMNOQSV&B95"$&ln CEFGILMNOQSV&4:5"$&lnDHPRT&4;5"$&lnDHPRT&4<5"$&lnDHPRT&4=5"$&lnDHPRT&,>5"$&lnJ&,?5"$&lnJ &,@5"$&lnJ&,A5"$&lnJ&,B5"$&lnJ&,C5"$&lnJ$D78TB$E78TB $F78TB$G78TB$H78TB$I78TB,J78TDHPRT,K78TDHPRT,L78TDHPRT$M78TJ$N78TJ $O78TJ$P78TJ$Q78TJ$R78TJ$S:sB$T:sB $U:sB$V:sB$W:sB$X:sB,Y:sDHPRT,Z:sDHPRT,[:sDHPRT$\:sJ$]:sJ $^:sJ$_:sJ$`:sJ$a:sJHbBDHPRTHcBUHdBVHeBWXHfB"LgEPBLhEPWXLiEPZHjVB8kGR PRa !5XlGRBDEFHT .mGR)* XnGRBDEFHT  .oGR)*  4pC PRa !5TqCBDEFHT *rC)* 4sC PRa !5 TtCBDEFHT  *uC)*  $)* (1A1K1K15"$&ln5"$&lnx5"$&lnd5"$&lnd5"$&lns5"$&lns5"$&lnd5"$&lnP5"$&lnP5"$&ln<5"$&lnZ5"$&lnn5"$&ln}5"$&ln5"$&ln5"$&ln 5"$&ln5"$&ln<5"$&ln5"$&ln(5"$&ln<5"$&ln_5"$&ln25"$&lnP5"$&lnd5"$&lns5"$&ln5"$&ln5"$&ln78T-78TA78TP78Td78T78T78T78T<78T78T-78TA78TP78Td78T78T:s-:sA:sP:sd:s:s:s:s<:s:s-:sA:sP:sd:s:sBBBBBEPEPEPVR_R_RKRPRdCsCCC-CKC &,28>DJPV\bhntzu)))w<w  / RX^djpv|RTMvMvvvMvMvvvMv 06<BHNTZ`flrx~""!"T"""e">"%z-he"%z-h $(/  """ .4:@FLRX^djpv|Trr mm>mm,mmJmr mm>mm,mmJm $(/  LiLiLi "(.4:@FLRX^djpv|NN>NN,N$NJNNN>NN,N$NJN$(:  jpv|;0;0B0L&&p7&A&L&&p7&A&6 LRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv| $k}VWUC}@;gBgggDgJgggggYgCg4gg4gggg9g#gg!g gg}zgg&&DUg&&&d&&&&%&&&&&&&&&m<&&&&&%%k<w7nXkz&z&&&&&&&&&m}kk?&&&H&&&&&&&&&&1&&f&6&+&Y&&;&:&x&&&g& g&gg"#$%&'()*+,-./0123456789:;BDEFHIJKLMNOPQRSTUVWXYZ[  &?Q_`aopw~ !"#$%&'()*+,-./0123456JR/<NQSVX\anqstuvx{|~HIP`akopqrtuv~ #( X Y+ a l- x x9 : ; ? @ JK.4:@FLRX^djpv| $*06<BHNTZ`flrx~&.&&&o&&o&m&2&Z&&k&;&;&d&fYcl&,g^<}H&4&t&)o&&o&t&&Y&,ZH&4&t&)o&&o&t&@  &,28>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~Nrc:rvNr).2J4A.V@8+< r:NrrGppp ppr|ppUNcrH1r:2x"#$%&()*,-./013456789:;BDFHIJLMNOPSTUVXZ[  &?F_`aop~ !"#$%'()*+,-./0123456J<NQSX\nqstuvx{|HIP`atuvx    m w( &,28>DJPV\bhntzjejddYdddd2oj}c}UabQ<a6 %LRX^djpv| $cp|QQ$QQ$%"&*06:BFJPVZFOPW_`aop(5NQSs|I  LT 9tz "(.4:@FLRX^djpv||B d8nm 1^"R <d,:),|BB89"$%&)*-.04569;BDFIJNPTUV[&?FOPW_`(5<NQS\sIPv  r6.B  p|r-M $####p& #HNTZ`flrx~|xR>4S93^i<>tXNioovu{{b'7AxtXNioovu{'7A# c d e f g i j k l   c d e f g j k l  $*06<4<tou]V p $ touV p $ ~ $*06<BHNTZ`fl:Y+Z0.N:6xD.N:6xD c d e f j  b   ~ $*06<BHNTZ`fl:='. .N:6rD .N:6rD c d e f j  a \\N>X  &,U64545 c f  h *:.N    "(.4:@FLFFFF[[BBXXXXFFtt"$(+025789:k{ "$4568T_csX<FN\_`c&>jlnp !"#23@CE ^ _w_F[BX.XF "%',-025789:k{ "#$45678ITXY_s #>X6JNX\`c~(*,.0<NOPQRSTVXZjlnpsuwy{} !"#23:;@CElm ^ _ 9B-59{ B|%h}d5>51%>;(<$T"N2<(!t$g4)=)FN5N2N5d2B.-*%T,H-(&-)B[upu$0(% 0<[R<;;8Xh<r<;&#X&  0(udu#2A#&kd=+dX2+,"N2,,.~J.-y,:5d))5r(b.TTTT-----Xl1B/\;% % % % % % 0<;;;;[Xh<h<h<h<h<N2h<XXXX% % % .0<.0<.0<.0<[[-R<-R<-R<-R<*%*%]T;T;T;T;T;v,;8HHHHJXXXX-h<-h<-h<-B););););&#&#&#XXXXXX BB[([([(;j8  8  .#8-###=-]` --#x)#Sv)C[:#313}[y#[#8`)}((;ZMYt.=% T;-h<XXXXX% % b--R<8-h<-h<#;Mks#-R<%/X% b1h<% % T;T;-h<-h<XX);&#(%*%}#[-#[i% -h<-h<-h<-h<BC M#+#.2~&<Cy#v%V' (5"?.-#8s'm#>(##" Tn## ##  ##2I#?B?N?)NNC@u::#yyy {#(##b# #y ### ###(I I LLE0>5>( 0262##<2   <>9( > .6"2&>>22222,i(",>(a-fy 7>;B![*%2T-$ ([#>'T% ;N% (h<; % X&h<v#&#Ni70X -;Nh<N-7#2##<<#. -)TT,%#%}8B##%#%*%-$(.}(   C8.##boq #y# I#  bb#C;e-#XBBT##b ##o##%#%-#-#-#.}}}Cb#T&- # #<N;8q h< X&  (bX bB*T,> (?9 F 5AEN  % BBB.0<[[[[[-R<*%*%*%*%*%T;T;888HHHHXXXX-h<-h<-h<-h<(();););););&#&#&#&#XXXXX& &      00B[([([(&# % ; '!#% % % % % % % % % % % % T;T;-h<-h<-h<-h<-h<-h<-h<-#-#-#-#-#XX11111BBBB #B% % % % % % % % y{;;;;;;;;....2(h<h<h<h<h<h< "NNNNNNNNL--------@B% % ;;h<h<NN--% % % % % % % % --------@B% % % % % % % (@HQffyy*%//H;;;;;;TT//HNNNNNN77aa-----  >>>'Md MM &222d((((((#(-<<<2>>I>(f((dddd82#d=d<dJ/T" >,,,4,,, ,w {  L,,,/,,4,,,#,w w   5  LF LA Y#-8).^"H)kRV >'>'4 T1v OH.;va& a   k0k0<[2'1'2'/*.+*02'2'22'2'2'2'!<$ $ X2X2-#d|d| F22N2N2N2DDNMN5-v-0;(;:(0((((I(C(;(I(((Q( (((j(d(\(j(@(X$[4)=)&y0|(t(((W(0((((((M(:(((M(((%((((((u(u(6-@--@-+ 7(r<N;(;:(: F2222H H( $r#*%[y)kJ#@#)[c$upu$upu$((cD2 2J;(;:(: %  -$1suz ##) %R(T00#d7. -9j- * -&\;:->v*`i)C-\7>%7##M@-0@-7(0 )" ~( & ( ,,8,,.,,4,,,#, *b b,6(qqF{( j"0SIEE? 9 LF L5A^ E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =#D 22>2z2T  !vQ-&-y<00/ddvdvdJ@;(% (h<; % X&h<v#&#Ni70X <-#( 22>2% ;h<N-; ;NN% ;h<N-;N &22 \;Q5};;PK!G}#mdc/resources/futurabook-italic.ttfpOS/2`[NPCLTH`+6cmap}@^cvt 2fpgm8 8glyf kjhead ,6hheaOd$hmtxSy0kernl͸loca5pZ maxpTt nameGposth;CprepՆL-8$ !\}8 p : R Bh * p &DFuturaBook ItalicFuturaBT-BookItalicCopyright 1990-1993 Bitstream Inc. All rights reserved.Futura Book Italic, Geometric 211Futura Book Italic BTmfgpctt-v1.54 Tuesday, February 9, 1993 8:11:58 am (EST)Copyright 1990-1993 Bitstream Inc. All rights reserved.Futura Bk BTBook ItalicFutura Book Italic, Geometric 211Futura Book Italic BTmfgpctt-v1.54 Tuesday, February 9, 1993 8:11:58 am (EST)FuturaBT-BookItalicuNu)Rf3h  hJ)!HmjmP5P`XR=sDfhBuwoZs'){'^u)u'y'!L- fu-fw!'bmjPR5sP XZh)Xy-J {}hhZRywfBuoA;.*#SY&Y@&}}kDYG}} !!.&@YG]AYY  @ @k}a.a@.>>D$ |{eA{Szy`&yx wvutsrsrqpoSpoSnmml}kjkkjiYjAji`&iYi@feAffeAd}cbccbaYbba`&aYa@`&\ZYGZZYGXWVUST>PONNLKKGFEDCBA?=<};:k843k0//.--*)*)$#"! ! }K&& A   L}}d++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++@, %Id@QX Y!-,%Id@QX Y!-,  P y PXY%%# P y PXY%-,KPX EDY!-,%E`D-,KSX%%EDY!!-,ED-ff@WXW/10!%!!fsr)} #@ [ Z \  991074632#"&3}C0/A@01B9L/CB01BCFw^q@^]1<20###wu))hP@5 _ _     9122<<22<<220!!!3!!!!#!#!7!!7!_-3+^J++@`+X^b)){{++{{9!w!(/r@D)" * #d*d cf0*)#"  -&&-099991299907&&546773&&'#7&&6654&9:VG\aB,jAD\Am|O>atFky+Mz mcmRVO sOm bKiL} #/3U@/1$!04g*h!g$ g hgf$c43021'-499991990%32654&#"2#"&54632654&#"2#"&5463=@]n=@Zq;@\n;?Zqǀ8d]Y׹[W8^Xع\U95 ;@U<:73 6%&26ll,k6f<:7/&) /  67/%) 3/2 ;7/ )7"<999999999199999076654&#"3267'#"&54677&&54632667B7XAK>GY\ih`;y:=RRbТ;88|1\)i9a1)BX0-E}AoR^oR^ %@p qp    <<1/<<0!!#!5!vu)u'h"@ts 9919901\49y#@ vu9910!!L+^D @ [ Z  1074632#"&^C00CC01B^0CC00BBB@ w\/99103 iRL "@ddcf! !10#"476632%"324&L]UO}[ULRS3EP~wy,iwyәYWwf^=@ dy91/0!!7!ͪ@ V;8@ dcd99991/990!!6676654&#"#6$32!%V Rv yR"[jϲB+Q@+ " +d(xdd c(f, "%,999919990332654&#"732654&#"#6632#"&5B ~np ijФ}z~l}zm~ϼ ,@  dc  91/<290!!533#f+eT-ffJab G@'  dd dyf 999199907732654&#"'!!6632#"&rLT̴NH!n5Z'ٞpPKײ%& bV:@dzd a f 99919906632#"&547"32654&?z=꘬w’|”##"۶Ȕ2dnĘ̝yw#@dy9190'!7!7`/RT  /@@"$ d* ddc*f0$'! !-0991990%2654&#"2654&#"&&54632#"&546~̀mwRdg켼ӗ|o~Zpni}?.a۹Ÿ99@dzd c{ 9991990#"&5432'2654&#"?y>$ꗬnvQÒ}Ôy##ܶ&ɓ:bǘ̜ym! !@[ [| Z 1074632#"&4632#"&mC/0CB10BQC00CC00CL/CC/0CC/BB/0EE! 1@ t [| s  9919904632#"&B00AA00B/BA00CC\4Ly @~}291905fhkgh\@qq<210!5!5RRuuuuLy @~}<919055fg 3\@1!  1* 1l[ l$k Z4 ' . *!'.4999999199990%4632#"&#"&546767654&#"'66323263C00CC01Bet#\NXj"mt-NRCJeL/CC/0CCy"nW yc=JcbWA(toCQcqN[`@7POYL CYS"!YF=%SL%1!PO!"@CV7VI7+\991/<99990733267665!"32$7#"$'&5476$32#"&5465#"&54327&&#"326 :n77-n0Yeysy~eE-wec$f}xETcc3^[}8<nPf^fLy(,.0(L Dhez­cQWa[Bmp]\u6ţ${WQca79NMW[>O?Zdnw )@ \   91/<90##!!`^b qHN4:@#+ !\ ! "+ 4 .( 5991/9032676654&'&&###32676654&'&&###!2#fuig(@G1/ WZ9Jg|-FP74&eh8`879|ZTC?vN<^VCfV'/0S#zs:.&fF5@ llkf    999199990&&#"3267# 476$32goyO[_"al'Xj~}uif]YXT`BG..>7uinOSN/(@ \ 9991/0%3267654&'&&##32!_@x7fFhˠH#ĥ?#RgODN *@ \   91/0%!!!!!s9EJKL $@\  91/03!!!!L9A^K9f ;@llkf  99991990!! 476$32&&# 32$7!jv|wq3yg2,5 oD:slou}N^ '@ \   91/<<033!3#!NKL^`CH+T@\991/033TH-@ lf \  9919990'732673#"&F}S42w"6%\fmBC'4Y>CVN $@ \  91/<290333#NV'foe N!@\91/033!NX +@\   91/<290##FK1L%@\91/99033Li?nhu##@ llkf$ $104#"326766 # 476$~Uag1Y]hKxqЫwuo)4\Vb\X]Q{slu>9qjqN!+@ \!  "9991/032676654&'&&###32###dwpm'CH11!\b5JĠ<@CPN?D?TUAb(03]o<1+}hdq)N@,)&&&ll kf*)##*999199990'# 476$3 7654#"3267TVft~vs.HF{V_j?>y<''>5pmtyi%+Y!.\XaN 8@ \     <9991/<9032676654&##32##dwol)BIN=BERJX+|R|f(04\Z\&K@& l$lk$f'!  ! '9999199990732654&'&&54632&&#"#"& ix.ݤاWWZLRZml)3@ Z  9991990&&#"3267#"&5432hGWʯFQ6W)VMHC೐8A(**.01` 5@ Z  9991/990%2654&#"3#7#"5432􅺑uM͟Bi z.mޥרYU)lm)A@#  Z  99919903267#"&5432'&&#"#Q@nPqwvNRZhg-v|v=!:@"  z  91/<2999903#736632&&#"3#f#{'G$+.86&f ޣ T#H ,R@.# ,#)# z-  , & -99919990%2654&#"3#"&'732677#"&5432u¡\!;>yBh z,yܣԥ))ag]ʪ~YV*kjB8@  ! 99991/<99990336632#67654&#"B̞mFfLHd`~>[[|41 1RV1H !@  z  " 991/04632#"&3A-.??.-AyyD,@?-/@Am B !@  z " 99104632#"&#3A-.??.-A!D,@?-/@A,QB '@ z  91/<903##3% B̞_F@991/03#3̠B,I@,+" ( z ,+"!   %! -99991/<<<2990!6654&#"#366326632#6654&#"yJUSl>zA[\E\uLJUSo}=2*SU1XV[QVV|?1*SU1B8@ z ! 99991/<99990336632#67654&#"BxMdLHd`~>]Y|41 1RV1) #@Z # 10"32654&432#"&%ūĭ|(3߬ޫq/B 9@ Z z   9991990"32654&36632#"&'Nt¡.Cf{,Rݤզ#QZVkl5B 8@Z z  9991990%2654&#"3##"&5432u¡RBg {.mޥا&GZV/lmB.@   z 91/9990&&#"#366326i{:x?M/ P]U 'M@' %%Z(" $"$(9999199990'732654'&'&&54632&&#"#"&f2MVe$V\?`*rFE` \tyQQOCKA ?lR~DCs89O6JI:r\T%J '@ z   91/<203#7333#hg/1gqb<@  Z z !999912999990332673#"&54775f]{p;>!W4ak1JR/ ]7:1 @z9129033k|6 -@ z   912<9033rRPr6c (@ z   91/<290#33##{T49\B#@z9129033 ?dB"/sB!@z91/0#!7!!P)bZ0e@81 %" !/()""!/1 !/' &!%(1<<299991999990"&#"33#"&'&&554&#"#52326554676633ZyVWooWW~'#cy*7-nn-7*xd#F^]}$z{}#?@(10#?~bV0a@6%($( !(*1(+!%&)'$1<2<999919999903263"&#"##5232655467&&554&##5323oo,6'uf)xWWooWX}'#dz*6,X||$}__}#~)@ q q* 1990#"&'&'&#"566323267e]+_59dSyiX8yrWTxsHH HKUIH( :JTZ'$' "T@."   \ # !"+,+ #999991/<9032654&#"4632#"&3#!!}I44II45Hmaba`9>b 5HH54KJ3abbHquf'F'&\N'(s'Lf'1L'huZ'2'}LZ'8'5'D/5'DC/5'D/53'D/5?'D/5 (4W@/(/) )/%zZ(,. 0.2"59999991/99032654&#"4632#"&3#7#"54322654&#"I35JJ54Hm`cc`xBh z.u¡4KK44IH5abamYU)lmޥا)''F))'H)'HC)'H)3'HH1''C7''F3'B?'Q;)'R)'RC)'R)3'R)?'Rb'Xb'XCb'Xb3'XFB )@ \   91<20!7!3!!7oJJoB1ωD7ym  @  121104&#"3262#"&546uTTwwTTuuvvTuuTTvvoutvwR"`@6  #  #9991..9999990%&&54373&&'267###c=j.'1^8pGF'By8-`Eqp *"01i78" u)-K@J<2/ =HK@9 9d@d& ( c@fL)('&" " ,"<=/"K3"L999999999991<29999076676654&'#73&&54326654&#"!66323267#"'&'&'&#")*_3.*& ȿx3{?B#KDpW0`0`ASO 2*YH`5B Lz84rs:о  ] r!AQ$:33oHG150C9? E_@5437 F)2= 7/kF,&) =:4C:4,4&4C42F9991999904&#"326&&54632&&#"#"&55732654&'&&'&&546hf}eqea׬h\_|"%.gnc_ةi^]~"&)ejdlb{+d ajwX)D"L9j1_ůbmvW%D$U:h3! @ 5 104632#"&3{zz{{zzL'@6 691/<20####&&5463!}^`ײyy%!3c@72//)/ &$Z 43%$&2!,499991/<299999903#7376676632#"&'732654&##732654&#"Ph831TѢ&Y3$H%! zqof Ţ316ɨ! ʩt}w3.FO@, /);G  8 75859#7AG299991290#32654&'2###4&'&&#"3267662#"$'&5476$N{hm`j[`Z^놄Y^db\[ꀃ_[aw jfmmhmjinrke)BKOG\ruYwmHL[]a^Z_^\ba]Zdojfejqpkh kglw31II@*   2 2,>J : 78889&7DJ99190&&#"32673#"&546324&'&&#"3267662#"$'&5476$)oSusWu ē״ 3bZ\셄Z]cb\]遁_[_w ifmlgmjjoqjfMWaUv[\`_[_^\bd\Zcnifejqoji  lhmm L@)    <=;< ; <= 9991<<22903#######5R6R}^k66C-C#9@10#3 y#\/ZN3 @  > >1<204632#"&%4632#"&yA),?/)C@,0=>)?@# q q   <291<2<29990!!!!'7!5!!5!^X{;YVssFss@?@( \   91/<90#!!!!!!!!b/%sH#<%^}Cٚm= 7l@<8)$ '*673($l3l$k3f88(*-7 '6 )- 899999999199990&&#"3267654&'7&&5476$327#"&'GrZ]c00LClX`i63JJwt+]TLNwtիVBD_Z]eCXBJdYac>X㊳8qnsSSLX錰qmrVV /D@$ -!' $-'-0 $??*0999919999032654&#"&&#"32676632#"&'#"&546323Xfz[U3Viz[UsC``LG`a/_]nl?__pl튄٤xڣ~)2@ q q    <2<21<<0%!5!!#!5!RvuuuXuX! *@  q  <229190%!55b/buu}e! *@  q   <<29190%!555bb-uueq}CD}=@&    91/<<2<290!!7!'!7!333!!!PNٮ;mEu/ (2@# ) &  BC B)991026732#"&54&#"#"&54632-g  L\>35@ i +)1^I]?4/AKNA0;F9X^rvL;5>:&`!X S@-   k!! DED!999999199990!!73#7#"&54632"32654&ob^X -uI˞Yxnt]`ip/lqN54A2r`wo`u!  9@k  DD EF99102#"&5464&#"326!!ݬ~ck}fkӷ׸fsipdD@#   HGH G 9991/<2990%!5654#"!5!&5! Ly*+yoP4o0Ikυ T3:F@H%($!>4+!  47!(.>DZ.G;A1 :4$%A+:4 1AG9999999912999999903267#"&'#"&546326654&#"566326632'&&#"4&#"326R!Q>nQv6Dˆ۳Z?~JHRZ|!>xwuӈr|}k NRZjgeddc32$?gr))\T[Ys|wM]aWJX^7!+u@?,+"! % %Z,+"!( ( ( #(,.9999999199999990'7&&54327#"&'732654&''&&#"+=(((bJbaWA)toBSd#@[ \Z 9910##"&54632B//CA11@Ry0DE/0A@dZ@ q 10#!5sZ u9o *@    9190##'%w5w  oR}+D\';$Q@.%   $ c%$  %91<2999999990#7376632&&#"3##"&'73267z&J(,2?@\"5"t'%ɲ m޼T$'H@%!$  '!!q$q qq(* (<219999990#"$#"5663232675#"$#"566323267k\bdRjYo}VU}h[ddS}jYo{XW|KGGXIHGWIGHVIHFVV!@91/90%!bDC#JJr#?)/^ :@"    II 991<290+Td:Tb^VDVD/h^ :@"     I I 991<290%'7'7T)dR'c/VDRCcnVDRCc'/''$C'f'$'huf'2'j-Q@1*(!&$ ll&($"\fk*,-,+*)('&%$" ! # .9991/9904#"32676# 476$32!!!!!!zR\f.T^e5\Ƹ~|tq*3H'<:HR3^Wa]Yb[C7sovGӜ)*6^@2 "+ +1 Z%7("4(.79999912<299990&&#"3267#"&'#"&54326632"32654&7yx#Q>nOr7I'߀?F}S¨1{vNRZhggdch,hgfinצۦ@ 9910!!w@ 99107!)ww.@t\99991<290''55\?\2@t\  99991<290% \5@\51@ t\ 991990'13\'@ t\991990\5= ,@[ [ q p JJ <<102#"&546!52#"&546V/DC00CDRX0CC01BDmD//DC00C1uuC/0CC0/C#u"@91990 9%-B3'\sZ'<`'@103mo'V^ /@H&!.$!  -' % !/0/%*&-'*$ OLM.&OL*02299999999912299999999904&#"32666327'#"&''7&&5467'7<}GG.-@yy+f#{'G$+.86&fD-??-/@Am ޣ T=!!N@,  z  99991/<<299990!#3#736632&&#"3#Tˢ^f#{'G$+.86&f ޣ TBB@)   \   991<2<20!7!!7!3!!!!7FoPoEFoPoFB^^B @ P 104632#"&C00CB11B/DD/0AAh"@ts 9919901\47@ts  99991<299990%- \4?\4LJ #/;GKh@:I<9HL3gBh9gd^Vh;wVh'6P'''V{'='B']?@(<210##?~~~  D%@@%\& %&.99991/2203267654&'&&##!#7332!qL^?y7g7VaNEiH$ä?X!ߔE#SgOD)y *`@6( "("Z+    UT%+999999199990"32654&&&''%&&'77!"&5432:9CXLHx1!::t̘ɛ?kHe?EIb1uE9`5~bs'<`'B'\N 1@  \    9991/032676654&###332##;ba$CKJZ+-Bà=@CPNC0Tif(02_n<2,B 9@ Z    9991990"32654&#36632#"&Nu¡$Rm>h{ݤզXXk'@ qp10!5Rww-5 0@   V  <291<290'7ZR%R%#P%PR#%R%RR?#@ 910#7!1o)? ^?3@ 99991990!76676654&#"#6632!u6U6`Nahs]?2Ud7@O``|kPu+)+G@! " +(( , "%,999919990332654&#"732654&#"#6632#"&5+lbWbqmh wTHJ\lwl^TX%NXeWIMT\T@KJAjysdVyaL~{p U@-     29991/<290!7!533#3#7!\65Rnl@@loj'yrPwX$a@/  "" !#!$%2999991/990!!76676654&#"#6632!3#7!Eu&S2\J^clXloj'y999991/<299990!7!533#3332654&#"732654&#"'6632#"&5\65Rnl@@lo)h^U]khe  t|PEGWi|rhYPTrPwuIQ_QEGOTN=FE<bpk]Qr[HuuhL')Uf '*'#H^'JFT`',X'''6''VfF'&`')'FfF'&`')'F1) $H@*$  !Z  $  %9991/22990%2654&#"!7!33##7#"5432􅺑uZ##욟Cj z0mޥا} }yZT*kn9y#@ vu9910!!L+^B @ P 104632#"&C00CB11B/DD/0AAfNNw}N^'h9L51^mN9N^R^BVTwmwqdN^fNNLsfNTNyNLh9Nh`N q}{3 '+wX53)1){=#VBH BFJBVBh)5BHL%bs^fNLh}555555)))))H'VBh)h)h)h)h)bbbbBF7)B93Ld%ww/=huB/f`N%d hbw9L)hj9)NN+VV=)=Z=Z=BNNLNNNTJTThhRqh}}}H)9Pyf5 Hwsh)+9N-   +%%%)Lsf#T H^f)^f)19N  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~D: ~1BSax~ & 0 : !""""+"H"e%  0AR^x}  0 9 !""""+"H"`%^CiTjq_8 (BJbcdefghjikmlnoqprsutvwxzy{}|~!w  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ sfthyphenperiodcentered####Rtc>i$B)~V9\ S  E  L j  e $ O8Zp dG.\ R'_;] P],9F)6CP]jw;3+`~  O  !*!!!"A""#D#$I$%D%t%%&&&&&'-'>'>'K'X'e'(`({((())4)x))))*d**++w++,,5,,,----)-6-C-P-]-j----...7.~...//W/}///0*070D0Q0^001Z1g1t122&2_2~23&33444444445555|55  $&&*K-r2K4K6&79:; hheadT6hhea.$hmtxqvHkern,loca' maxpq4 namehposth}CprepYq8Oi8w  p  7 4? s p FuturaBookFuturaBT-BookCopyright 1990-1993 Bitstream Inc. All rights reserved.Futura Book, Geometric 211Futura Book BTmfgpctt-v1.54 Tuesday, February 9, 1993 8:09:25 am (EST)Copyright 1990-1993 Bitstream Inc. All rights reserved.Futura Bk BTBookFutura Book, Geometric 211Futura Book BTmfgpctt-v1.54 Tuesday, February 9, 1993 8:09:25 am (EST)FuturaBT-BookuP^ZmXuhV`V5f1mh9m V?}!HsuqP5P`XR=sDV^fhBuwZs){'du)uNyL- fu-fw'!bsquPR5P XZh)X-J {}ZRuyfBuuwwsAK]Y&Y@&}}DG}}>!! 77d.  Aa.a@.GG>>"   }  } S>5%k%S~S~S}||{z{}zyxyyxwYxxwv&wYw@v&srAssrAq}popponYoAonm&nYn@m&ihgfeb}a``^]]Y.WVUTRPO}NMkKED ED A@@?>?>9]8>7654)432}10/.-d.-d,}++*S)(&%#"! && 7}],dd%% 7 A6D }  7 } 7 D  d d d++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++@, %Id@QX Y!-,%Id@QX Y!-,  P y PXY%%# P y PXY%-,KPX EDY!-,%E`D-,KSX%%EDY!!-,ED-ff@fgf/10!%!!fsr) @ i h 1074632#"&3F11ED22E'P1FF12EE.s^q@kj1<20###wu))hP@5 l l     9122<<22<<220!!!3!!!!#!#!7!!7!_-3+^J++@`+X^b)){{++{{FB!(/j@;/ " (! )q !qp s0, %,)"%0<<9991<299990#5&&'7&&546753&&''6654&'fھOhOz3bDOWfWfOxtmmJ㭺Z \Hɏcc nf^KRlLUp+ug49 #/3L@*t u tt'ut1-0s430!21$!*4999912<0#"&546322654&#"2654&#"#"&546323JPNLIPP JPNLIPPv}J{Tȳ8ƳV% 9x@E 8510#$4{{*y4s85419-$' #'-09 -' - :99999991/9999032676654&#"'#"&5467'&&54632667d+x[sR@DE^NL`ma~<0.?(V0k+]3!RQtP%*j?K[`J%Fbc渃aC9vElT,qGuAq1^q@ kj10#u)? #@}h  2991990&7kvwuxklghw8#136P? #@ }h  <9919906'7Pkhgljyuwww1fI@, h   <<<29999190'7'737'#524f11fXX}Z}Z} %@   <<1/<<0!!#!5!vu)u'y @991990y!;y`@10!!- @i  1074632#"&F12GF32Eb1FE21CCBV@ h/99103#͉1i`X "@ qqps 10"32'2#"^'capm9./;@ 1/0!!7!/bsVs=@  qp  999991/9990%!6754&#"#4&546325:e榦o$Eq׿q.W@/ % .q+qq p+s/%"((/91999990332654&#"5232654&#"'6632#"&5q~ x {sps}wҳ Я-3 *@     <291/<290!!33#RJT;}^1F@' q qs  99919990'!!6632#"&'732654&#"!\2r?K{1lǦWɖindjʨ5w; D@#  qqsp 9999919999032654&#"6632#"547+u6n= N$" PR @s91907!5!qZ%qJ /A@$$ q*qp*s0$ !''-0991990"32654&2654&#"&&54632#"$546^xx|z-||vBqp~}qq$'Эw#)ʎÒs5 J@' q qp s 999991999904&#"326#"&5432'u6n=#"z (N{ @ ii <2104632#"&4632#"&F11ED22EE21ED22E1FF12EE1DD11EE { 0@  i    9919904632#"&E12ED32D1FF12EE !;Ly @291905fhkgh\@<210!5!5RRuuuuLy @<919055fgs*6U@.*  '{.i4{y47 $*1+1 $ 7999999919903#"&546767654&#"#5463232654632#"&d`QYaoK:LLF11FE22E![d ^ESof[f tg8Gbb1FF12EEqN[`@7POYL CYS"!YF=%SL%1!PO!"@CV7VI7+\991/<99990733267665!"32$7#"$'&5476$32#"&5465#"&54327&&#"326 :n77-n0Yeysy~eE-wec$f}xETcc3^[}8<nPf^fLy(,.0(L Dhez­cQWa[Bmp]\u6ţ${WQca79NMW[>O?Zdnw )@h  91/<90!#!#ľq?%$-9@" &%h #-'$ *  %!.291/903!2#32676654&'&&##32654&#17FMoj@9>ׇ{%-4>;#\a3!(4atX9=2 rEPv!slqmT%-@%""ys& "&2129990&&#"3267#"&'&5476$32TitQTT22Xcmt`qtptZrm^TWׂfH}tsOQEBoD©qlkMQ`*@ h  #!9991/0%3 676654&'&&!#! !#`oEZ^][Eo8`~`?/9K홚L:1?JaaJ? '@h $! 2221/03!!!!!VV\Ϣ !@h! 221/03!!!!V\-m1"?@!!!ys#! "#9991990!!"&'&5476$32&&#"327!\xgOuvc6fOC%^1p,*c]޷'p^`u  &@ h% ! 221/<<033!3#! 3H!`@h!1/033Hw)@  sh /91999903#"&'73265ǰZ@s6\2OAGJs80v &@ h ! 2991/<290333#glum@ h&!1/033!)1 *@ s  91/<290##Z9))9E#@hs!1/99033/nXm/#@ *ys0 ' $"010%2676654&'&&#"#"$'&5476$32{xWVZ[UVyzTVZYWXtooߛopuupn !not}[WVz{UVZZVW{zXXZ\lluulmmkttkl,@h (!299991/0#!2##'32654&##Z38FOOF81XXXo"'2jj2("irms5I@(  5  ,y s65 2' &"6999199906654&'&$#"3267#'#"&'&5476$323^e*(SyTTZ}}G]R<@Wz|_vopov} JZBZTTyZ45 "Ci32IGq=nlsfekݧff:@ h  )  !<991/<<03!2####32654&#X4AH/̊!(3hFF%iqP'K@)!' !ys(' $ $ *(9999919990#"&'732654&''&&54632&&#"ŏԭ) oqr贄61zMb}`e-=ʊNyb2L=pm\USx]Nr,@ h1/20!!5!!bd)@ s h %!1290332653! ʽqq')"@sh9129033R9`\ /@ sh s   912<9033suo5lF *@ h   91/<290#33# \:/a -Bw@ h 91/290!33}{bT#@h+991/0#!5!! 7dd@h2103!!#JDuBV@ h/991033ϾiNd@h<10#5!!5CfX@ 91290##PFFJ-@/10!5vv#@10#3x#\Z 4@ { { 0 /.,2991/9904&#"326#5#"54325\7js4omdi gf9 6@ { {  .2 0 191/99032654&#"36632#"&'#55qj6ŠfgkbT^1@  {{  .,991990%#"5432&&#"326^>Z L@0@sz_WN?DMŝ @9129033;9 +@    /912<9033ihop4Bw "@  /91/<290133#`cGF'b B"@9129033{ B9o?$@9991/03!5!!  bZ0e@81 %" !/()""!/1 !/< ;!:(1<<299991999990"&#"33#"&'&&554&#"#52326554676633ZyVWooWW~'#cy*7-nn-7*xd#F^]}$z{}#?@=10#?~bV0a@6%($( !(*1(+!:;)<$1<2<999919999903263"&#"##5232655467&&554&##5323oo,6'uf)xWWooWX}'#dz*6,X||$}__}#~)@  ? 1990#"&'&'&#"566323267e]+_59dSyiX8yrWTxsHH HKUIH( :JT^'$' "X@/ ! !h# "! ABA  #99999991/<9032654&#"4632#"&3#!#!G45JK43Hueeeeľ5HI43JI4eefL?qm)T'&d'(7'`'1'm^'2{'^'8'Z'DHZ'DCHZ'DHZ7'DHZ9'DHZ(4P@.&, 2{2{ C)B#C/0/. ,591/990#5#"543254&#"32632654&#"4632#"&7js4RG44KK43Hueeeemdi gf.4IJ33JI6ffeT)^'FP'HP'HCP'HP7'Hi''C'7'9'QBV9'RHV9'RCHV9'RHV97'RHV99'RH'X1'XC1'X17'X1ZB %@ h E  <<1<20!5!3!!mlB1ϏJ7ym  @  FGF104&#"3262#"&546uTTwwTTuuvvTuuTTvvoutvw;f!Z@-" !     " ."<<<<2199999990&&'667#5&547532^wi=Sb/ % > ("%/ =)%0%>99999999912<2<99999076676654&'#53&&54$32&&#"!!323267#"&'&'&#"V7|G2$ }-- 0,X13V)8e'S*#@6W-1X\+]2(U+uz:&DbuA#5v4o H' t3! @ H 104632#"&3{zz{{zzL'@I I91/<20####&&5463!}^`ײyy)7!7m@<5/&#!/)&!&/{{%&8&%5,. .25018<991/2999999903#534632#"&'532654&#""#532654&#"ϸkhA0B&$w}vpGk Ѫ| wrx~73MU\w3.FO@, /);G  K J5K5L#JAG299991290#32654&'2###4&'&&#"3267662#"$'&5476$N{hm`j[`Z^놄Y^db\[ꀃ_[aw jfmmhmjinrke)BKOG\ruYwmHL[]a^Z_^\ba]Zdojfejqpkh kglw31II@*   2 2,>J M J8K8L&JDJ99190&&#"32673#"&546324&'&&#"3267662#"$'&5476$)oSusWu ē״ 3bZ\셄Z]cb\]遁_[_w ifmlgmjjoqjfMWaUv[\`_[_^\bd\Zcnifejqoji  lhmm L@)    OPNO N OP 9991<<22903#######5R6R}^k66C-Cq#@103q#\V'7 @  Q Q1<204632#"&%4632#"&FC-.C@10@E..@=12A-CB.1@@1,DB.2?@)?@#     <291<2<29990!!!!'7!5!!5!^X{;YVssFss@R>@' h   91/<90#!!!!!!!!mz}d ľRϢ?V9m 7e@:8*% (+74)%4%y4s8*). (+7  .' "8999999199990&&#"32676654&''7&5476$327#"&'ScyVVZMHTOh{UTZIMPgnupohPhmupp䝀r?@ZVU|wLP?>YUU}l^bRemmtTRPemlsRR /D@$ -!' $-'-0 $RR*0999919999032654&#"&&#"32676632#"&'#"&546323Xfz[U3Viz[UsC``LG`a/_]nl?__pl튄٤xڣ~)2@    <2<21<<0%!5!!#!5!RvuuuXuX! *@    <229190%!55b/buu}e! *@     <<29190%!555bb-uueq}CD}C@# qq    229991/<<2<290!!5!'!5!33!!!!X[uy{wL{yV-&C@)' # $ '&$#  ' %'912<99990326733267#"&'#"&'#j~rg}-y %#  .FE)`W,q<-!D%mv'4@ !}FMFMDEu#)6@'! '!* $$*99919906654&#"#"&54632#"&546324&#"32 OH5-,_͓ٞc ZRqXTo\QN+;]Hզ^uuzw *@    91990!!!!53#1 ?褋-wX@SS120!#!#c-#b@6  " $   #" #T#$99999991/<2299990#3267#"&5467!##"#663!sn092@#nt!TŞ'7; bBa91gc0^>Eu/ (2@# ) &  UV U)991026732#"&54&#"#"&54632-g  L\>35@ i +)1^I]?4/AKNA0;F9X^rvL;5>:&D +@   29919904&#"326#5#"&546325fktwnivss)PU(smynt~{uFIHGxB+ #@  $ $1032654&#"4676632#"&'&&hhhiz754ML558856JM457weeffG~11343/~FD|224312|dD@#   XWX W 9991/<2990%!5654#"!5!&5! Ly*+yoP4o0Ikυ5/ <C@H"A+:7 63%+(!A=./{ 63= /3{:A{/+:D76>.( 0"!>...=0..YD<999991999999999032654&#"#"&546326654&#"566326632!3267#"&!&&#"xqutw})/èO9>IPK.%_3wEՎ/}pZ_gX[cdbg-,{&&k]cg!ebP|~hyL9!+k@:,#"  & {&{,#")  , ). 6).,,<9999999919999999077&&54327#"&'32654&&&#"Lu65VBwIt::^>%Aɰl'H@%!$  '!!$ (? (<219999990#"$#"5663232675#"$#"566323267k\bdRjYo}VU}h[ddS}jYo{XW|KGGXIHGWIGHVIHFVV!@91/90%!bDC#JJr#?D1\ 9@!    Z Z 9991<290%j1i1CHCD1\ =@#      Z Z 9991<2907'7'7bhpdk1HLTCilHLTCi#'''}'$C'`'$'m`'2{'m6J@(#5&2h&s2y!5"  ,"7<<<<21/99032676654&'&&#"!!!!!#"&'&5476$32%[WTyzUUY[UUwxTWYVVsrSvqq"tyWTXZTVzwUU[YUWa\Ϣ52m\КpmrV+7_@3&/%55{%"{/{) 82%&.2.,.,8299991<99999990&&#"#"&'&&54326632!3267#"&32654&#"`}r \5ہB9w$xJ8|-\9yEՎŠ1yss\o""FކecaicdP|~iɑ@/10!!u@/105!uuT'2@h99991<290'''>->V%2@h99991<290%);/;y@ h991990'Ἤ>y@ h991990y;= ,@   [\[ <<102#"&546!52#"&546V/DC00CDRX0CC01BDmD//DC00C1uuC/0CC0/C#u"@91990 9%- B7'\^'<J'@103}}'V^ /@H&!.$!  -' % !/0/%*&-'*$ a^_.&a^*02299999999912299999999904&#"32666327'#"&''7&&5467'7<}GG}}=\\'^?PWStxkLTH ?@? <6# ?  <,)0 0  ,6&  &39,-9 @2<299991/<29999990!5!33#3332654&#"'232654&#"#6632#"&5P/mml}}'n^N[dfc _bYKQZlVNR_~Pho >KTLOQRKH@KGBkpteIe lRpva')Um1R'*B'ZB+'JJd', 'P)'6?)'VmT'&h'T^'F)mT'&h'T^'F)Z $H@' " { { !#0 2.%<2991/<29904&#"3263##5#"5432!5!\6jr4hřscj gfy`@10!!-ZH @  104632#"&F12GG22E1FF12EEf\\N^'h9ZV1^NNPPf\y\V`sq-^wqs+qm+m13mmHPN;NVNNZTZPPZuuVZB?`w sm+3mZZZZZZTPPPPiuVVVVV````3Z7V3o3L)wwqmhuB/jDjB%d5L+9LTDTDm 9mVV{T{V\y\y VVDD333Z\\y{V9+++{mmRqm7B PB?sV -LJJJHHmZPB?mTmTZ\  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~D: ~1BSax~ & 0 : !""""+"H"e%  0AR^x}  0 9 !""""+"H"`%^CiTjq_8 (BJbcdefghjikmlnoqprsutvwxzy{}|~!u  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ sfthyphenperiodcentered####NpWf}$OnfY8"Ei .  x  0 a ) P o 1W|(pBC}N-U6\] -:GTan{ %2?LYfs-dfD_AYHy U !!l!""K"#I#$B$l$$%"%%%&%&6&6&C&P&]&']'r'''((!(e(((()Q)t))*O***+++++++++, ,,$,1,,,,,,,-=-R-x--. .1.Z.y....///9/000(0n0011#1j1223,393F3S3`3m3z33334 4"4A( &&*K-r2K4K6&7D9:;````````m`m`m`m``c`````c.\\\\Y Y ```l`l`l`l``.`m`m`m`m`m`l`l`l`l`cc#;-\\\ lM1'c.ccc8t&l`&l`&l` xl`:l?Ll?Jl?Ll??0550*\\\\\\|1 Y EYEYEY!=l?Ltt4%@V]$`X'^] 3BL!8t-t-t-t!! M]|x[B73yY9!|xx)MMMRh?E?EZ\\\l,M\\&/\`@ ~I~ (8    " & 0 : D !"!&""""""""+"H"`"e%  L &8    & 0 9 D !"!&""""""""+"H"`"d%rPON5&UPJIF=5,PMrogfda^R6۸P:DE&'FGe   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdeivhimk|torzn|wk{twva}p`gr{C~uqlfcdfgFG<pqnoj}ehmHNuJKL~OMID,,,,,,,,J`H 8HVn~4P Z< <j:Lh|D  2 F Z j |  D x " D f 8 j  4 H d 4ff&j@ | BRtH0<HT`lxHT`lx&2X<HT`lx(4@r".:FR^jv(fr~&2>JVdp|(4R^jv ".:FR^jv*6BNZfr~&2>JVbnz  " \ !!"!6!N!j!!!!"" "" "*"4">"H"R"\"f"p"z""""""""""##(#@#d##$H$\$p$$$% %P%f%%%%%&&J&~&&' '('B'''(&(6(F(V(f(((((() ) )D)t)))))** *.*<*J*XDdU./<2<2/<2<23!%!!D $hUD 74632#"&3R99R)(:;Pp8RR9:)(P$Pm#!#!B+C+mm*#3#'!'#53#53!!!$;9<9$75'85$(V""ˬWWu![5&#"#5.'7327654'.'&'&54>75vDXXt/.y(qfe1-ADqnJI=y^=a.WQvzmhNG/.?7a-z- .A>GFoc<I+WImH|eJM#.=47632#"'&732654&#"'47632#"'&7327654'&#"MoqnnܛmltSQttRRt3mneoqnnomml9:SR9::9SQtkklkmmTttRQtt&>B:kklkjjllT::::RR::t|!$0B 7>7!'#"'&54?>7&5476323277>7654&#" -P%[?ޚ͏e fh98 43MP`1@RE?++6:[ 1^0(jEۃEbbdQQ c<>bDvvEc0 5!3!!#cHƺPP,!'!N?Q!!BQ 74632#"&R99R)(:;Pp8RR9:)(PZ'dRSW"7632#"'&327654'&#"WۚڜYYZZZZZZq !7!#+t.3@"%!!>7654&#"#!2?Ok9p"8ӏC"da0^Kl膆~y?vW/#+527654'&#"#>32# '&'3327654'&3[BAha53$ˀ8pqJJoA!:c>?/0rxwvqVpwKMvB&{ 3##5! 4'L !>32# 7327654'&#"#!5$L ᐑͱIJJk__^^rM~. |32be^a,q>!>32#"'&5474'&#"3276$* ҞUVyz{xUV> Ԙ̷z{UVyyUVb!5!'d2.u]"%4&547632#"'&532654&#"327654&#"d]56֋CD`___JKkjKKjiLK#xϼ~~~}~2``xcCD__kMLKLjkKKq"#'#"'&547632327654'&#"̫q* ӜmUVyyUVVUzxUV5՗˴}UVUVyyVUUV 74632#"&4632#"'&R99R)(:;PR99R)(::)(p8RR9:)(P,7RR9:)()(,'4632#"'&㘶R99R)(::)(!N?8RR9:)()(n\ 5n \c,5!5!c))pm[75 5 fh|p0>3#"'&5476767654&#"#.547632324632#"'&kQiab=>'(SEER kjmE +nR99R)(9;()ј]ydetFG56!!EEQPE7(iiԟd?;(V+ 98RR9:)(()l#?M327654'&! 32%7! '&'&5! #"'#"'&54763274'&#"3260?>WGF꾽DE|4 ӛWV_Cvw.{nlyyg5?A]e@AhRi5K{y隔Zxw~nS䣥y~wvo~]>>NMxhi !# # DkwiR N*332#32654&+327654'&+\]@A&'{GHM`ixIy|vRJNKIv9;XY[s*ih}Mqspmq>CgdDCl.&&#"327>7# '&7!2.H{V0g9}쩫(D0qI'c3!2#'32767654'&!#D金v}WihhTi.-ln++!#L  !!!!!! YkT- !!!#!-!lQ&$!! '&76!2&!"32767!~)(_Qʬ$3|lIPJJtu% !3#!#3f\/##"'732765uv#!5!c--0327653#"'&5AaaA阫^\Yb ! K[.|uS 3 NsbpSFk ! ! ! !W '6 C' O ! !# ab mieE%!!!5!-fp3!!Yt3Z5sSlf#5!!5/Y$,c#!#0,+!!zd7|nL`>3#5#"'&5432327654'&#"\⋠ʄŪKMu}MMMM{tNM2f$XYVYYWXYl 632#"'#4'&#"3276oŃȩLMt|NMLL|uMNČᓒfGXZWVUWWX`&'&#"32767#"'&5432M= 3#5#"'&547632327654'&#"\ⅨȄūKMu}MMMM{tNMgfڒXYVYYWXY`#!32767#"'&547632'&#"F EElT76E,bpLڄ}|/)H;* xGF((ljKkE 珍/B*El##5347632'&#"3wPP@X<[I/<xLj# %+*x`<!1%#"'&'3325#"'&547632534'&#"3276< F~ FwҸzLMxJCCIKEEi(nOilH'[/ՕnUW_UU]^U3632#4&#"#xcTS\v0/lk]@uiIJ)l#4632#"&o"V<=+++*==V2;V+*==++Vl#4632#"&o"V<=+++*==V ;V+*==++V ! !#o=.Y$;g$o#og 36763263 #4'&#"##"#A.1J`jI"#P]U_WZDq:;  3632#4'&#"#v_R('gp/.Zuk[ 78JI*`o432#"'&732654'&#"`.ژ۔NPOP(۔ܒUVUVl#3632#"'4'&#"3276oᅩɂƫLMu|ML|uLNjےtXYYWXX`> #"'&54763253327654'&#"\łǩLLu|MNMM{tNMޕj XZVWYWXY 367632&#"#>01CYag@=WA:.L&&#"#"'73254'.'&'&547632ĺ,A,|hef()9rX"D#b(3WY(cZ) 87Mn_ZYF&h<4 00=`SS5%3 ##5333v``e3253#"'&'&5oErrF/uUL=cc=LD4 3  # '' 3 {,s m !! ! ! Al N%! 3!J*0 G%!!!5!Cw_Tt%#"37#"&54&'5>5463tZ6RY9GF3232?632#"'&#"#"BggMT=.=MOPmZI"# @-#xF@(LUBAN8Y #"&547632#)(:9R():9R59)(R::()RQ>&.'&#"32767#5.'&'&5%5 zb(G=RQPZ;7#"'&#"'6767654'!53&5476324'&#"- 5z8+ )COPtTC7@(]7@k#a׊"ByNNjf(.q 1:+p:<;@4Te*3 O@EAnjUCONzf '+7&547'76327'#"'4'&#"32762nn株om~圭gfhgghgh-䘭ol⤢omgihgghgh('!533 33!!!#!5]QT^CEi3#3#mQI7G7332654'&'.547&547632#&#"#"'&'&327654'&#"am00Ֆ۴zy`>=fܢ21v]&'|}zde8:DEb`DEEDabCEmd],-DSblzy;:]~:$OwSRI?DGfvw42Z[_DBBB^_BBCBt47632#"'&%47632#"&**;;***,9<*)*+:<)**,9;T:)**);<*)*,::)**);<*)TM(-?'&#"32?#"5432! '&47676!2 ! 764'&'&z~]]]_z}(ӄ|,LMՂML~_^_[\bHCe*PqF]Z~^3#5#"&54632327654'&#"7V_~|iP-.HK////JH..9JNR4425PO5341]     ,),onqonM9j!!5!QQ!!BQM(); ##32'3254+! '&47676!2 ! 764'&'&-Yc55R$,LMՂML~}oEPWJH|z*PqF]Z~?!!C?\2#"'&5476"327654'&}ZZ[Z[Z[[E0/`BD.0/.[Z[ZZ[XZ--BFb11FA-.c0 5!3!!#5!cHH)ƺPo:Mj!!>7654&#"#!2UoR0?#XA$XZ)P?9Q8+=R0RQyJJ$jFfZ%527654&#"#>32# 3327654&u`4L=mOQanXYA**XI7E{~IJq|FD~QP*+CNDd '{Ll#33253#"'o῿Frta/uUL=c3%$#"'&5)###wbb̀=լhk y 4632#"&R99R)(:;P8RR9:)(P'I5j'#73#Xyb^4632#"'&732654.#"^____[]^QQ`.A'(A/ZYZY[[UecT*C0/C|? 7 ' 7 'Ԗ~Օnono# #73#'%3##5!\Xmn.cc*uyb>B䋂pK# $#73#'%!!>7654&#"#!2\XmnVoQ1A"XA$XZ*Q=yb>Bh:S4-;R0RQxLI#jF7~#%)25527654&#"#>32# 3327654&'%3##5!F`4L=mOQanXYA**Xmn.cc+tI7E{~IJq|FD~QP*+CND>B䋂p|q,9#4763232654'3#"&54767654&#"#"&54632Pj>=('TEER ֡mFD2n)(:9RR99RԖ_yʑtGF65!!DEQQE8(ԟd@:'W1D9)(R:9RR2&(2&(K&(&(&(I&(I!#!!!!!! OpaVbi^qLl.&&* 2&, 2&, K&,_ &,e2&02&0K&0z&0.c#3#53!2#'3276765'&!#!!D金v}WihhTiL.-ln++!"LZ&5Ul2&6l2&64lK&6l&6tl&6[@ 7   'IJJJmJ~I~Jl-%7! ''7&76! &#" 3254y&ꦀG:aݩL, ZauR02&< 02&<0K&<0&<2"@9#332#'3 54!#ZaOlWAMeL>,3#53547632#527654'&'52654'&#"PPr~Ɓخgj}PA@hyoz{yp9f^^W6}s`>={`>&HG``>&Hz`>&HH2`>&HN2`>&Hn*`>&HL `*/=!327#"'#"&5476324'&#"5632632'&#"327654&#"B GFje J+ĝzjk{78lh)3j8;SY<<|WRrvJHl=\i[\B45%v9&&'(;4LN`&J~`&LG1`&Lz`&LH`&Lno&_&Q&D&`o%377#"'&547632.''7&/&32654'&#"\CK-OzzޗRK=QI HQ NPOPD.|d瘕ڕmKd$*ڑUVUV&UN`o&VGb`o&Vz`o&VH$`o&VN;`o&Vn$cG5!47632#"'&47632#"'&c)j&)35LL56&&&)35LL56&&ƺ4&&L66L&)4&&L66L&)."&7#"''7&547632&#" 327654fmڸga٢=PhIUPOlؔfhהPA8Y(QRX&\G&\z&\H&\n N"`zl#3632#"'4'&#"3276oᅩɂƫLMu|ML|uLN˅ےtXYYWXX N&`ns&(`>?&Hu0&(`>&HJ- i&(MR` U&HMl.2"*`"Jzl.P&*H4`&JHl.&*K@`&JKl.K"*`"JIcK&+`&K.c#3#53!2#'3276765'&!#!!D金v}WihhTiL.-ln++!"LZ`(327654'&#"3##5#"'&547632#53FKMu}MMMM{tNMⅨȄūXYVYYWXY,ZfڒI+ s&,`?&Lu &,J3`&LJ &,6`&LK B&,M` &LM K&,`&LIlQO&.HM3`<&NHlQ".`<"NJlQ&.KF%`<&NKlQ&&.`<W&NX%H&/H,H&OH,&/gGF`@#&O#8'NZ0f1'NS^s&0?&'J",0?'J#[ &0M% &PM"0o#o2&01lx&PQH&1H,"'H6&2y&R ! !#o=.Y$;g$h2&3518t&SvBh&3r&Sh&3&SK&3KB&SKh'i %!!573*QXbb.5 #5735ᓓ9f gg6:2&5&Uzq&5{&U5K&5&UIt\Y'UGls&6J`o?&Vu'l&6JN,`o&VJl2&6`o&VOl &*!!!!!5# 7!25!327654'&#" EV~$sx?WD﨨榧-Մ76K/ ::𭭩`B$6!327!"'&'#"'&547632632'&#"32>54.#">9JInchpg=Ԙ'1KLElK''JjCNMrJIo23Uە~UU+QtJItP*TS2&9 &YzD&9W &YkK&9: &YIXlJ2&:L&ZzFlJH&:H/,J &ZHhlJ&&:~L'~GZlJO&:?'I]Z&;5%3&[K&;A5&[q&; *%3&[*0&<N&\N0s&<?&\u0&<J3&\J0I&<&\LD2&<lN&\O 0&<MR &\M~uO&>H3 '#&^HI&@H - N&`H&@cE2&A2G&azE&A}G&aKEK&AG&aI=`#3!#"'72767#737>32&#"m" ;1%;K%k+$ɮ>S)9-N'&ж^.Y;5Fa0/lJ&,0&'&#"#"'&'732654./$4763 '"502Oa@@Ƀ (Hm5T:Å k"p\ 76RqE?L۟Ջww44dp-K?7>uvM?L*'&#"#"'73254'.'&'&547632Y%,A,|hef()9rX"D#b(3WYI5cZ) 87Mn_ZYF&h<4 00=`SSt)K'=N<>t)K'aKN?d '_dAwd 77Awg 33273#"'&ݹ_^YXt47632#"&,/<>,--,>?X <,,,,>?+,Xd;47632#"'&732654&#"@@Y[?@@?Z[@?w9**99*$AX?@@@ZZ@@@@[+99**9$ !33267#"'&5476eG-O]nII.._R 1=:]Z=Bt'7>32327#"'&#",46:"Ngh8D`8[-7to)(7#45lj8.%dw ''c^cLlnLl@d'G{Vd=z{]d H{$tYN{`?u{Xg%J{'tUK{^tn{dL{dO{]d I{ ~{ [MZ3uB.sLTW 3#5!##!"zz3Q!!FQ8Q!!8Qt)!'a!N?tK''N<>N<>tK''a}KN?KN?t!''a}!N?JN?f@ 3!!#!5! >> f@3!!!!#!5!!5! >>>>EaBX2#"'&5476 \]]]_]^_X`_^__`^_ (74632#"&%4632#"'&%4632#"'&R99R)(:;PR9:R)(:;()R99R)(9;()p8RR9:)(P<8RR9:)(();8RR9:)(()M #.=M\47632#"'&732654&#"'47632#"'&7327654'&#"47632#"'&7327654'&#"MoqnnܛmltSQttRRt3mneoqnnomml9:SR9::9SQtoqnnomml9:SR9::9SQtkklkmmTttRQtt&>B:kklkjjllT::::RR::tLkklkjjllT::::RR::t]t  H,on| 7 'Ԗno#'@mm#>B& "!!67! '&!!3F)_k %DJIW NDX##5! # `$6%%RSq'ٗ'v@!B.!35!&576! !!5$4'&#"Bp/,˰nugȆwu.>uкˑ͡bӺ7O +7#"'&547632&'.'&"32654&wٚZQHG@>Q4}UUTUxy?CB~nꩨґ KJ%Cecadcʔ333%!3PW}Y !#3!53!3!53#Yǽ[[9#! !3!5 5Fs :Q~(Ol|5!|)ƺ#'@mm#>By 4632#"&R99R)(:;P8RR9:)(P!!#5!367NDբAL6U> l|)".#"'&54632632#"327654'&#"&#"32 ѡffΟ̞ڢdffd,oqF//0.GpmtF.//0Fq|fggfggo02HF2112FG21 7327657632&#"#".M'mF%\7.M&W6Z`f% D >.|p*M3232767#"/&#"'>3232767#"/&#"EqYB=)(/JRSrHw>=fQEq\F;)(/%L*StGw>=d%VF@PNBA91UF@POLm!A91M9;!!!!'7!5!7!5k~Z[xUc\A<GйGйMG9  5!59 ,MG9 5 55!M bVV,^E ZYLME@77h}(52632#"'&#"#"547632>7D)J{`5P%DHF\=+7[XADPV1suLjmZ>?;6'AFB1!F5^ufe>A!#ꕔBB7 )E!#54'&#"!!##5347632#303JI21PPtutu[J8987L\tuutE!#4'&#"!!##534763222II21PPuutu*J8987L\tuutu4632#"'&%4632#"'&T:<)**);<*)T;;TT;<*)4:T**<;***,;:TT<;T*,27@o]Z'M?2 'o1]B27H1o]tD47632#"'&%47632#"'&D*(<;***,9=()j**;;***,9<*):)**);<*)*,::)**);<*)*,d_ '_|Lldg7`|nLdQ 'ROTAw o'7'#53oK}=Q5. 33273#"'&_^ꞞYXK '3_d AwhK '_d Awl'7>32327#"'&#"46:"Ngh8D`8[-7o)(7#45lj8.,I47632#"'&732654&#",@@Y[?@@?Z[@?w9**99*$rX?@@@ZZ@@@@[+99**9$MK 77Aw2 'hoA]Bz 47632#"'&%47632#"&)*;;TT;=()y*+:;TT;;T48,*T<;T*,;:**T<;TT47632#"'&,/<>,--,>?,,;=,,,,>@+,,/|'7'#53|K}=QH5.cxW73#K}=Q5./2 ''hoAhoA]B]Bs!!Cs^s!![s?!!?M#MQ'# 1Q v     0 6D      F  ? Z ~ $  0 0  V  d p |       Copyright 1998, Neufville Digital. ALL RIGHTS RESERVED. This font is licensed, not sold, and may not be reproduced without the written consent of Neufville Digital. Parts Visualogik Technology & Design, 1998. Copyright 1998, Neufville Digital. ALL RIGHTS RESERVED. This font is licensed, not sold, and may not be reproduced without the written consent of Neufville Digital. Parts Visualogik Technology & Design, 1998.FuturaFuturaMediumMediumFutura Medium; 13.0d1e3; 2017-06-07Futura Medium; 13.0d1e3; 2017-06-07Futura MediumFutura Medium13.0d1e313.0d1e3Futura-MediumFutura-MediumFutura is a registered trademark of Bauer Types SA. Unauthorised use prohibited. ALL RIGHTS RESERVED. Neufville Digital is a trademark of Visualogik, used with the permission of Neufville SL.Futura is a registered trademark of Bauer Types SA. Unauthorised use prohibited. ALL RIGHTS RESERVED. Neufville Digital is a trademark of Visualogik, used with the permission of Neufville SL.Paul Renner (1928)Paul Renner (1928)Paul Renner (1878-1956) was a painter, typographer, typeface designer and teacher. Between 1908 and 1917 he designed thousands of books for Munich publishers in a refined traditional style. In the early 1920s he began to support the modern styles of architecture and typography, becoming a leading proponent of the New Typography. Renner is best known for designing the typeface Futura, which became a standard tool for the New Typography, and remains a popular typeface today. Futura does give a restful, almost bland impression, which accords with Renner's objectives. Futura seems classical, not only due to the form of its capitals, but also to the open, wide forms of the geometrical small letters. The typeface relies on notions of classical, yet contemporary form, - harmony and evenness of texture. Thanks to the modern digital technology Futura lives on in a greater variety than ever, offering a wide choice of typographic solutions for contemporary design in the new millennium.Paul Renner (1878-1956) was a painter, typographer, typeface designer and teacher. Between 1908 and 1917 he designed thousands of books for Munich publishers in a refined traditional style. In the early 1920s he began to support the modern styles of architecture and typography, becoming a leading proponent of the New Typography. Renner is best known for designing the typeface Futura, which became a standard tool for the New Typography, and remains a popular typeface today. Futura does give a restful, almost bland impression, which accords with Renner's objectives. Futura seems classical, not only due to the form of its capitals, but also to the open, wide forms of the geometrical small letters. The typeface relies on notions of classical, yet contemporary form, - harmony and evenness of texture. Thanks to the modern digital technology Futura lives on in a greater variety than ever, offering a wide choice of typographic solutions for contemporary design in the new millennium.http://www.neufville.comhttp://www.neufville.comhttp://www.neufville.comhttp://www.neufville.comN-MediumHalbfettMediumMoyenMedio00000̴MediumMediumMdio!@54=89MedelN-{IMedia  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ controlBS controlHT controlCR controlGS softhyphenAmacronamacronAbreveabreveAogonekaogonek Ccircumflex ccircumflex Cdotaccent cdotaccentDcarondcaronDcroatEmacronemacronEbreveebreve Edotaccent edotaccentEogonekeogonekEcaronecaron Gcircumflex gcircumflex Gdotaccent gdotaccentGcedillagcedilla Hcircumflex hcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonekIJij Jcircumflex jcircumflexKcedillakcedilla kgreenlandicLacutelacuteLcedillalcedillaLcaronlcaron Ldotaccent ldotaccentNacutenacuteNcedillancedillaNcaronncaron quoterightnOmacronomacronObreveobreve Ohungarumlaut ohungarumlautRacuteracuteRcedillarcedillaRcaronrcaronSacutesacute Scircumflex scircumflexTcedillatcedillaTcarontcaronTbartbarUtildeutildeUmacronumacronUbreveubreveUringuring Uhungarumlaut uhungarumlautUogonekuogonek Wcircumflex wcircumflex Ycircumflex ycircumflexZacutezacute Zdotaccent zdotaccent Scommaaccent scommaaccentgravecmbacutecmb circumflexcmbtildecmb macroncmbbrevecmb dotaccentcmb dieresiscmbringcmbhungarumlautcmbcaroncmb commaaccent cedillacmb ogonekcmbsoliduslongoverlaycmb Deltagreek OmegagreekzerowidthjoinerEuro divisionslashbulletoperatorDieresisGravejudgeupoakuniE770uniE773uniE774uniE772ashyeaicesurehungfeeCaronAcuteeatkickuniF6C3uniE784 HungarumlautMacronoozeuniE775dotlessj ) )*+,BCCDEF~ .<DFLTlatnliga PSM .<DFLTlatnkern Tb,:HBx 2\R|*`| 4 > T b l " , > X v @ v | @ Z HHHHHH\\\\\ ***  > > > > > > " b l l l l > X X X X X v v v v Z ZH >H >H > b bB l l l l 2  " " " > > >\ X\ X   RRR| @| @* v* v* v* v 4 4 4 0 V 0 jGg (d;=>@dddX\Ggb ^m^^LBf ZTLd5/!Z\jP"fhL*.68;<=>@yHIJKVX[\]^`qGgn(6=>@  (%/+2+6%%% (1;=>?@;(16HLPQVY\ (;=>@(*.6:;THLV\`)(V*.6:;<=>@}\`VVVNGgD#( *.6HLV\   (;=>?@oR(1HLV*.6;<=>@HLV\` (;=>@[#+!"(*.16:=\>\@dHJLP%Q%VY\]^`qn (TUWY#f!"(*.6:;\HLPVY\`qqqnq#d!"(}*.6:;\HLPVY\`qo}}}}}}o}no B*68HLV\`#!"(s*.6:;dH}L}PVuW\]q`ssssssfqn`]`Q]^`G]^`O5R5[]^_`GHLMDP+Q)S!V[JGR`G;%Q?HLV\]`W]^`;W]^`G;[ ]^_`G[`J\-!"HJKLMDOPQRSTUVWXY[J\]X^^_+`ZaG9 !F"+HLO)VGJG/! "HJLSV1! "HJLSVHJLVX)! "HJLSV (;=u>w@`((ITUWY]^` (f;'=?>?@5fffV (jKVY[]^jjjV (j;'=B>B@5jjjV(\;=w>@T/ (+ -.13579AHJ!LM$OP&RY([`067=>DJV\ajmnopqrstv |""$$&)./27<=??AAFGfhooդ'`^"oPK!Q\i\imdc/resources/iclr.bst%% File: `iclr2017.bst' %% A copy of iclm2010.bst, which is a modification of `plainnl.bst' for use with natbib package %% %% Copyright 2010 Hal Daum\'e III %% Modified by J. Frnkranz %% - Changed labels from (X and Y, 2000) to (X & Y, 2000) %% %% Copyright 1993-2007 Patrick W Daly %% Max-Planck-Institut f\"ur Sonnensystemforschung %% Max-Planck-Str. 2 %% D-37191 Katlenburg-Lindau %% Germany %% E-mail: daly@mps.mpg.de %% %% This program can be redistributed and/or modified under the terms %% of the LaTeX Project Public License Distributed from CTAN %% archives in directory macros/latex/base/lppl.txt; either %% version 1 of the License, or any later version. %% % Version and source file information: % \ProvidesFile{icml2010.mbs}[2007/11/26 1.93 (PWD)] % % BibTeX `plainnat' family % version 0.99b for BibTeX versions 0.99a or later, % for LaTeX versions 2.09 and 2e. % % For use with the `natbib.sty' package; emulates the corresponding % member of the `plain' family, but with author-year citations. % % With version 6.0 of `natbib.sty', it may also be used for numerical % citations, while retaining the commands \citeauthor, \citefullauthor, % and \citeyear to print the corresponding information. % % For version 7.0 of `natbib.sty', the KEY field replaces missing % authors/editors, and the date is left blank in \bibitem. % % Includes field EID for the sequence/citation number of electronic journals % which is used instead of page numbers. % % Includes fields ISBN and ISSN. % % Includes field URL for Internet addresses. % % Includes field DOI for Digital Object Idenfifiers. % % Works best with the url.sty package of Donald Arseneau. % % Works with identical authors and year are further sorted by % citation key, to preserve any natural sequence. % ENTRY { address author booktitle chapter doi eid edition editor howpublished institution isbn issn journal key month note number organization pages publisher school series title type url volume year } {} { label extra.label sort.label short.list } INTEGERS { output.state before.all mid.sentence after.sentence after.block } FUNCTION {init.state.consts} { #0 'before.all := #1 'mid.sentence := #2 'after.sentence := #3 'after.block := } STRINGS { s t } FUNCTION {output.nonnull} { 's := output.state mid.sentence = { ", " * write$ } { output.state after.block = { add.period$ write$ newline$ "\newblock " write$ } { output.state before.all = 'write$ { add.period$ " " * write$ } if$ } if$ mid.sentence 'output.state := } if$ s } FUNCTION {output} { duplicate$ empty$ 'pop$ 'output.nonnull if$ } FUNCTION {output.check} { 't := duplicate$ empty$ { pop$ "empty " t * " in " * cite$ * warning$ } 'output.nonnull if$ } FUNCTION {fin.entry} { add.period$ write$ newline$ } FUNCTION {new.block} { output.state before.all = 'skip$ { after.block 'output.state := } if$ } FUNCTION {new.sentence} { output.state after.block = 'skip$ { output.state before.all = 'skip$ { after.sentence 'output.state := } if$ } if$ } FUNCTION {not} { { #0 } { #1 } if$ } FUNCTION {and} { 'skip$ { pop$ #0 } if$ } FUNCTION {or} { { pop$ #1 } 'skip$ if$ } FUNCTION {new.block.checka} { empty$ 'skip$ 'new.block if$ } FUNCTION {new.block.checkb} { empty$ swap$ empty$ and 'skip$ 'new.block if$ } FUNCTION {new.sentence.checka} { empty$ 'skip$ 'new.sentence if$ } FUNCTION {new.sentence.checkb} { empty$ swap$ empty$ and 'skip$ 'new.sentence if$ } FUNCTION {field.or.null} { duplicate$ empty$ { pop$ "" } 'skip$ if$ } FUNCTION {emphasize} { duplicate$ empty$ { pop$ "" } { "\emph{" swap$ * "}" * } if$ } INTEGERS { nameptr namesleft numnames } FUNCTION {format.names} { 's := #1 'nameptr := s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{ff~}{vv~}{ll}{, jj}" format.name$ 't := nameptr #1 > { namesleft #1 > { ", " * t * } { numnames #2 > { "," * } 'skip$ if$ t "others" = { " et~al." * } { " and " * t * } if$ } if$ } 't if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {format.key} { empty$ { key field.or.null } { "" } if$ } FUNCTION {format.authors} { author empty$ { "" } { author format.names } if$ } FUNCTION {format.editors} { editor empty$ { "" } { editor format.names editor num.names$ #1 > { " (eds.)" * } { " (ed.)" * } if$ } if$ } FUNCTION {format.isbn} { isbn empty$ { "" } { new.block "ISBN " isbn * } if$ } FUNCTION {format.issn} { issn empty$ { "" } { new.block "ISSN " issn * } if$ } FUNCTION {format.url} { url empty$ { "" } { new.block "URL \url{" url * "}" * } if$ } FUNCTION {format.doi} { doi empty$ { "" } { new.block "\doi{" doi * "}" * } if$ } FUNCTION {format.title} { title empty$ { "" } { title "t" change.case$ } if$ } FUNCTION {format.full.names} {'s := #1 'nameptr := s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{vv~}{ll}" format.name$ 't := nameptr #1 > { namesleft #1 > { ", " * t * } { numnames #2 > { "," * } 'skip$ if$ t "others" = { " et~al." * } { " and " * t * } if$ } if$ } 't if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {author.editor.full} { author empty$ { editor empty$ { "" } { editor format.full.names } if$ } { author format.full.names } if$ } FUNCTION {author.full} { author empty$ { "" } { author format.full.names } if$ } FUNCTION {editor.full} { editor empty$ { "" } { editor format.full.names } if$ } FUNCTION {make.full.names} { type$ "book" = type$ "inbook" = or 'author.editor.full { type$ "proceedings" = 'editor.full 'author.full if$ } if$ } FUNCTION {output.bibitem} { newline$ "\bibitem[" write$ label write$ ")" make.full.names duplicate$ short.list = { pop$ } { * } if$ "]{" * write$ cite$ write$ "}" write$ newline$ "" before.all 'output.state := } FUNCTION {n.dashify} { 't := "" { t empty$ not } { t #1 #1 substring$ "-" = { t #1 #2 substring$ "--" = not { "--" * t #2 global.max$ substring$ 't := } { { t #1 #1 substring$ "-" = } { "-" * t #2 global.max$ substring$ 't := } while$ } if$ } { t #1 #1 substring$ * t #2 global.max$ substring$ 't := } if$ } while$ } FUNCTION {format.date} { year duplicate$ empty$ { "empty year in " cite$ * warning$ pop$ "" } 'skip$ if$ month empty$ 'skip$ { month " " * swap$ * } if$ extra.label * } FUNCTION {format.btitle} { title emphasize } FUNCTION {tie.or.space.connect} { duplicate$ text.length$ #3 < { "~" } { " " } if$ swap$ * * } FUNCTION {either.or.check} { empty$ 'pop$ { "can't use both " swap$ * " fields in " * cite$ * warning$ } if$ } FUNCTION {format.bvolume} { volume empty$ { "" } { "volume" volume tie.or.space.connect series empty$ 'skip$ { " of " * series emphasize * } if$ "volume and number" number either.or.check } if$ } FUNCTION {format.number.series} { volume empty$ { number empty$ { series field.or.null } { output.state mid.sentence = { "number" } { "Number" } if$ number tie.or.space.connect series empty$ { "there's a number but no series in " cite$ * warning$ } { " in " * series * } if$ } if$ } { "" } if$ } FUNCTION {format.edition} { edition empty$ { "" } { output.state mid.sentence = { edition "l" change.case$ " edition" * } { edition "t" change.case$ " edition" * } if$ } if$ } INTEGERS { multiresult } FUNCTION {multi.page.check} { 't := #0 'multiresult := { multiresult not t empty$ not and } { t #1 #1 substring$ duplicate$ "-" = swap$ duplicate$ "," = swap$ "+" = or or { #1 'multiresult := } { t #2 global.max$ substring$ 't := } if$ } while$ multiresult } FUNCTION {format.pages} { pages empty$ { "" } { pages multi.page.check { "pp.\ " pages n.dashify tie.or.space.connect } { "pp.\ " pages tie.or.space.connect } if$ } if$ } FUNCTION {format.eid} { eid empty$ { "" } { "art." eid tie.or.space.connect } if$ } FUNCTION {format.vol.num.pages} { volume field.or.null number empty$ 'skip$ { "\penalty0 (" number * ")" * * volume empty$ { "there's a number but no volume in " cite$ * warning$ } 'skip$ if$ } if$ pages empty$ 'skip$ { duplicate$ empty$ { pop$ format.pages } { ":\penalty0 " * pages n.dashify * } if$ } if$ } FUNCTION {format.vol.num.eid} { volume field.or.null number empty$ 'skip$ { "\penalty0 (" number * ")" * * volume empty$ { "there's a number but no volume in " cite$ * warning$ } 'skip$ if$ } if$ eid empty$ 'skip$ { duplicate$ empty$ { pop$ format.eid } { ":\penalty0 " * eid * } if$ } if$ } FUNCTION {format.chapter.pages} { chapter empty$ 'format.pages { type empty$ { "chapter" } { type "l" change.case$ } if$ chapter tie.or.space.connect pages empty$ 'skip$ { ", " * format.pages * } if$ } if$ } FUNCTION {format.in.ed.booktitle} { booktitle empty$ { "" } { editor empty$ { "In " booktitle emphasize * } { "In " format.editors * ", " * booktitle emphasize * } if$ } if$ } FUNCTION {empty.misc.check} { author empty$ title empty$ howpublished empty$ month empty$ year empty$ note empty$ and and and and and key empty$ not and { "all relevant fields are empty in " cite$ * warning$ } 'skip$ if$ } FUNCTION {format.thesis.type} { type empty$ 'skip$ { pop$ type "t" change.case$ } if$ } FUNCTION {format.tr.number} { type empty$ { "Technical Report" } 'type if$ number empty$ { "t" change.case$ } { number tie.or.space.connect } if$ } FUNCTION {format.article.crossref} { key empty$ { journal empty$ { "need key or journal for " cite$ * " to crossref " * crossref * warning$ "" } { "In \emph{" journal * "}" * } if$ } { "In " } if$ " \citet{" * crossref * "}" * } FUNCTION {format.book.crossref} { volume empty$ { "empty volume in " cite$ * "'s crossref of " * crossref * warning$ "In " } { "Volume" volume tie.or.space.connect " of " * } if$ editor empty$ editor field.or.null author field.or.null = or { key empty$ { series empty$ { "need editor, key, or series for " cite$ * " to crossref " * crossref * warning$ "" * } { "\emph{" * series * "}" * } if$ } 'skip$ if$ } 'skip$ if$ " \citet{" * crossref * "}" * } FUNCTION {format.incoll.inproc.crossref} { editor empty$ editor field.or.null author field.or.null = or { key empty$ { booktitle empty$ { "need editor, key, or booktitle for " cite$ * " to crossref " * crossref * warning$ "" } { "In \emph{" booktitle * "}" * } if$ } { "In " } if$ } { "In " } if$ " \citet{" * crossref * "}" * } FUNCTION {article} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { journal emphasize "journal" output.check eid empty$ { format.vol.num.pages output } { format.vol.num.eid output } if$ format.date "year" output.check } { format.article.crossref output.nonnull eid empty$ { format.pages output } { format.eid output } if$ } if$ format.issn output format.doi output format.url output new.block note output fin.entry } FUNCTION {book} { output.bibitem author empty$ { format.editors "author and editor" output.check editor format.key output } { format.authors output.nonnull crossref missing$ { "author and editor" editor either.or.check } 'skip$ if$ } if$ new.block format.btitle "title" output.check crossref missing$ { format.bvolume output new.block format.number.series output new.sentence publisher "publisher" output.check address output } { new.block format.book.crossref output.nonnull } if$ format.edition output format.date "year" output.check format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {booklet} { output.bibitem format.authors output author format.key output new.block format.title "title" output.check howpublished address new.block.checkb howpublished output address output format.date output format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {inbook} { output.bibitem author empty$ { format.editors "author and editor" output.check editor format.key output } { format.authors output.nonnull crossref missing$ { "author and editor" editor either.or.check } 'skip$ if$ } if$ new.block format.btitle "title" output.check crossref missing$ { format.bvolume output format.chapter.pages "chapter and pages" output.check new.block format.number.series output new.sentence publisher "publisher" output.check address output } { format.chapter.pages "chapter and pages" output.check new.block format.book.crossref output.nonnull } if$ format.edition output format.date "year" output.check format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {incollection} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { format.in.ed.booktitle "booktitle" output.check format.bvolume output format.number.series output format.chapter.pages output new.sentence publisher "publisher" output.check address output format.edition output format.date "year" output.check } { format.incoll.inproc.crossref output.nonnull format.chapter.pages output } if$ format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {inproceedings} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { format.in.ed.booktitle "booktitle" output.check format.bvolume output format.number.series output format.pages output address empty$ { organization publisher new.sentence.checkb organization output publisher output format.date "year" output.check } { address output.nonnull format.date "year" output.check new.sentence organization output publisher output } if$ } { format.incoll.inproc.crossref output.nonnull format.pages output } if$ format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {conference} { inproceedings } FUNCTION {manual} { output.bibitem format.authors output author format.key output new.block format.btitle "title" output.check organization address new.block.checkb organization output address output format.edition output format.date output format.url output new.block note output fin.entry } FUNCTION {mastersthesis} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block "Master's thesis" format.thesis.type output.nonnull school "school" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {misc} { output.bibitem format.authors output author format.key output title howpublished new.block.checkb format.title output howpublished new.block.checka howpublished output format.date output format.issn output format.url output new.block note output fin.entry empty.misc.check } FUNCTION {phdthesis} { output.bibitem format.authors "author" output.check author format.key output new.block format.btitle "title" output.check new.block "PhD thesis" format.thesis.type output.nonnull school "school" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {proceedings} { output.bibitem format.editors output editor format.key output new.block format.btitle "title" output.check format.bvolume output format.number.series output address output format.date "year" output.check new.sentence organization output publisher output format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {techreport} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block format.tr.number output.nonnull institution "institution" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {unpublished} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block note "note" output.check format.date output format.url output fin.entry } FUNCTION {default.type} { misc } MACRO {jan} {"January"} MACRO {feb} {"February"} MACRO {mar} {"March"} MACRO {apr} {"April"} MACRO {may} {"May"} MACRO {jun} {"June"} MACRO {jul} {"July"} MACRO {aug} {"August"} MACRO {sep} {"September"} MACRO {oct} {"October"} MACRO {nov} {"November"} MACRO {dec} {"December"} MACRO {acmcs} {"ACM Computing Surveys"} MACRO {acta} {"Acta Informatica"} MACRO {cacm} {"Communications of the ACM"} MACRO {ibmjrd} {"IBM Journal of Research and Development"} MACRO {ibmsj} {"IBM Systems Journal"} MACRO {ieeese} {"IEEE Transactions on Software Engineering"} MACRO {ieeetc} {"IEEE Transactions on Computers"} MACRO {ieeetcad} {"IEEE Transactions on Computer-Aided Design of Integrated Circuits"} MACRO {ipl} {"Information Processing Letters"} MACRO {jacm} {"Journal of the ACM"} MACRO {jcss} {"Journal of Computer and System Sciences"} MACRO {scp} {"Science of Computer Programming"} MACRO {sicomp} {"SIAM Journal on Computing"} MACRO {tocs} {"ACM Transactions on Computer Systems"} MACRO {tods} {"ACM Transactions on Database Systems"} MACRO {tog} {"ACM Transactions on Graphics"} MACRO {toms} {"ACM Transactions on Mathematical Software"} MACRO {toois} {"ACM Transactions on Office Information Systems"} MACRO {toplas} {"ACM Transactions on Programming Languages and Systems"} MACRO {tcs} {"Theoretical Computer Science"} READ FUNCTION {sortify} { purify$ "l" change.case$ } INTEGERS { len } FUNCTION {chop.word} { 's := 'len := s #1 len substring$ = { s len #1 + global.max$ substring$ } 's if$ } FUNCTION {format.lab.names} { 's := s #1 "{vv~}{ll}" format.name$ s num.names$ duplicate$ #2 > { pop$ " et~al." * } { #2 < 'skip$ { s #2 "{ff }{vv }{ll}{ jj}" format.name$ "others" = { " et~al." * } { " \& " * s #2 "{vv~}{ll}" format.name$ * } if$ } if$ } if$ } FUNCTION {author.key.label} { author empty$ { key empty$ { cite$ #1 #3 substring$ } 'key if$ } { author format.lab.names } if$ } FUNCTION {author.editor.key.label} { author empty$ { editor empty$ { key empty$ { cite$ #1 #3 substring$ } 'key if$ } { editor format.lab.names } if$ } { author format.lab.names } if$ } FUNCTION {author.key.organization.label} { author empty$ { key empty$ { organization empty$ { cite$ #1 #3 substring$ } { "The " #4 organization chop.word #3 text.prefix$ } if$ } 'key if$ } { author format.lab.names } if$ } FUNCTION {editor.key.organization.label} { editor empty$ { key empty$ { organization empty$ { cite$ #1 #3 substring$ } { "The " #4 organization chop.word #3 text.prefix$ } if$ } 'key if$ } { editor format.lab.names } if$ } FUNCTION {calc.short.authors} { type$ "book" = type$ "inbook" = or 'author.editor.key.label { type$ "proceedings" = 'editor.key.organization.label { type$ "manual" = 'author.key.organization.label 'author.key.label if$ } if$ } if$ 'short.list := } FUNCTION {calc.label} { calc.short.authors short.list "(" * year duplicate$ empty$ short.list key field.or.null = or { pop$ "" } 'skip$ if$ * 'label := } FUNCTION {sort.format.names} { 's := #1 'nameptr := "" s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{vv{ } }{ll{ }}{ ff{ }}{ jj{ }}" format.name$ 't := nameptr #1 > { " " * namesleft #1 = t "others" = and { "zzzzz" * } { numnames #2 > nameptr #2 = and { "zz" * year field.or.null * " " * } 'skip$ if$ t sortify * } if$ } { t sortify * } if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {sort.format.title} { 't := "A " #2 "An " #3 "The " #4 t chop.word chop.word chop.word sortify #1 global.max$ substring$ } FUNCTION {author.sort} { author empty$ { key empty$ { "to sort, need author or key in " cite$ * warning$ "" } { key sortify } if$ } { author sort.format.names } if$ } FUNCTION {author.editor.sort} { author empty$ { editor empty$ { key empty$ { "to sort, need author, editor, or key in " cite$ * warning$ "" } { key sortify } if$ } { editor sort.format.names } if$ } { author sort.format.names } if$ } FUNCTION {author.organization.sort} { author empty$ { organization empty$ { key empty$ { "to sort, need author, organization, or key in " cite$ * warning$ "" } { key sortify } if$ } { "The " #4 organization chop.word sortify } if$ } { author sort.format.names } if$ } FUNCTION {editor.organization.sort} { editor empty$ { organization empty$ { key empty$ { "to sort, need editor, organization, or key in " cite$ * warning$ "" } { key sortify } if$ } { "The " #4 organization chop.word sortify } if$ } { editor sort.format.names } if$ } FUNCTION {presort} { calc.label label sortify " " * type$ "book" = type$ "inbook" = or 'author.editor.sort { type$ "proceedings" = 'editor.organization.sort { type$ "manual" = 'author.organization.sort 'author.sort if$ } if$ } if$ " " * year field.or.null sortify * " " * cite$ * #1 entry.max$ substring$ 'sort.label := sort.label * #1 entry.max$ substring$ 'sort.key$ := } ITERATE {presort} SORT STRINGS { longest.label last.label next.extra } INTEGERS { longest.label.width last.extra.num number.label } FUNCTION {initialize.longest.label} { "" 'longest.label := #0 int.to.chr$ 'last.label := "" 'next.extra := #0 'longest.label.width := #0 'last.extra.num := #0 'number.label := } FUNCTION {forward.pass} { last.label label = { last.extra.num #1 + 'last.extra.num := last.extra.num int.to.chr$ 'extra.label := } { "a" chr.to.int$ 'last.extra.num := "" 'extra.label := label 'last.label := } if$ number.label #1 + 'number.label := } FUNCTION {reverse.pass} { next.extra "b" = { "a" 'extra.label := } 'skip$ if$ extra.label 'next.extra := extra.label duplicate$ empty$ 'skip$ { "{\natexlab{" swap$ * "}}" * } if$ 'extra.label := label extra.label * 'label := } EXECUTE {initialize.longest.label} ITERATE {forward.pass} REVERSE {reverse.pass} FUNCTION {bib.sort.order} { sort.label 'sort.key$ := } ITERATE {bib.sort.order} SORT FUNCTION {begin.bib} { preamble$ empty$ 'skip$ { preamble$ write$ newline$ } if$ "\begin{thebibliography}{" number.label int.to.str$ * "}" * write$ newline$ "\providecommand{\natexlab}[1]{#1}" write$ newline$ "\providecommand{\url}[1]{\texttt{#1}}" write$ newline$ "\expandafter\ifx\csname urlstyle\endcsname\relax" write$ newline$ " \providecommand{\doi}[1]{doi: #1}\else" write$ newline$ " \providecommand{\doi}{doi: \begingroup \urlstyle{rm}\Url}\fi" write$ newline$ } EXECUTE {begin.bib} EXECUTE {init.state.consts} ITERATE {call.type$} FUNCTION {end.bib} { newline$ "\end{thebibliography}" write$ newline$ } EXECUTE {end.bib} PK!$##mdc/resources/iclr.sty%%%% ICLR Macros (LaTex) %%%% Adapted by Hugo Larochelle from the NIPS stylefile Macros %%%% Style File %%%% Dec 12, 1990 Rev Aug 14, 1991; Sept, 1995; April, 1997; April, 1999; October 2014 % This file can be used with Latex2e whether running in main mode, or % 2.09 compatibility mode. % % If using main mode, you need to include the commands % \documentclass{article} % \usepackage{iclr14submit_e,times} % % Change the overall width of the page. If these parameters are % changed, they will require corresponding changes in the % maketitle section. % \usepackage{eso-pic} % used by \AddToShipoutPicture \RequirePackage{fancyhdr} \RequirePackage{natbib} % modification to natbib citations \setcitestyle{authoryear,round,citesep={;},aysep={,},yysep={;}} \renewcommand{\topfraction}{0.95} % let figure take up nearly whole page \renewcommand{\textfraction}{0.05} % let figure take up nearly whole page % Define iclrfinal, set to true if iclrfinalcopy is defined \newif\ificlrfinal \iclrfinalfalse \def\iclrfinalcopy{\iclrfinaltrue} \font\iclrtenhv = phvb at 8pt % Specify the dimensions of each page \setlength{\paperheight}{11in} \setlength{\paperwidth}{8.5in} \oddsidemargin .5in % Note \oddsidemargin = \evensidemargin \evensidemargin .5in \marginparwidth 0.07 true in %\marginparwidth 0.75 true in %\topmargin 0 true pt % Nominal distance from top of page to top of %\topmargin 0.125in \topmargin -0.625in \addtolength{\headsep}{0.25in} \textheight 9.0 true in % Height of text (including footnotes & figures) \textwidth 5.5 true in % Width of text line. \widowpenalty=10000 \clubpenalty=10000 % \thispagestyle{empty} \pagestyle{empty} \flushbottom \sloppy % We're never going to need a table of contents, so just flush it to % save space --- suggested by drstrip@sandia-2 \def\addcontentsline#1#2#3{} % Title stuff, taken from deproc. \def\maketitle{\par \begingroup \def\thefootnote{\fnsymbol{footnote}} \def\@makefnmark{\hbox to 0pt{$^{\@thefnmark}$\hss}} % for perfect author % name centering % The footnote-mark was overlapping the footnote-text, % added the following to fix this problem (MK) \long\def\@makefntext##1{\parindent 1em\noindent \hbox to1.8em{\hss $\m@th ^{\@thefnmark}$}##1} \@maketitle \@thanks \endgroup \setcounter{footnote}{0} \let\maketitle\relax \let\@maketitle\relax \gdef\@thanks{}\gdef\@author{}\gdef\@title{}\let\thanks\relax} % The toptitlebar has been raised to top-justify the first page \usepackage{fancyhdr} \pagestyle{fancy} \fancyhead{} % Title (includes both anonimized and non-anonimized versions) \def\@maketitle{\vbox{\hsize\textwidth %\linewidth\hsize \vskip 0.1in \toptitlebar \centering {\LARGE\sc \@title\par} %\bottomtitlebar % \vskip 0.1in % minus \ificlrfinal \lhead{Published as a conference paper at ICLR 2020} \def\And{\end{tabular}\hfil\linebreak[0]\hfil \begin{tabular}[t]{l}\bf\rule{\z@}{24pt}\ignorespaces}% \def\AND{\end{tabular}\hfil\linebreak[4]\hfil \begin{tabular}[t]{l}\bf\rule{\z@}{24pt}\ignorespaces}% \begin{tabular}[t]{l}\bf\rule{\z@}{24pt}\@author\end{tabular}% \else \lhead{Under review as a conference paper at ICLR 2020} \def\And{\end{tabular}\hfil\linebreak[0]\hfil \begin{tabular}[t]{l}\bf\rule{\z@}{24pt}\ignorespaces}% \def\AND{\end{tabular}\hfil\linebreak[4]\hfil \begin{tabular}[t]{l}\bf\rule{\z@}{24pt}\ignorespaces}% \begin{tabular}[t]{l}\bf\rule{\z@}{24pt}Anonymous authors\\Paper under double-blind review\end{tabular}% \fi \vskip 0.3in minus 0.1in}} \renewenvironment{abstract}{\vskip.075in\centerline{\large\sc Abstract}\vspace{0.5ex}\begin{quote}}{\par\end{quote}\vskip 1ex} % sections with less space \def\section{\@startsection {section}{1}{\z@}{-2.0ex plus -0.5ex minus -.2ex}{1.5ex plus 0.3ex minus0.2ex}{\large\sc\raggedright}} \def\subsection{\@startsection{subsection}{2}{\z@}{-1.8ex plus -0.5ex minus -.2ex}{0.8ex plus .2ex}{\normalsize\sc\raggedright}} \def\subsubsection{\@startsection{subsubsection}{3}{\z@}{-1.5ex plus -0.5ex minus -.2ex}{0.5ex plus .2ex}{\normalsize\sc\raggedright}} \def\paragraph{\@startsection{paragraph}{4}{\z@}{1.5ex plus 0.5ex minus .2ex}{-1em}{\normalsize\bf}} \def\subparagraph{\@startsection{subparagraph}{5}{\z@}{1.5ex plus 0.5ex minus .2ex}{-1em}{\normalsize\sc}} \def\subsubsubsection{\vskip 5pt{\noindent\normalsize\rm\raggedright}} % Footnotes \footnotesep 6.65pt % \skip\footins 9pt plus 4pt minus 2pt \def\footnoterule{\kern-3pt \hrule width 12pc \kern 2.6pt } \setcounter{footnote}{0} % Lists and paragraphs \parindent 0pt \topsep 4pt plus 1pt minus 2pt \partopsep 1pt plus 0.5pt minus 0.5pt \itemsep 2pt plus 1pt minus 0.5pt \parsep 2pt plus 1pt minus 0.5pt \parskip .5pc %\leftmargin2em \leftmargin3pc \leftmargini\leftmargin \leftmarginii 2em \leftmarginiii 1.5em \leftmarginiv 1.0em \leftmarginv .5em %\labelsep \labelsep 5pt \def\@listi{\leftmargin\leftmargini} \def\@listii{\leftmargin\leftmarginii \labelwidth\leftmarginii\advance\labelwidth-\labelsep \topsep 2pt plus 1pt minus 0.5pt \parsep 1pt plus 0.5pt minus 0.5pt \itemsep \parsep} \def\@listiii{\leftmargin\leftmarginiii \labelwidth\leftmarginiii\advance\labelwidth-\labelsep \topsep 1pt plus 0.5pt minus 0.5pt \parsep \z@ \partopsep 0.5pt plus 0pt minus 0.5pt \itemsep \topsep} \def\@listiv{\leftmargin\leftmarginiv \labelwidth\leftmarginiv\advance\labelwidth-\labelsep} \def\@listv{\leftmargin\leftmarginv \labelwidth\leftmarginv\advance\labelwidth-\labelsep} \def\@listvi{\leftmargin\leftmarginvi \labelwidth\leftmarginvi\advance\labelwidth-\labelsep} \abovedisplayskip 7pt plus2pt minus5pt% \belowdisplayskip \abovedisplayskip \abovedisplayshortskip 0pt plus3pt% \belowdisplayshortskip 4pt plus3pt minus3pt% % Less leading in most fonts (due to the narrow columns) % The choices were between 1-pt and 1.5-pt leading %\def\@normalsize{\@setsize\normalsize{11pt}\xpt\@xpt} % got rid of @ (MK) \def\normalsize{\@setsize\normalsize{11pt}\xpt\@xpt} \def\small{\@setsize\small{10pt}\ixpt\@ixpt} \def\footnotesize{\@setsize\footnotesize{10pt}\ixpt\@ixpt} \def\scriptsize{\@setsize\scriptsize{8pt}\viipt\@viipt} \def\tiny{\@setsize\tiny{7pt}\vipt\@vipt} \def\large{\@setsize\large{14pt}\xiipt\@xiipt} \def\Large{\@setsize\Large{16pt}\xivpt\@xivpt} \def\LARGE{\@setsize\LARGE{20pt}\xviipt\@xviipt} \def\huge{\@setsize\huge{23pt}\xxpt\@xxpt} \def\Huge{\@setsize\Huge{28pt}\xxvpt\@xxvpt} \def\toptitlebar{\hrule height4pt\vskip .25in\vskip-\parskip} \def\bottomtitlebar{\vskip .29in\vskip-\parskip\hrule height1pt\vskip .09in} % %Reduced second vskip to compensate for adding the strut in \@author %% % Vertical Ruler %% % This code is, largely, from the CVPR 2010 conference style file %% % ----- define vruler %% \makeatletter %% \newbox\iclrrulerbox %% \newcount\iclrrulercount %% \newdimen\iclrruleroffset %% \newdimen\cv@lineheight %% \newdimen\cv@boxheight %% \newbox\cv@tmpbox %% \newcount\cv@refno %% \newcount\cv@tot %% % NUMBER with left flushed zeros \fillzeros[] %% \newcount\cv@tmpc@ \newcount\cv@tmpc %% \def\fillzeros[#1]#2{\cv@tmpc@=#2\relax\ifnum\cv@tmpc@<0\cv@tmpc@=-\cv@tmpc@\fi %% \cv@tmpc=1 % %% \loop\ifnum\cv@tmpc@<10 \else \divide\cv@tmpc@ by 10 \advance\cv@tmpc by 1 \fi %% \ifnum\cv@tmpc@=10\relax\cv@tmpc@=11\relax\fi \ifnum\cv@tmpc@>10 \repeat %% \ifnum#2<0\advance\cv@tmpc1\relax-\fi %% \loop\ifnum\cv@tmpc<#1\relax0\advance\cv@tmpc1\relax\fi \ifnum\cv@tmpc<#1 \repeat %% \cv@tmpc@=#2\relax\ifnum\cv@tmpc@<0\cv@tmpc@=-\cv@tmpc@\fi \relax\the\cv@tmpc@}% %% % \makevruler[][][][][] %% \def\makevruler[#1][#2][#3][#4][#5]{\begingroup\offinterlineskip %% \textheight=#5\vbadness=10000\vfuzz=120ex\overfullrule=0pt% %% \global\setbox\iclrrulerbox=\vbox to \textheight{% %% {\parskip=0pt\hfuzz=150em\cv@boxheight=\textheight %% \cv@lineheight=#1\global\iclrrulercount=#2% %% \cv@tot\cv@boxheight\divide\cv@tot\cv@lineheight\advance\cv@tot2% %% \cv@refno1\vskip-\cv@lineheight\vskip1ex% %% \loop\setbox\cv@tmpbox=\hbox to0cm{{\iclrtenhv\hfil\fillzeros[#4]\iclrrulercount}}% %% \ht\cv@tmpbox\cv@lineheight\dp\cv@tmpbox0pt\box\cv@tmpbox\break %% \advance\cv@refno1\global\advance\iclrrulercount#3\relax %% \ifnum\cv@refno<\cv@tot\repeat}}\endgroup}% %% \makeatother %% % ----- end of vruler %% % \makevruler[][][][][] %% \def\iclrruler#1{\makevruler[12pt][#1][1][3][0.993\textheight]\usebox{\iclrrulerbox}} %% \AddToShipoutPicture{% %% \ificlrfinal\else %% \iclrruleroffset=\textheight %% \advance\iclrruleroffset by -3.7pt %% \color[rgb]{.7,.7,.7} %% \AtTextUpperLeft{% %% \put(\LenToUnit{-35pt},\LenToUnit{-\iclrruleroffset}){%left ruler %% \iclrruler{\iclrrulercount}} %% } %% \fi %% } %%% To add a vertical bar on the side %\AddToShipoutPicture{ %\AtTextLowerLeft{ %\hspace*{-1.8cm} %\colorbox[rgb]{0.7,0.7,0.7}{\small \parbox[b][\textheight]{0.1cm}{}}} %} PK!D:j j jmdc/resources/icml.bst%% File: `icml2019.bst' %% A modification of `plainnl.bst' for use with natbib package %% %% Copyright 2010 Hal Daum\'e III %% Modified by J. Frnkranz %% - Changed labels from (X and Y, 2000) to (X & Y, 2000) %% - Changed References to last name first and abbreviated first names. %% Modified by Iain Murray 2018 (who suggests adopting a standard .bst in future...) %% - Made it actually use abbreviated first names %% %% Copyright 1993-2007 Patrick W Daly %% Max-Planck-Institut f\"ur Sonnensystemforschung %% Max-Planck-Str. 2 %% D-37191 Katlenburg-Lindau %% Germany %% E-mail: daly@mps.mpg.de %% %% This program can be redistributed and/or modified under the terms %% of the LaTeX Project Public License Distributed from CTAN %% archives in directory macros/latex/base/lppl.txt; either %% version 1 of the License, or any later version. %% % Version and source file information: % \ProvidesFile{icml2010.mbs}[2007/11/26 1.93 (PWD)] % % BibTeX `plainnat' family % version 0.99b for BibTeX versions 0.99a or later, % for LaTeX versions 2.09 and 2e. % % For use with the `natbib.sty' package; emulates the corresponding % member of the `plain' family, but with author-year citations. % % With version 6.0 of `natbib.sty', it may also be used for numerical % citations, while retaining the commands \citeauthor, \citefullauthor, % and \citeyear to print the corresponding information. % % For version 7.0 of `natbib.sty', the KEY field replaces missing % authors/editors, and the date is left blank in \bibitem. % % Includes field EID for the sequence/citation number of electronic journals % which is used instead of page numbers. % % Includes fields ISBN and ISSN. % % Includes field URL for Internet addresses. % % Includes field DOI for Digital Object Idenfifiers. % % Works best with the url.sty package of Donald Arseneau. % % Works with identical authors and year are further sorted by % citation key, to preserve any natural sequence. % ENTRY { address author booktitle chapter doi eid edition editor howpublished institution isbn issn journal key month note number organization pages publisher school series title type url volume year } {} { label extra.label sort.label short.list } INTEGERS { output.state before.all mid.sentence after.sentence after.block } FUNCTION {init.state.consts} { #0 'before.all := #1 'mid.sentence := #2 'after.sentence := #3 'after.block := } STRINGS { s t } FUNCTION {output.nonnull} { 's := output.state mid.sentence = { ", " * write$ } { output.state after.block = { add.period$ write$ newline$ "\newblock " write$ } { output.state before.all = 'write$ { add.period$ " " * write$ } if$ } if$ mid.sentence 'output.state := } if$ s } FUNCTION {output} { duplicate$ empty$ 'pop$ 'output.nonnull if$ } FUNCTION {output.check} { 't := duplicate$ empty$ { pop$ "empty " t * " in " * cite$ * warning$ } 'output.nonnull if$ } FUNCTION {fin.entry} { add.period$ write$ newline$ } FUNCTION {new.block} { output.state before.all = 'skip$ { after.block 'output.state := } if$ } FUNCTION {new.sentence} { output.state after.block = 'skip$ { output.state before.all = 'skip$ { after.sentence 'output.state := } if$ } if$ } FUNCTION {not} { { #0 } { #1 } if$ } FUNCTION {and} { 'skip$ { pop$ #0 } if$ } FUNCTION {or} { { pop$ #1 } 'skip$ if$ } FUNCTION {new.block.checka} { empty$ 'skip$ 'new.block if$ } FUNCTION {new.block.checkb} { empty$ swap$ empty$ and 'skip$ 'new.block if$ } FUNCTION {new.sentence.checka} { empty$ 'skip$ 'new.sentence if$ } FUNCTION {new.sentence.checkb} { empty$ swap$ empty$ and 'skip$ 'new.sentence if$ } FUNCTION {field.or.null} { duplicate$ empty$ { pop$ "" } 'skip$ if$ } FUNCTION {emphasize} { duplicate$ empty$ { pop$ "" } { "\emph{" swap$ * "}" * } if$ } INTEGERS { nameptr namesleft numnames } FUNCTION {format.names} { 's := #1 'nameptr := s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{vv~}{ll}{, jj}{, f.}" format.name$ 't := nameptr #1 > { namesleft #1 > { ", " * t * } { numnames #2 > { "," * } 'skip$ if$ t "others" = { " et~al." * } { " and " * t * } if$ } if$ } 't if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {format.key} { empty$ { key field.or.null } { "" } if$ } FUNCTION {format.authors} { author empty$ { "" } { author format.names } if$ } FUNCTION {format.editors} { editor empty$ { "" } { editor format.names editor num.names$ #1 > { " (eds.)" * } { " (ed.)" * } if$ } if$ } FUNCTION {format.isbn} { isbn empty$ { "" } { new.block "ISBN " isbn * } if$ } FUNCTION {format.issn} { issn empty$ { "" } { new.block "ISSN " issn * } if$ } FUNCTION {format.url} { url empty$ { "" } { new.block "URL \url{" url * "}" * } if$ } FUNCTION {format.doi} { doi empty$ { "" } { new.block "\doi{" doi * "}" * } if$ } FUNCTION {format.title} { title empty$ { "" } { title "t" change.case$ } if$ } FUNCTION {format.full.names} {'s := #1 'nameptr := s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{vv~}{ll}" format.name$ 't := nameptr #1 > { namesleft #1 > { ", " * t * } { numnames #2 > { "," * } 'skip$ if$ t "others" = { " et~al." * } { " and " * t * } if$ } if$ } 't if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {author.editor.full} { author empty$ { editor empty$ { "" } { editor format.full.names } if$ } { author format.full.names } if$ } FUNCTION {author.full} { author empty$ { "" } { author format.full.names } if$ } FUNCTION {editor.full} { editor empty$ { "" } { editor format.full.names } if$ } FUNCTION {make.full.names} { type$ "book" = type$ "inbook" = or 'author.editor.full { type$ "proceedings" = 'editor.full 'author.full if$ } if$ } FUNCTION {output.bibitem} { newline$ "\bibitem[" write$ label write$ ")" make.full.names duplicate$ short.list = { pop$ } { * } if$ "]{" * write$ cite$ write$ "}" write$ newline$ "" before.all 'output.state := } FUNCTION {n.dashify} { 't := "" { t empty$ not } { t #1 #1 substring$ "-" = { t #1 #2 substring$ "--" = not { "--" * t #2 global.max$ substring$ 't := } { { t #1 #1 substring$ "-" = } { "-" * t #2 global.max$ substring$ 't := } while$ } if$ } { t #1 #1 substring$ * t #2 global.max$ substring$ 't := } if$ } while$ } FUNCTION {format.date} { year duplicate$ empty$ { "empty year in " cite$ * warning$ pop$ "" } 'skip$ if$ month empty$ 'skip$ { month " " * swap$ * } if$ extra.label * } FUNCTION {format.btitle} { title emphasize } FUNCTION {tie.or.space.connect} { duplicate$ text.length$ #3 < { "~" } { " " } if$ swap$ * * } FUNCTION {either.or.check} { empty$ 'pop$ { "can't use both " swap$ * " fields in " * cite$ * warning$ } if$ } FUNCTION {format.bvolume} { volume empty$ { "" } { "volume" volume tie.or.space.connect series empty$ 'skip$ { " of " * series emphasize * } if$ "volume and number" number either.or.check } if$ } FUNCTION {format.number.series} { volume empty$ { number empty$ { series field.or.null } { output.state mid.sentence = { "number" } { "Number" } if$ number tie.or.space.connect series empty$ { "there's a number but no series in " cite$ * warning$ } { " in " * series * } if$ } if$ } { "" } if$ } FUNCTION {format.edition} { edition empty$ { "" } { output.state mid.sentence = { edition "l" change.case$ " edition" * } { edition "t" change.case$ " edition" * } if$ } if$ } INTEGERS { multiresult } FUNCTION {multi.page.check} { 't := #0 'multiresult := { multiresult not t empty$ not and } { t #1 #1 substring$ duplicate$ "-" = swap$ duplicate$ "," = swap$ "+" = or or { #1 'multiresult := } { t #2 global.max$ substring$ 't := } if$ } while$ multiresult } FUNCTION {format.pages} { pages empty$ { "" } { pages multi.page.check { "pp.\ " pages n.dashify tie.or.space.connect } { "pp.\ " pages tie.or.space.connect } if$ } if$ } FUNCTION {format.eid} { eid empty$ { "" } { "art." eid tie.or.space.connect } if$ } FUNCTION {format.vol.num.pages} { volume field.or.null number empty$ 'skip$ { "\penalty0 (" number * ")" * * volume empty$ { "there's a number but no volume in " cite$ * warning$ } 'skip$ if$ } if$ pages empty$ 'skip$ { duplicate$ empty$ { pop$ format.pages } { ":\penalty0 " * pages n.dashify * } if$ } if$ } FUNCTION {format.vol.num.eid} { volume field.or.null number empty$ 'skip$ { "\penalty0 (" number * ")" * * volume empty$ { "there's a number but no volume in " cite$ * warning$ } 'skip$ if$ } if$ eid empty$ 'skip$ { duplicate$ empty$ { pop$ format.eid } { ":\penalty0 " * eid * } if$ } if$ } FUNCTION {format.chapter.pages} { chapter empty$ 'format.pages { type empty$ { "chapter" } { type "l" change.case$ } if$ chapter tie.or.space.connect pages empty$ 'skip$ { ", " * format.pages * } if$ } if$ } FUNCTION {format.in.ed.booktitle} { booktitle empty$ { "" } { editor empty$ { "In " booktitle emphasize * } { "In " format.editors * ", " * booktitle emphasize * } if$ } if$ } FUNCTION {empty.misc.check} { author empty$ title empty$ howpublished empty$ month empty$ year empty$ note empty$ and and and and and key empty$ not and { "all relevant fields are empty in " cite$ * warning$ } 'skip$ if$ } FUNCTION {format.thesis.type} { type empty$ 'skip$ { pop$ type "t" change.case$ } if$ } FUNCTION {format.tr.number} { type empty$ { "Technical Report" } 'type if$ number empty$ { "t" change.case$ } { number tie.or.space.connect } if$ } FUNCTION {format.article.crossref} { key empty$ { journal empty$ { "need key or journal for " cite$ * " to crossref " * crossref * warning$ "" } { "In \emph{" journal * "}" * } if$ } { "In " } if$ " \citet{" * crossref * "}" * } FUNCTION {format.book.crossref} { volume empty$ { "empty volume in " cite$ * "'s crossref of " * crossref * warning$ "In " } { "Volume" volume tie.or.space.connect " of " * } if$ editor empty$ editor field.or.null author field.or.null = or { key empty$ { series empty$ { "need editor, key, or series for " cite$ * " to crossref " * crossref * warning$ "" * } { "\emph{" * series * "}" * } if$ } 'skip$ if$ } 'skip$ if$ " \citet{" * crossref * "}" * } FUNCTION {format.incoll.inproc.crossref} { editor empty$ editor field.or.null author field.or.null = or { key empty$ { booktitle empty$ { "need editor, key, or booktitle for " cite$ * " to crossref " * crossref * warning$ "" } { "In \emph{" booktitle * "}" * } if$ } { "In " } if$ } { "In " } if$ " \citet{" * crossref * "}" * } FUNCTION {article} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { journal emphasize "journal" output.check eid empty$ { format.vol.num.pages output } { format.vol.num.eid output } if$ format.date "year" output.check } { format.article.crossref output.nonnull eid empty$ { format.pages output } { format.eid output } if$ } if$ format.issn output format.doi output format.url output new.block note output fin.entry } FUNCTION {book} { output.bibitem author empty$ { format.editors "author and editor" output.check editor format.key output } { format.authors output.nonnull crossref missing$ { "author and editor" editor either.or.check } 'skip$ if$ } if$ new.block format.btitle "title" output.check crossref missing$ { format.bvolume output new.block format.number.series output new.sentence publisher "publisher" output.check address output } { new.block format.book.crossref output.nonnull } if$ format.edition output format.date "year" output.check format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {booklet} { output.bibitem format.authors output author format.key output new.block format.title "title" output.check howpublished address new.block.checkb howpublished output address output format.date output format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {inbook} { output.bibitem author empty$ { format.editors "author and editor" output.check editor format.key output } { format.authors output.nonnull crossref missing$ { "author and editor" editor either.or.check } 'skip$ if$ } if$ new.block format.btitle "title" output.check crossref missing$ { format.bvolume output format.chapter.pages "chapter and pages" output.check new.block format.number.series output new.sentence publisher "publisher" output.check address output } { format.chapter.pages "chapter and pages" output.check new.block format.book.crossref output.nonnull } if$ format.edition output format.date "year" output.check format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {incollection} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { format.in.ed.booktitle "booktitle" output.check format.bvolume output format.number.series output format.chapter.pages output new.sentence publisher "publisher" output.check address output format.edition output format.date "year" output.check } { format.incoll.inproc.crossref output.nonnull format.chapter.pages output } if$ format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {inproceedings} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { format.in.ed.booktitle "booktitle" output.check format.bvolume output format.number.series output format.pages output address empty$ { organization publisher new.sentence.checkb organization output publisher output format.date "year" output.check } { address output.nonnull format.date "year" output.check new.sentence organization output publisher output } if$ } { format.incoll.inproc.crossref output.nonnull format.pages output } if$ format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {conference} { inproceedings } FUNCTION {manual} { output.bibitem format.authors output author format.key output new.block format.btitle "title" output.check organization address new.block.checkb organization output address output format.edition output format.date output format.url output new.block note output fin.entry } FUNCTION {mastersthesis} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block "Master's thesis" format.thesis.type output.nonnull school "school" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {misc} { output.bibitem format.authors output author format.key output title howpublished new.block.checkb format.title output howpublished new.block.checka howpublished output format.date output format.issn output format.url output new.block note output fin.entry empty.misc.check } FUNCTION {phdthesis} { output.bibitem format.authors "author" output.check author format.key output new.block format.btitle "title" output.check new.block "PhD thesis" format.thesis.type output.nonnull school "school" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {proceedings} { output.bibitem format.editors output editor format.key output new.block format.btitle "title" output.check format.bvolume output format.number.series output address output format.date "year" output.check new.sentence organization output publisher output format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {techreport} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block format.tr.number output.nonnull institution "institution" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {unpublished} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block note "note" output.check format.date output format.url output fin.entry } FUNCTION {default.type} { misc } MACRO {jan} {"January"} MACRO {feb} {"February"} MACRO {mar} {"March"} MACRO {apr} {"April"} MACRO {may} {"May"} MACRO {jun} {"June"} MACRO {jul} {"July"} MACRO {aug} {"August"} MACRO {sep} {"September"} MACRO {oct} {"October"} MACRO {nov} {"November"} MACRO {dec} {"December"} MACRO {acmcs} {"ACM Computing Surveys"} MACRO {acta} {"Acta Informatica"} MACRO {cacm} {"Communications of the ACM"} MACRO {ibmjrd} {"IBM Journal of Research and Development"} MACRO {ibmsj} {"IBM Systems Journal"} MACRO {ieeese} {"IEEE Transactions on Software Engineering"} MACRO {ieeetc} {"IEEE Transactions on Computers"} MACRO {ieeetcad} {"IEEE Transactions on Computer-Aided Design of Integrated Circuits"} MACRO {ipl} {"Information Processing Letters"} MACRO {jacm} {"Journal of the ACM"} MACRO {jcss} {"Journal of Computer and System Sciences"} MACRO {scp} {"Science of Computer Programming"} MACRO {sicomp} {"SIAM Journal on Computing"} MACRO {tocs} {"ACM Transactions on Computer Systems"} MACRO {tods} {"ACM Transactions on Database Systems"} MACRO {tog} {"ACM Transactions on Graphics"} MACRO {toms} {"ACM Transactions on Mathematical Software"} MACRO {toois} {"ACM Transactions on Office Information Systems"} MACRO {toplas} {"ACM Transactions on Programming Languages and Systems"} MACRO {tcs} {"Theoretical Computer Science"} READ FUNCTION {sortify} { purify$ "l" change.case$ } INTEGERS { len } FUNCTION {chop.word} { 's := 'len := s #1 len substring$ = { s len #1 + global.max$ substring$ } 's if$ } FUNCTION {format.lab.names} { 's := s #1 "{vv~}{ll}" format.name$ s num.names$ duplicate$ #2 > { pop$ " et~al." * } { #2 < 'skip$ { s #2 "{ff }{vv }{ll}{ jj}" format.name$ "others" = { " et~al." * } { " \& " * s #2 "{vv~}{ll}" format.name$ * } if$ } if$ } if$ } FUNCTION {author.key.label} { author empty$ { key empty$ { cite$ #1 #3 substring$ } 'key if$ } { author format.lab.names } if$ } FUNCTION {author.editor.key.label} { author empty$ { editor empty$ { key empty$ { cite$ #1 #3 substring$ } 'key if$ } { editor format.lab.names } if$ } { author format.lab.names } if$ } FUNCTION {author.key.organization.label} { author empty$ { key empty$ { organization empty$ { cite$ #1 #3 substring$ } { "The " #4 organization chop.word #3 text.prefix$ } if$ } 'key if$ } { author format.lab.names } if$ } FUNCTION {editor.key.organization.label} { editor empty$ { key empty$ { organization empty$ { cite$ #1 #3 substring$ } { "The " #4 organization chop.word #3 text.prefix$ } if$ } 'key if$ } { editor format.lab.names } if$ } FUNCTION {calc.short.authors} { type$ "book" = type$ "inbook" = or 'author.editor.key.label { type$ "proceedings" = 'editor.key.organization.label { type$ "manual" = 'author.key.organization.label 'author.key.label if$ } if$ } if$ 'short.list := } FUNCTION {calc.label} { calc.short.authors short.list "(" * year duplicate$ empty$ short.list key field.or.null = or { pop$ "" } 'skip$ if$ * 'label := } FUNCTION {sort.format.names} { 's := #1 'nameptr := "" s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{vv{ } }{ll{ }}{ f{ }}{ jj{ }}" format.name$ 't := nameptr #1 > { " " * namesleft #1 = t "others" = and { "zzzzz" * } { numnames #2 > nameptr #2 = and { "zz" * year field.or.null * " " * } 'skip$ if$ t sortify * } if$ } { t sortify * } if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {sort.format.title} { 't := "A " #2 "An " #3 "The " #4 t chop.word chop.word chop.word sortify #1 global.max$ substring$ } FUNCTION {author.sort} { author empty$ { key empty$ { "to sort, need author or key in " cite$ * warning$ "" } { key sortify } if$ } { author sort.format.names } if$ } FUNCTION {author.editor.sort} { author empty$ { editor empty$ { key empty$ { "to sort, need author, editor, or key in " cite$ * warning$ "" } { key sortify } if$ } { editor sort.format.names } if$ } { author sort.format.names } if$ } FUNCTION {author.organization.sort} { author empty$ { organization empty$ { key empty$ { "to sort, need author, organization, or key in " cite$ * warning$ "" } { key sortify } if$ } { "The " #4 organization chop.word sortify } if$ } { author sort.format.names } if$ } FUNCTION {editor.organization.sort} { editor empty$ { organization empty$ { key empty$ { "to sort, need editor, organization, or key in " cite$ * warning$ "" } { key sortify } if$ } { "The " #4 organization chop.word sortify } if$ } { editor sort.format.names } if$ } FUNCTION {presort} { calc.label label sortify " " * type$ "book" = type$ "inbook" = or 'author.editor.sort { type$ "proceedings" = 'editor.organization.sort { type$ "manual" = 'author.organization.sort 'author.sort if$ } if$ } if$ " " * year field.or.null sortify * " " * cite$ * #1 entry.max$ substring$ 'sort.label := sort.label * #1 entry.max$ substring$ 'sort.key$ := } ITERATE {presort} SORT STRINGS { longest.label last.label next.extra } INTEGERS { longest.label.width last.extra.num number.label } FUNCTION {initialize.longest.label} { "" 'longest.label := #0 int.to.chr$ 'last.label := "" 'next.extra := #0 'longest.label.width := #0 'last.extra.num := #0 'number.label := } FUNCTION {forward.pass} { last.label label = { last.extra.num #1 + 'last.extra.num := last.extra.num int.to.chr$ 'extra.label := } { "a" chr.to.int$ 'last.extra.num := "" 'extra.label := label 'last.label := } if$ number.label #1 + 'number.label := } FUNCTION {reverse.pass} { next.extra "b" = { "a" 'extra.label := } 'skip$ if$ extra.label 'next.extra := extra.label duplicate$ empty$ 'skip$ { "{\natexlab{" swap$ * "}}" * } if$ 'extra.label := label extra.label * 'label := } EXECUTE {initialize.longest.label} ITERATE {forward.pass} REVERSE {reverse.pass} FUNCTION {bib.sort.order} { sort.label 'sort.key$ := } ITERATE {bib.sort.order} SORT FUNCTION {begin.bib} { preamble$ empty$ 'skip$ { preamble$ write$ newline$ } if$ "\begin{thebibliography}{" number.label int.to.str$ * "}" * write$ newline$ "\providecommand{\natexlab}[1]{#1}" write$ newline$ "\providecommand{\url}[1]{\texttt{#1}}" write$ newline$ "\expandafter\ifx\csname urlstyle\endcsname\relax" write$ newline$ " \providecommand{\doi}[1]{doi: #1}\else" write$ newline$ " \providecommand{\doi}{doi: \begingroup \urlstyle{rm}\Url}\fi" write$ newline$ } EXECUTE {begin.bib} EXECUTE {init.state.consts} ITERATE {call.type$} FUNCTION {end.bib} { newline$ "\end{thebibliography}" write$ newline$ } EXECUTE {end.bib} PK!Liimdc/resources/icml.sty% File: icml2019.sty (LaTeX style file for ICML-2019, version of 2019-01-07) % This file contains the LaTeX formatting parameters for a two-column % conference proceedings that is 8.5 inches wide by 11 inches high. % % Modified by Iain Murray 2018: changed years, location. Remove affiliation notes when anonymous. % Move times dependency from .tex to .sty so fewer people delete it. % % Modified by Daniel Roy 2017: changed byline to use footnotes for affiliations, and removed emails % % Modified by Percy Liang 12/2/2013: changed the year, location from the previous template for ICML 2014 % Modified by Fei Sha 9/2/2013: changed the year, location form the previous template for ICML 2013 % % Modified by Fei Sha 4/24/2013: (1) remove the extra whitespace after the first author's email address (in %the camera-ready version) (2) change the Proceeding ... of ICML 2010 to 2014 so PDF's metadata will show up % correctly % % Modified by Sanjoy Dasgupta, 2013: changed years, location % % Modified by Francesco Figari, 2012: changed years, location % % Modified by Christoph Sawade and Tobias Scheffer, 2011: added line % numbers, changed years % % Modified by Hal Daume III, 2010: changed years, added hyperlinks % % Modified by Kiri Wagstaff, 2009: changed years % % Modified by Sam Roweis, 2008: changed years % % Modified by Ricardo Silva, 2007: update of the ifpdf verification % % Modified by Prasad Tadepalli and Andrew Moore, merely changing years. % % Modified by Kristian Kersting, 2005, based on Jennifer Dy's 2004 version % - running title. If the original title is to long or is breaking a line, % use \icmltitlerunning{...} in the preamble to supply a shorter form. % Added fancyhdr package to get a running head. % - Updated to store the page size because pdflatex does compile the % page size into the pdf. % % Hacked by Terran Lane, 2003: % - Updated to use LaTeX2e style file conventions (ProvidesPackage, % etc.) % - Added an ``appearing in'' block at the base of the first column % (thus keeping the ``appearing in'' note out of the bottom margin % where the printer should strip in the page numbers). % - Added a package option [accepted] that selects between the ``Under % review'' notice (default, when no option is specified) and the % ``Appearing in'' notice (for use when the paper has been accepted % and will appear). % % Originally created as: ml2k.sty (LaTeX style file for ICML-2000) % by P. Langley (12/23/99) %%%%%%%%%%%%%%%%%%%% %% This version of the style file supports both a ``review'' version %% and a ``final/accepted'' version. The difference is only in the %% text that appears in the note at the bottom of the first column of %% the first page. The default behavior is to print a note to the %% effect that the paper is under review and don't distribute it. The %% final/accepted version prints an ``Appearing in'' note. To get the %% latter behavior, in the calling file change the ``usepackage'' line %% from: %% \usepackage{icml2019} %% to %% \usepackage[accepted]{icml2019} %%%%%%%%%%%%%%%%%%%% \NeedsTeXFormat{LaTeX2e} \ProvidesPackage{icml2019}[2019/01/07 v2.0 ICML Conference Style File] % Before 2018, \usepackage{times} was in the example TeX, but inevitably % not everybody did it. \RequirePackage{times} % Use fancyhdr package \RequirePackage{fancyhdr} \RequirePackage{color} \RequirePackage{algorithm} \RequirePackage{algorithmic} \RequirePackage{natbib} \RequirePackage{eso-pic} % used by \AddToShipoutPicture \RequirePackage{forloop} %%%%%%%% Options \DeclareOption{accepted}{% \renewcommand{\Notice@String}{\ICML@appearing} \gdef\isaccepted{1} } \DeclareOption{nohyperref}{% \gdef\nohyperref{1} } \ifdefined\nohyperref\else\ifdefined\hypersetup \definecolor{mydarkblue}{rgb}{0,0.08,0.45} \hypersetup{ % pdftitle={}, pdfauthor={}, pdfsubject={ICML 2019 Workshop on Uncertainty and Robustness in Deep Learning}, pdfkeywords={}, pdfborder=0 0 0, pdfpagemode=UseNone, colorlinks=true, linkcolor=mydarkblue, citecolor=mydarkblue, filecolor=mydarkblue, urlcolor=mydarkblue, pdfview=FitH} \ifdefined\isaccepted \else \hypersetup{pdfauthor={Anonymous Submission}} \fi \fi\fi %%%%%%%%%%%%%%%%%%%% % This string is printed at the bottom of the page for the % final/accepted version of the ``appearing in'' note. Modify it to % change that text. %%%%%%%%%%%%%%%%%%%% \newcommand{\ICML@appearing}{Presented at the ICML 2019 Workshop on Uncertainty and Robustness in Deep Learning. Copyright 2019 by the author(s).} %%%%%%%%%%%%%%%%%%%% % This string is printed at the bottom of the page for the draft/under % review version of the ``appearing in'' note. Modify it to change % that text. %%%%%%%%%%%%%%%%%%%% \newcommand{\Notice@String}{Preliminary work. Under review at the ICML 2019 Workshop on Uncertainty and Robustness in Deep Learning\@. Do not distribute.} % Cause the declared options to actually be parsed and activated \ProcessOptions\relax % Uncomment the following for debugging. It will cause LaTeX to dump % the version of the ``appearing in'' string that will actually appear % in the document. %\typeout{>> Notice string='\Notice@String'} % Change citation commands to be more like old ICML styles \newcommand{\yrcite}[1]{\citeyearpar{#1}} \renewcommand{\cite}[1]{\citep{#1}} %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% % to ensure the letter format is used. pdflatex does compile the % page size into the pdf. This is done using \pdfpagewidth and % \pdfpageheight. As Latex does not know this directives, we first % check whether pdflatex or latex is used. % % Kristian Kersting 2005 % % in order to account for the more recent use of pdfetex as the default % compiler, I have changed the pdf verification. % % Ricardo Silva 2007 %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% \paperwidth=8.5in \paperheight=11in % old PDFLaTex verification, circa 2005 % %\newif\ifpdf\ifx\pdfoutput\undefined % \pdffalse % we are not running PDFLaTeX %\else % \pdfoutput=1 % we are running PDFLaTeX % \pdftrue %\fi \newif\ifpdf %adapted from ifpdf.sty \ifx\pdfoutput\undefined \else \ifx\pdfoutput\relax \else \ifcase\pdfoutput \else \pdftrue \fi \fi \fi \ifpdf % \pdfpagewidth=\paperwidth % \pdfpageheight=\paperheight \setlength{\pdfpagewidth}{8.5in} \setlength{\pdfpageheight}{11in} \fi % Physical page layout \evensidemargin -0.23in \oddsidemargin -0.23in \setlength\textheight{9.0in} \setlength\textwidth{6.75in} \setlength\columnsep{0.25in} \setlength\headheight{10pt} \setlength\headsep{10pt} \addtolength{\topmargin}{-20pt} \addtolength{\topmargin}{-0.29in} % Historically many authors tried to include packages like geometry or fullpage, % which change the page layout. It either makes the proceedings inconsistent, or % wastes organizers' time chasing authors. So let's nip these problems in the % bud here. -- Iain Murray 2018. %\RequirePackage{printlen} \AtBeginDocument{% % To get the numbers below, include printlen package above and see lengths like this: %\printlength\oddsidemargin\\ %\printlength\headheight\\ %\printlength\textheight\\ %\printlength\marginparsep\\ %\printlength\footskip\\ %\printlength\hoffset\\ %\printlength\paperwidth\\ %\printlength\topmargin\\ %\printlength\headsep\\ %\printlength\textwidth\\ %\printlength\marginparwidth\\ %\printlength\marginparpush\\ %\printlength\voffset\\ %\printlength\paperheight\\ % \newif\ifmarginsmessedwith \marginsmessedwithfalse \ifdim\oddsidemargin=-16.62178pt \else oddsidemargin has been altered.\\ \marginsmessedwithtrue\fi \ifdim\headheight=10.0pt \else headheight has been altered.\\ \marginsmessedwithtrue\fi \ifdim\textheight=650.43pt \else textheight has been altered.\\ \marginsmessedwithtrue\fi \ifdim\marginparsep=11.0pt \else marginparsep has been altered.\\ \marginsmessedwithtrue\fi \ifdim\footskip=0.0pt \else footskip has been altered.\\ \marginsmessedwithtrue\fi \ifdim\hoffset=0.0pt \else hoffset has been altered.\\ \marginsmessedwithtrue\fi \ifdim\paperwidth=614.295pt \else paperwidth has been altered.\\ \marginsmessedwithtrue\fi \ifdim\topmargin=-24.95781pt \else topmargin has been altered.\\ \marginsmessedwithtrue\fi \ifdim\headsep=10.0pt \else headsep has been altered.\\ \marginsmessedwithtrue\fi \ifdim\textwidth=487.8225pt \else textwidth has been altered.\\ \marginsmessedwithtrue\fi \ifdim\marginparwidth=65.0pt \else marginparwidth has been altered.\\ \marginsmessedwithtrue\fi \ifdim\marginparpush=5.0pt \else marginparpush has been altered.\\ \marginsmessedwithtrue\fi \ifdim\voffset=0.0pt \else voffset has been altered.\\ \marginsmessedwithtrue\fi \ifdim\paperheight=794.96999pt \else paperheight has been altered.\\ \marginsmessedwithtrue\fi \ifmarginsmessedwith \textbf{\large \em The page layout violates the ICML style.} Please do not change the page layout, or include packages like geometry, savetrees, or fullpage, which change it for you. We're not able to reliably undo arbitrary changes to the style. Please remove the offending package(s), or layout-changing commands and try again. \fi} %% The following is adapted from code in the acmconf.sty conference %% style file. The constants in it are somewhat magical, and appear %% to work well with the two-column format on US letter paper that %% ICML uses, but will break if you change that layout, or if you use %% a longer block of text for the copyright notice string. Fiddle with %% them if necessary to get the block to fit/look right. %% %% -- Terran Lane, 2003 %% %% The following comments are included verbatim from acmconf.sty: %% %%% This section (written by KBT) handles the 1" box in the lower left %%% corner of the left column of the first page by creating a picture, %%% and inserting the predefined string at the bottom (with a negative %%% displacement to offset the space allocated for a non-existent %%% caption). %%% \def\ftype@copyrightbox{8} \def\@copyrightspace{ % Create a float object positioned at the bottom of the column. Note % that because of the mystical nature of floats, this has to be called % before the first column is populated with text (e.g., from the title % or abstract blocks). Otherwise, the text will force the float to % the next column. -- TDRL. \@float{copyrightbox}[b] \begin{center} \setlength{\unitlength}{1pc} \begin{picture}(20,1.5) % Create a line separating the main text from the note block. % 4.818pc==0.8in. \put(0,2.5){\line(1,0){4.818}} % Insert the text string itself. Note that the string has to be % enclosed in a parbox -- the \put call needs a box object to % position. Without the parbox, the text gets splattered across the % bottom of the page semi-randomly. The 19.75pc distance seems to be % the width of the column, though I can't find an appropriate distance % variable to substitute here. -- TDRL. \put(0,0){\parbox[b]{19.75pc}{\small \Notice@String}} \end{picture} \end{center} \end@float} % Note: A few Latex versions need the next line instead of the former. % \addtolength{\topmargin}{0.3in} % \setlength\footheight{0pt} \setlength\footskip{0pt} %\pagestyle{empty} \flushbottom \twocolumn \sloppy % Clear out the addcontentsline command \def\addcontentsline#1#2#3{} %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%% commands for formatting paper title, author names, and addresses. %%start%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%% title as running head -- Kristian Kersting 2005 %%%%%%%%%%%%% %\makeatletter %\newtoks\mytoksa %\newtoks\mytoksb %\newcommand\addtomylist[2]{% % \mytoksa\expandafter{#1}% % \mytoksb{#2}% % \edef#1{\the\mytoksa\the\mytoksb}% %} %\makeatother % box to check the size of the running head \newbox\titrun % general page style \pagestyle{fancy} \fancyhf{} \fancyhead{} \fancyfoot{} % set the width of the head rule to 1 point \renewcommand{\headrulewidth}{1pt} % definition to set the head as running head in the preamble \def\icmltitlerunning#1{\gdef\@icmltitlerunning{#1}} % main definition adapting \icmltitle from 2004 \long\def\icmltitle#1{% %check whether @icmltitlerunning exists % if not \icmltitle is used as running head \ifx\undefined\@icmltitlerunning% \gdef\@icmltitlerunning{#1} \fi %add it to pdf information \ifdefined\nohyperref\else\ifdefined\hypersetup \hypersetup{pdftitle={#1}} \fi\fi %get the dimension of the running title \global\setbox\titrun=\vbox{\small\bf\@icmltitlerunning} % error flag \gdef\@runningtitleerror{0} % running title too long \ifdim\wd\titrun>\textwidth% {\gdef\@runningtitleerror{1}}% % running title breaks a line \else\ifdim\ht\titrun>6.25pt {\gdef\@runningtitleerror{2}}% \fi \fi % if there is somthing wrong with the running title \ifnum\@runningtitleerror>0 \typeout{}% \typeout{}% \typeout{*******************************************************}% \typeout{Title exceeds size limitations for running head.}% \typeout{Please supply a shorter form for the running head} \typeout{with \string\icmltitlerunning{...}\space prior to \string\begin{document}}% \typeout{*******************************************************}% \typeout{}% \typeout{}% % set default running title \chead{\small\bf Title Suppressed Due to Excessive Size}% \else % 'everything' fine, set provided running title \chead{\small\bf\@icmltitlerunning}% \fi % no running title on the first page of the paper \thispagestyle{empty} %%%%%%%%%%%%%%%%%%%% Kristian Kersting %%%%%%%%%%%%%%%%%%%%%%%%% %end%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% {\center\baselineskip 18pt \toptitlebar{\Large\bf #1}\bottomtitlebar} } \gdef\icmlfullauthorlist{} \newcommand\addstringtofullauthorlist{\g@addto@macro\icmlfullauthorlist} \newcommand\addtofullauthorlist[1]{% \ifdefined\icmlanyauthors% \addstringtofullauthorlist{, #1}% \else% \addstringtofullauthorlist{#1}% \gdef\icmlanyauthors{1}% \fi% \ifdefined\nohyperref\else\ifdefined\hypersetup% \hypersetup{pdfauthor=\icmlfullauthorlist}% \fi\fi} \def\toptitlebar{\hrule height1pt \vskip .25in} \def\bottomtitlebar{\vskip .22in \hrule height1pt \vskip .3in} \newenvironment{icmlauthorlist}{% \setlength\topsep{0pt} \setlength\parskip{0pt} \begin{center} }{% \end{center} } \newcounter{@affiliationcounter} \newcommand{\@pa}[1]{% % ``#1'' \ifcsname the@affil#1\endcsname % do nothing \else \ifcsname @icmlsymbol#1\endcsname % nothing \else \stepcounter{@affiliationcounter}% \newcounter{@affil#1}% \setcounter{@affil#1}{\value{@affiliationcounter}}% \fi \fi% \ifcsname @icmlsymbol#1\endcsname \textsuperscript{\csname @icmlsymbol#1\endcsname\,}% \else %\expandafter\footnotemark[\arabic{@affil#1}\,]% \textsuperscript{\arabic{@affil#1}\,}% \fi } %\newcommand{\icmlauthor}[2]{% %\addtofullauthorlist{#1}% %#1\@for\theaffil:=#2\do{\pa{\theaffil}}% %} \newcommand{\icmlauthor}[2]{% \ifdefined\isaccepted \mbox{\bf #1}\,\@for\theaffil:=#2\do{\@pa{\theaffil}} \addtofullauthorlist{#1}% \else \ifdefined\@icmlfirsttime \else \gdef\@icmlfirsttime{1} \mbox{\bf Anonymous Authors}\@pa{@anon} \addtofullauthorlist{Anonymous Authors} \fi \fi } \newcommand{\icmlsetsymbol}[2]{% \expandafter\gdef\csname @icmlsymbol#1\endcsname{#2} } \newcommand{\icmlaffiliation}[2]{% \ifdefined\isaccepted \ifcsname the@affil#1\endcsname \expandafter\gdef\csname @affilname\csname the@affil#1\endcsname\endcsname{#2}% \else {\bf AUTHORERR: Error in use of \textbackslash{}icmlaffiliation command. Label ``#1'' not mentioned in some \textbackslash{}icmlauthor\{author name\}\{labels here\} command beforehand. } \typeout{}% \typeout{}% \typeout{*******************************************************}% \typeout{Affiliation label undefined. }% \typeout{Make sure \string\icmlaffiliation\space follows } \typeout{all of \string\icmlauthor\space commands}% \typeout{*******************************************************}% \typeout{}% \typeout{}% \fi \else % \isaccepted % can be called multiple times... it's idempotent \expandafter\gdef\csname @affilname1\endcsname{Anonymous Institution, Anonymous City, Anonymous Region, Anonymous Country} \fi } \newcommand{\icmlcorrespondingauthor}[2]{ \ifdefined\isaccepted \ifdefined\icmlcorrespondingauthor@text \g@addto@macro\icmlcorrespondingauthor@text{, #1 \textless{}#2\textgreater{}} \else \gdef\icmlcorrespondingauthor@text{#1 \textless{}#2\textgreater{}} \fi \else \gdef\icmlcorrespondingauthor@text{Anonymous Author \textless{}anon.email@domain.com\textgreater{}} \fi } \newcommand{\icmlEqualContribution}{\textsuperscript{*}Equal contribution } \newcounter{@affilnum} \newcommand{\printAffiliationsAndNotice}[1]{% \stepcounter{@affiliationcounter}% {\let\thefootnote\relax\footnotetext{\hspace*{-\footnotesep}\ifdefined\isaccepted #1\fi% \forloop{@affilnum}{1}{\value{@affilnum} < \value{@affiliationcounter}}{ \textsuperscript{\arabic{@affilnum}}\ifcsname @affilname\the@affilnum\endcsname% \csname @affilname\the@affilnum\endcsname% \else {\bf AUTHORERR: Missing \textbackslash{}icmlaffiliation.} \fi }. \ifdefined\icmlcorrespondingauthor@text Correspondence to: \icmlcorrespondingauthor@text. \else {\bf AUTHORERR: Missing \textbackslash{}icmlcorrespondingauthor.} \fi \ \\ \Notice@String } } } %\makeatother \long\def\icmladdress#1{% {\bf The \textbackslash{}icmladdress command is no longer used. See the example\_paper PDF .tex for usage of \textbackslash{}icmlauther and \textbackslash{}icmlaffiliation.} } %% keywords as first class citizens \def\icmlkeywords#1{% % \ifdefined\isaccepted \else % \par {\bf Keywords:} #1% % \fi % \ifdefined\nohyperref\else\ifdefined\hypersetup % \hypersetup{pdfkeywords={#1}} % \fi\fi % \ifdefined\isaccepted \else % \par {\bf Keywords:} #1% % \fi \ifdefined\nohyperref\else\ifdefined\hypersetup \hypersetup{pdfkeywords={#1}} \fi\fi } % modification to natbib citations \setcitestyle{authoryear,round,citesep={;},aysep={,},yysep={;}} % Redefinition of the abstract environment. \renewenvironment{abstract} {% % Insert the ``appearing in'' copyright notice. %\@copyrightspace \centerline{\large\bf Abstract} \vspace{-0.12in}\begin{quote}} {\par\end{quote}\vskip 0.12in} % numbered section headings with different treatment of numbers \def\@startsection#1#2#3#4#5#6{\if@noskipsec \leavevmode \fi \par \@tempskipa #4\relax \@afterindenttrue % Altered the following line to indent a section's first paragraph. % \ifdim \@tempskipa <\z@ \@tempskipa -\@tempskipa \@afterindentfalse\fi \ifdim \@tempskipa <\z@ \@tempskipa -\@tempskipa \fi \if@nobreak \everypar{}\else \addpenalty{\@secpenalty}\addvspace{\@tempskipa}\fi \@ifstar {\@ssect{#3}{#4}{#5}{#6}}{\@dblarg{\@sict{#1}{#2}{#3}{#4}{#5}{#6}}}} \def\@sict#1#2#3#4#5#6[#7]#8{\ifnum #2>\c@secnumdepth \def\@svsec{}\else \refstepcounter{#1}\edef\@svsec{\csname the#1\endcsname}\fi \@tempskipa #5\relax \ifdim \@tempskipa>\z@ \begingroup #6\relax \@hangfrom{\hskip #3\relax\@svsec.~}{\interlinepenalty \@M #8\par} \endgroup \csname #1mark\endcsname{#7}\addcontentsline {toc}{#1}{\ifnum #2>\c@secnumdepth \else \protect\numberline{\csname the#1\endcsname}\fi #7}\else \def\@svsechd{#6\hskip #3\@svsec #8\csname #1mark\endcsname {#7}\addcontentsline {toc}{#1}{\ifnum #2>\c@secnumdepth \else \protect\numberline{\csname the#1\endcsname}\fi #7}}\fi \@xsect{#5}} \def\@sect#1#2#3#4#5#6[#7]#8{\ifnum #2>\c@secnumdepth \def\@svsec{}\else \refstepcounter{#1}\edef\@svsec{\csname the#1\endcsname\hskip 0.4em }\fi \@tempskipa #5\relax \ifdim \@tempskipa>\z@ \begingroup #6\relax \@hangfrom{\hskip #3\relax\@svsec}{\interlinepenalty \@M #8\par} \endgroup \csname #1mark\endcsname{#7}\addcontentsline {toc}{#1}{\ifnum #2>\c@secnumdepth \else \protect\numberline{\csname the#1\endcsname}\fi #7}\else \def\@svsechd{#6\hskip #3\@svsec #8\csname #1mark\endcsname {#7}\addcontentsline {toc}{#1}{\ifnum #2>\c@secnumdepth \else \protect\numberline{\csname the#1\endcsname}\fi #7}}\fi \@xsect{#5}} % section headings with less space above and below them \def\thesection {\arabic{section}} \def\thesubsection {\thesection.\arabic{subsection}} \def\section{\@startsection{section}{1}{\z@}{-0.12in}{0.02in} {\large\bf\raggedright}} \def\subsection{\@startsection{subsection}{2}{\z@}{-0.10in}{0.01in} {\normalsize\bf\raggedright}} \def\subsubsection{\@startsection{subsubsection}{3}{\z@}{-0.08in}{0.01in} {\normalsize\sc\raggedright}} \def\paragraph{\@startsection{paragraph}{4}{\z@}{1.5ex plus 0.5ex minus .2ex}{-1em}{\normalsize\bf}} \def\subparagraph{\@startsection{subparagraph}{5}{\z@}{1.5ex plus 0.5ex minus .2ex}{-1em}{\normalsize\bf}} % Footnotes \footnotesep 6.65pt % \skip\footins 9pt \def\footnoterule{\kern-3pt \hrule width 0.8in \kern 2.6pt } \setcounter{footnote}{0} % Lists and paragraphs \parindent 0pt \topsep 4pt plus 1pt minus 2pt \partopsep 1pt plus 0.5pt minus 0.5pt \itemsep 2pt plus 1pt minus 0.5pt \parsep 2pt plus 1pt minus 0.5pt \parskip 6pt \leftmargin 2em \leftmargini\leftmargin \leftmarginii 2em \leftmarginiii 1.5em \leftmarginiv 1.0em \leftmarginv .5em \leftmarginvi .5em \labelwidth\leftmargini\advance\labelwidth-\labelsep \labelsep 5pt \def\@listi{\leftmargin\leftmargini} \def\@listii{\leftmargin\leftmarginii \labelwidth\leftmarginii\advance\labelwidth-\labelsep \topsep 2pt plus 1pt minus 0.5pt \parsep 1pt plus 0.5pt minus 0.5pt \itemsep \parsep} \def\@listiii{\leftmargin\leftmarginiii \labelwidth\leftmarginiii\advance\labelwidth-\labelsep \topsep 1pt plus 0.5pt minus 0.5pt \parsep \z@ \partopsep 0.5pt plus 0pt minus 0.5pt \itemsep \topsep} \def\@listiv{\leftmargin\leftmarginiv \labelwidth\leftmarginiv\advance\labelwidth-\labelsep} \def\@listv{\leftmargin\leftmarginv \labelwidth\leftmarginv\advance\labelwidth-\labelsep} \def\@listvi{\leftmargin\leftmarginvi \labelwidth\leftmarginvi\advance\labelwidth-\labelsep} \abovedisplayskip 7pt plus2pt minus5pt% \belowdisplayskip \abovedisplayskip \abovedisplayshortskip 0pt plus3pt% \belowdisplayshortskip 4pt plus3pt minus3pt% % Less leading in most fonts (due to the narrow columns) % The choices were between 1-pt and 1.5-pt leading \def\@normalsize{\@setsize\normalsize{11pt}\xpt\@xpt} \def\small{\@setsize\small{10pt}\ixpt\@ixpt} \def\footnotesize{\@setsize\footnotesize{10pt}\ixpt\@ixpt} \def\scriptsize{\@setsize\scriptsize{8pt}\viipt\@viipt} \def\tiny{\@setsize\tiny{7pt}\vipt\@vipt} \def\large{\@setsize\large{14pt}\xiipt\@xiipt} \def\Large{\@setsize\Large{16pt}\xivpt\@xivpt} \def\LARGE{\@setsize\LARGE{20pt}\xviipt\@xviipt} \def\huge{\@setsize\huge{23pt}\xxpt\@xxpt} \def\Huge{\@setsize\Huge{28pt}\xxvpt\@xxvpt} % Revised formatting for figure captions and table titles. \newsavebox\newcaptionbox\newdimen\newcaptionboxwid \long\def\@makecaption#1#2{ \vskip 10pt \baselineskip 11pt \setbox\@tempboxa\hbox{#1. #2} \ifdim \wd\@tempboxa >\hsize \sbox{\newcaptionbox}{\small\sl #1.~} \newcaptionboxwid=\wd\newcaptionbox \usebox\newcaptionbox {\footnotesize #2} % \usebox\newcaptionbox {\small #2} \else \centerline{{\small\sl #1.} {\small #2}} \fi} \def\fnum@figure{Figure \thefigure} \def\fnum@table{Table \thetable} % Strut macros for skipping spaces above and below text in tables. \def\abovestrut#1{\rule[0in]{0in}{#1}\ignorespaces} \def\belowstrut#1{\rule[-#1]{0in}{#1}\ignorespaces} \def\abovespace{\abovestrut{0.20in}} \def\aroundspace{\abovestrut{0.20in}\belowstrut{0.10in}} \def\belowspace{\belowstrut{0.10in}} % Various personal itemization commands. \def\texitem#1{\par\noindent\hangindent 12pt \hbox to 12pt {\hss #1 ~}\ignorespaces} \def\icmlitem{\texitem{$\bullet$}} % To comment out multiple lines of text. \long\def\comment#1{} %% Line counter (not in final version). Adapted from NIPS style file by Christoph Sawade % Vertical Ruler % This code is, largely, from the CVPR 2010 conference style file % ----- define vruler \makeatletter \newbox\icmlrulerbox \newcount\icmlrulercount \newdimen\icmlruleroffset \newdimen\cv@lineheight \newdimen\cv@boxheight \newbox\cv@tmpbox \newcount\cv@refno \newcount\cv@tot % NUMBER with left flushed zeros \fillzeros[] \newcount\cv@tmpc@ \newcount\cv@tmpc \def\fillzeros[#1]#2{\cv@tmpc@=#2\relax\ifnum\cv@tmpc@<0\cv@tmpc@=-\cv@tmpc@\fi \cv@tmpc=1 % \loop\ifnum\cv@tmpc@<10 \else \divide\cv@tmpc@ by 10 \advance\cv@tmpc by 1 \fi \ifnum\cv@tmpc@=10\relax\cv@tmpc@=11\relax\fi \ifnum\cv@tmpc@>10 \repeat \ifnum#2<0\advance\cv@tmpc1\relax-\fi \loop\ifnum\cv@tmpc<#1\relax0\advance\cv@tmpc1\relax\fi \ifnum\cv@tmpc<#1 \repeat \cv@tmpc@=#2\relax\ifnum\cv@tmpc@<0\cv@tmpc@=-\cv@tmpc@\fi \relax\the\cv@tmpc@}% % \makevruler[][][][][] \def\makevruler[#1][#2][#3][#4][#5]{ \begingroup\offinterlineskip \textheight=#5\vbadness=10000\vfuzz=120ex\overfullrule=0pt% \global\setbox\icmlrulerbox=\vbox to \textheight{% { \parskip=0pt\hfuzz=150em\cv@boxheight=\textheight \cv@lineheight=#1\global\icmlrulercount=#2% \cv@tot\cv@boxheight\divide\cv@tot\cv@lineheight\advance\cv@tot2% \cv@refno1\vskip-\cv@lineheight\vskip1ex% \loop\setbox\cv@tmpbox=\hbox to0cm{ % side margin \hfil {\hfil\fillzeros[#4]\icmlrulercount} }% \ht\cv@tmpbox\cv@lineheight\dp\cv@tmpbox0pt\box\cv@tmpbox\break \advance\cv@refno1\global\advance\icmlrulercount#3\relax \ifnum\cv@refno<\cv@tot\repeat } } \endgroup }% \makeatother % ----- end of vruler % \makevruler[][][][][] \def\icmlruler#1{\makevruler[12pt][#1][1][3][\textheight]\usebox{\icmlrulerbox}} \AddToShipoutPicture{% \icmlruleroffset=\textheight \advance\icmlruleroffset by 5.2pt % top margin \color[rgb]{.7,.7,.7} \ifdefined\isaccepted \else \AtTextUpperLeft{% \put(\LenToUnit{-35pt},\LenToUnit{-\icmlruleroffset}){%left ruler \icmlruler{\icmlrulercount}} % \put(\LenToUnit{1.04\textwidth},\LenToUnit{-\icmlruleroffset}){%right ruler % \icmlruler{\icmlrulercount}} } \fi } \endinput PK!U``!mdc/resources/lmmono10-italic.otfOTTO 0CFF kſ8&GPOSQ7cxGSUBj0$TOS/2iY `cmap lheadX6hheaM$hmtxm` maxpPname4e4+posto S_<i9i9BBP XKXW^E UKWN  "< c  :XQg  m   4  t  S "   Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.Latin Modern Mono10 Italic2.004;UKWN;LMMono10-ItalicLatin Modern Mono 10 ItalicVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853LMMono10-ItalicPlease refer to the Copyright section for the font trademark attribution notices.LM Mono 10 ItalicItalicCopyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LM Mono 10Italic2.004;UKWN;LMMono10-ItalicLMMono10-ItalicVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853Please refer to the Copyright section for the font trademark attribution notices.Latin Modern Mono10 Italic ggg5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%'8{ L]RV/C598bt'~(:;qp)&<=z KQU\.4B(I X~  !#%')+-157:<>@BDFHKMOQSUWY[]_aceikmoqsuxz|  7Y #&2? %'+/9CG]cmo      " & 0 ; = @ F R T !!!!'!.!"""""""##*$#%&j&'6F +/26;@CIMWZgko~8L$   "$&(*,.469;=?ACEGJLNPRTVXZ\^`bdhjlnprtvy{} 7X#&.? $&*.6BDXbln      & 0 9 = ? D R T !!!!&!.!"""""""##)$"%&j&'%8 ).15:@CHLPZckn~8C$?6!676957?KOKRzd_cHJy7K"z")BDRUWg?A9\^`bZ~H&40wޟDއ݁#}|_ G / at T`g5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%''t:~-&;%z \KQU!B.48l#8{ ]LRV"C/59m$q|}deY}~ (I9*HJ)|- "flqk]<=V')&Z    {ELMMono10-Italic:MNOPQ Jb ;  5;7 $.5<CJQXeir} !:OXanx)>KSVaky,4EHKRYbr '18?FK[afkp$6ELR_mu  2HQ_nz *7DQ^ip{ '.9@GNY`kr}   ! , 7 E S ^ i x  # 7 G W ` i r {     % . 7 A K Q W ] c s    # - 7 @ I S ] d k w   ) 4 ? H Q Z c l u { '-39?LR]ht $0<FPYbhntz(1:CLV`jt(.4:@LXajt~ #,5>HR[djpy$.;HR\jx  )28>HRX^djt~",9<EKQ\jv'/48?CFJOQSZ]`cjqx}L[ciacute.capacute.ts1anglearcangleleftanglerightAogonekaogonekuni2193uni2190uni2192uni2191asterisk.mathbahtbigcircleblanksymbolstar.altbreve.capbreve.ts1space_uni0306_uni0301.capspace_uni0306_uni0301space_uni0306_uni0300.capspace_uni0306_uni0300space_uni0306_uni0309.capspace_uni0306_uni0309space_uni0306_uni0303.capspace_uni0306_uni0303caron.capcaron.ts1cent.oldstylecentigradecircumflex.capspace_uni0302_uni0301.capspace_uni0302_uni0301space_uni0302_uni0300.capspace_uni0302_uni0300space_uni0302_uni0309.capspace_uni0302_uni0309space_uni0302_uni0303.capspace_uni0302_uni0303space_uni0326copyleftcwmcwmascendercwmcapitaldblbracketleftdblbracketrightspace_uni030F.capspace_uni030Fdblgrave.ts1dblverticalbardcroatDeltadiameterdieddieresis.capdieresis.ts1discountdivorceddollar.oldstyledongdotaccent.capspace_uni0323dotlessjeight.taboldstyleEngengEogonekeogonekestimatedfive.taboldstylefour.taboldstyleGammagnaborretnigrave.capgrave.ts1guaraniHbarhbarspace_uni0309.capspace_uni0309hungarumlaut.caphungarumlaut.ts1interrobangIogonekiogonekLambdaleafliralongsmacron.capmacron.ts1marrieduni00B5uni266Anairanine.taboldstylenumeroOhornohornOmegaone.taboldstyleone.superiorOogonekoogonekopenbulletparagraph.altperthousandzeropesoPhiPiPsipublishedquillbracketleftquillbracketrightquotedblbase.csquotedblbase.ts1quotedblright.csquotesinglbase.ts1quotesingle.ts1radicalrecipereferencemarkregistered.altring.capspace_uni030A_uni0301.capspace_uni030A_uni0301Scedillascedillaseven.taboldstyleSigmasix.taboldstyleThetathree.taboldstylethree.superiortieaccentcapitaltieaccentcapital.newtieaccentlowercasetieaccentlowercase.newtilde.capasciitilde.lowtwo.taboldstyletwo.superiorUhornuhornUogonekuogonekUpsilondotaccent.altuni2423wonXizero.taboldstyleEuroinfinityringhalfleftringhalfrightmacron.altmacron.cap.altspace_uni0311space_uni0311.capspace_uni032Espace_uni032Fspace_uni0331space_uni0332space_uni0330uni0301.capuni0301uni0306.capuni0306uni032Euni032Funi0311.capuni0311uni030C.capuni030Cuni0302.capuni0302uni0326uni030F.capuni030Funi0308.capuni0308uni0307.capuni0307uni0323uni0300.capuni0300uni0309.capuni0309uni030B.capuni030Buni0332uni0331uni0304.capuni0304uni030A.capuni030Auni0303.capuni0303uni0330space_uni0308_uni0301.capspace_uni0308_uni0301space_uni0308_uni0300.capspace_uni0308_uni0300space_uni0308_uni030C.capspace_uni0308_uni030CAbreveabreveAbreveacuteabreveacuteAbrevedotbelowabrevedotbelowAbrevegraveabrevegraveAbrevehookaboveabrevehookaboveAbrevetildeabrevetildeAcaronacaronAcircumflexacuteacircumflexacuteAcircumflexdotbelowacircumflexdotbelowAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAdblgraveadblgraveAdotbelowadotbelowAEacuteaeacuteAhookaboveahookaboveAmacronamacronAogonekacuteaogonekacuteAringacutearingacuteCacutecacuteCcaronccaronCcircumflexccircumflexCdotaccentcdotaccentDcarondcaronDdotbelowddotbelowDlinebelowdlinebelowEbreveebreveEcaronecaronEcircumflexacuteecircumflexacuteEcircumflexdotbelowecircumflexdotbelowEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEdblgraveedblgraveEdotaccentedotaccentEdotbelowedotbelowEhookaboveehookaboveEmacronemacronEogonekacuteeogonekacuteEreversedereversedEtildeetildeeturnedschwaGacutegacuteGbrevegbreveGcarongcaronGcircumflexgcircumflexGcommaaccentgcommaaccentGdotaccentgdotaccentHbrevebelowhbrevebelowHcircumflexhcircumflexHdieresishdieresisHdotbelowhdotbelowH_uni0303h_uni0303IbreveibreveIcaronicaronIdblgraveidblgraveIdieresisacuteidieresisacuteIdotaccentIdotbelowidotbelowIhookaboveihookaboveImacronimacronImacron.altimacron.altIogonekacuteiogonekacuteItildeitildeJacutejacuteJ_uni030C.capjcaronJcircumflexjcircumflexKcommaaccentkcommaaccentLacutelacuteLcaronlcaronLcommaaccentlcommaaccentLdotldotLdotbelowldotbelowLdotbelowmacronldotbelowmacronL_uni0303l_uni0303MdotbelowmdotbelowNacutenacuteNcaronncaronNcommaaccentncommaaccentNdotaccentndotaccentNdotbelowndotbelowObreveobreveOcaronocaronOcircumflexacuteocircumflexacuteOcircumflexdotbelowocircumflexdotbelowOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOdblgraveodblgraveOdotbelowodotbelowOhookaboveohookaboveOhornacuteohornacuteOhorndotbelowohorndotbelowOhorngraveohorngraveOhornhookaboveohornhookaboveOhorntildeohorntildeOhungarumlautohungarumlautOmacronomacronOogonekacuteoogonekacuteOslashacuteoslashacuteRacuteracuteRcaronrcaronRcommaaccentrcommaaccentRdblgraverdblgraveRdotaccentrdotaccentRdotbelowrdotbelowRdotbelowmacronrdotbelowmacronSacutesacuteScircumflexscircumflexuni0218uni0219SdotbelowsdotbelowTcarontcaronuni021Auni021BTcedillatcedillaT_uni0308tdieresisTdotbelowtdotbelowTlinebelowtlinebelowT_uni0303t_uni0303UbreveubreveU_uni032Fu_uni032FUcaronucaronUdblgraveudblgraveUdieresisacuteudieresisacuteUdieresiscaronudieresiscaronUdieresisgraveudieresisgraveUdotbelowudotbelowUhookaboveuhookaboveUhornacuteuhornacuteUhorndotbelowuhorndotbelowUhorngraveuhorngraveUhornhookaboveuhornhookaboveUhorntildeuhorntildeUhungarumlautuhungarumlautUmacronumacronUringuringUtildeutildeWacutewacuteWcircumflexwcircumflexWdieresiswdieresisWgravewgraveYcircumflexycircumflexYdotbelowydotbelowYgraveygraveYhookaboveyhookaboveYtildeytildeZacutezacuteZdotaccentzdotaccentZdotbelowzdotbelowuni00A0uni2127zero.slashOrogateorogatequotedblbase.cmquotedblleft.cmquotedblright.cmfraction.althyphen.dupuni2010uni2011uni00ADhyphen.althyphendblemdash.althyphendbl.altohmacute.dupae.dupAE.dupcedilla.dupcircumflex.dupdieresis.dupgermandbls.dupmacron.dupoe.dupOE.duposlash.dupOslash.dupquoteleft.dupquoteright.duptilde.dupDcroatuni0237GcedillagcedillaKcedillakcedillaLcedillalcedillaNcedillancedillaRcedillarcedillaAlphaBetaEpsilonZetaEtaIotaKappaMuNuOmicronRhoTauChiuni2040uni203Funi20542.004Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LMMono10-ItalicLMMono10Normal~ $oIs-2@BJ  ( 9 M Z ^ T ]   X d } NTIx qv} &s| #'.y #(^glpt CY]agy*?JO]ai,6:>ELQWfn| #(-|wrp\Yp]^vep`zW loizIu~ynoY o & G f+ ho}tw|Ox}w~oo`Atg%@i fc.bvwǜze!{U]8gĭwt‘ & 7.t=GKȖ4} ku.F pw~rHZ^irmrwwBՋ `e~Ujh jОFq}~sn~u{gذO*L+}Tzj̚lq}d{~^}}?ԭFMEI,C ܪ_a ~t R Pzckm||ۣ`U%R jw֣z8b~wVh   zuv|~ Php}yZ}vgueN_cyff|fshqvjy{l}SwȜzE ףj^a |ay|v\i J & G +C&on . p~! mOGc+G k& y mu| []W'_[߸8{n$uz_Oo $-(#tzNFAA4KG͐ yyb4y |p0 M ~z}a Y^g^a +}TzvRvg = ^tlw: oG P& A4_o o x}]it|zgaUdtn}z|0 R omx|Sww ] M ~ p~{qhoPy%&\Sf|i\,%g0atqvw~Ɓez}kiyxgbn~Tpm|hW  noizIo|6+G _&  I cmdg}e_ ot R sy\v_a_|v M ~=|ynpf*.RH %xlp y Oy"փ@fvZMwn ej#hpU~`jV M ~ Y]QE nwʧs|1e_4E{rptulM܉ӝ \MUbr}z) v{8 uq 'xc]5ysv~ %"sM;Rݒ( 17Rwn !  ~|^^RXУ;ݽlRehu|yx!d/0RRa8PAb«sf}ĪhB-JӦ}sUs-}Rgq`bqmnr{r  L tx}2Jy}t y}t !  5 XWΏz~}ys{Ƥv]^ZrIM]Xtxu~4\ M ~:+  J J& %.P|MlVdt}ppswbQeМ? ~n0 }o~Xc{tڍ[JEr}x>۱ {]Ϗ k& 4 xt f|ѠyI u^+Ry2o)o{wzj[em֬6ZǗ~Wr}exz^a|scborzuvrJhwyh\`jo wЋzi-N<`|m6dnw ! 0 hp~xV|pku ptV j`sjw쳑ܥƚ \Qѵ 5 z¡ʽba\fqinxTcmw}zxuwc6puIno™uyujt?}tFno™uyuj~^j-z\ty?Ƌ x> PL P d~|^^RXУ;ݽlRZ[h\fxL(,<.YÿdiXĪhB-JӦ}slb<Xl؋>< qypsvj{zpyts6#|q~}o $Ό m@}]it |zgaUdtn}@z| @0 o 蕿R Pzckm||ۣ`U%R jw֣z8b~wcm\idZ nx~`eXt{uzes_rXttz<'}}諽|l{`KbM_1Ln}r2] V  sj@=u|#~njo&b&p~ Pu[n+ M  VVmtjoP ,  xuaNQd  t R } _Y^̟`,}& G i|pjoPxXT=#$^JYCHI1vەMq35  $0x 4 "y \ t 3 K1@+[}}̢䞻бg_UH<e}pknPg$dCAxm``p:[5 dz⵶xi`%uZ̮Ģ Lla|& G f+CtL CyGD;%"ڬ\Z|pjo / g-9qqlr .Cꄕ}rx|swz!msyx , $ O _vҽSc pIF48~ l {}xZh ~ ~ w~ @<U%ī a#(*sx}plwsd4,G G n+ .7s7NzFP gR+C^We* F7O_Ϡ ǰ^^}  ] r  t fw wi#%Swd{k cw >  h}vord0+e   M ~.R  x; zz}zz} Ӎ t~wz~{zsrw~}  V[  C)u{}| hBe B 4 ~Ц {|f nttnnrtn z V p~:{qhoP:{  &cv _pIF4 7s @ ^ w~ h;e ۶ +h j  x{y χx a |pjo  3 6 rmfhifnr tf.u~ J KH  svooslm| d l vw k⫠zW v{ <|pj xw {}} }  y~ 2Ѕb    p} ȋL q cs۪Ѯx L  zy}zz} LS-:Mn ċ u j ` 8"# sw  y~ wz~ krbo~ y|  _ v vzw v7J kT=e[s g "B?_ !#C=]\^<>$D %E&F'G(H|)I*J+K,L-M.N/O0P1Q  2R h3S4T5U6V@7W8X9Y:Z;[U c }-moqsuy0/3t{5}a~7,8gp:<> yo`ec AjxkCE  FGI}|  srz{viwAu K!*,fb2649  NM<@DFHPR ` lndpx,'.&%2469OS;Q=@BD*$#)HJ+Lw B8>  ~!,.5<MOQS^$-/t *e(23m    " 3 < V [ x }  } * r  D 1 *nz|xBGT]f+CWMYgt1KVam{#5IP]iz+Ct{U / .;HTDN"  U!p!"5";"H"V""###,#k#$A$H$R$$%%%&&&&&&'''5'J'^'j''''''(((#(;([(t((((((())),)F)Z)y)))))**++$+,B,,,-l---.o....../ //9/F/`/n///////0%0q0|00131I1g1r111111112 22/2C2M2\2g2w222222223 33/3?3S3c3t34444455'555K5P5\55566606;6R6b6w66666778[8999*94:::-:::;~;;< <<<<<<= ==-=9=K=Z=m=r>>>>>>>???+?@@@W@i@|@~@@@@@AA A9AWAqAAAAAABBBBBBCCCeCDDbDsDDDDDE9EJEF*FFGGHHaHIIIIIIIIIJkJtJJJJJJJJJJKKL'LLLLMNMMMNN+NTN}NNNNNOOQQQQRR!R>RSS)SnSSSSSSTTsTTTTTTUU&U=UJUfUwUUUUVVV9VKVlV|VVVWX)X=XYYYZ(Z^O^j_a`#`3`K`V`j`x```a=aMaeauaaabb"b0b=bPbcbtbbbbbbbbbbc cc)c;cGcSc_cmc{ccccccccccccdd dddd-d!M }A|)sa>{K=Epkoapzpyxxwm*%8 nx(,p}njodr|}Syxxyr~^sQr{fmpp]r[*c{{zVɠ͏Ĝэ8#dOlYM ~%8#34Iu~nDSIn 8#OVDUM ~I+$7#3+I ? jD IkXк?yekdo`gy vj!em]pblvkoW_wnxvt}N  B?d}X~tvfmlr{e~8?xAsv4lQ|`gwwf]v8>f{rZWT_ų̕~XR\In~^~Xq ! } # i Wz f,i~lhhvJwuY{mbZ@{ol1j^& G c+.4_j|zunZ o_ 5|r ]vw~yywy~vo{T}|Qa;k_t| E2{zz}~|*l Yoyx~ye/| w~4푳 + Ћ5=4 (y(vwe}yz|wzFMr~{qc /Y@{P *J' _3( Qx|? ,( C   N{sMi 7m7 vw}FMv}cy~ze F Uē] ,4)9+J4?<" v7&6wZhT&ho ' 7ihhT&ThhhIT&'& %  ,  Wp~8o|G+Toxy~{$1+|pjoPsr/L  D\dorot^~aroq}xk}Vwr|Nvw=Uq;'#MQq_TPIPbONvw N-}hrUnw}}~~Q:7!8NS|{}}T=i -jiePaXy³ v-UcSvC kҢ vRRwTƎiyz.* v zDY &cv _pIF48~ }n퇚EJb,r|v}xqs*j(Og}Xr/L QM ~S~|w|e{umX #%Qҫ[UDRZJh2FX|űѲePTW'.<)VwwϜwecZm?dvuciuWŮu|wqo}oҲS |8 SytbffX}y&v{-  7s-\ዛ6+Ɍ vw]jYh>kt`nei`s_jum~|xv v-cj  '}vyN~yzL 1 d9X_iАuq8zyxyEvZa[jhuCiǤ 92/ X}}cC2=aRQr^tPM^ZrF{y}{~!  /J #3";Hhhhhh!J $ J% ! *;u wp >J%9 JwL%%9 \u p" >J%(  p! *;K( u " >J: ! %:u wp >J%O JwL%%O u ^ " >J%@2JT́ ! %%@$   u " ;&A ! =g: u p << JL~M\u p" G(  p! J( ȵ_,FIȵ_ލ,F Zt I4U~ u " )B( ! 0(u " A J ! 0 u " u p }G5JLh5vVwJ߱ 7fxx{x~}}i f-Rl~mzn2_nmlMv ,[WV{>r}xxy}҄}{}()(uqMv F>rz|{wvxWVX|||yz֑}Au Q` [ !ٸ" DpiwpqzO Q J¸ٸ.w ! ;piwpqzO Q vwCwZZw_m5|s{{{MlaY}}}ʀ_N}ӻ՗,v !wCыh{w|~uimu~|mwossxyЗsqp|xw,v wErgqgpzzztwmltki\gyvwH~L_}_HC[@}|~#6txMhsvBwwu|dzz}}s}t|s}}demmnm{zz{vuxvxm[h6y_}ijiz|}|u " xh2J́ ! a$ _Y^̟`, yz}z{M;& G i|pjoP-|M x\\D1]J[L^CHI1vەMqqLvj tT=if}sjϒ cm ~V 2 ͽ[U ˼w$ g˼w $ Rv?E ˼w$ vE l}vorAy~$/}xww~yLyz  ? 0 D 0 A A? < D AX *}T {vg(yk9e?EĮbLwn wjow8᝜}sp~[CQclr|{T Ѧ? % D i;?  :( J D  Sy( { zmr1sp~kW zy}z}Q {Qclv|N k |lgդ y~}y~~wwpN^R\lG'dHϠv{o`{c}mQbgױ<i{{{{xxopusortge; ;trn zy}z~W2~+]W.{}U  {vq;QkafVwnHl.3 u0* UK &yvq35JUڽѨOxVz_vͩuj|1Iwѝv g-sqqlruzxsnoo~r}}rx|swzjxt|qoopuemmsyx}@yZ-`_g_`pg`WvwBfsfrls̛dckhQs]kn~uvv rwrhC~Ve+n<~,}ʫҊ LvVVwqfsfqktcpgwnhboq~uuw mzi}{jycoh [rtuejpÐr~hr}n`ilmq^hwn{w~|yosyapSth9F $tyZw{pAEu{uV Bj)藲9i<4xy{pvv}}3Jpwuxz%0 : \z fz l N <JNBnuhwlt {svdj|u}{zc Jɨp {On|Mkjx!*+QĹb“8"7O_Ϡ ǰ^^ pN ( xB J( ,eܟZ:;9J:w;wI۟Eaaiaariawlftujyz@oXboc] + n]`hXb r| {R;w:K<otxYvqpcZ۞~Y  3\vIw({xxy| }}}yx{FXorvư p !<yekdo`gy_v00wEabc5 ~4 C9 % qo) ~5* E4-Iyzwwz3~w >[!5ZڻاYgr?e1Ai~^Įؐ dmNipN ,5N L xBI5M;kpny}Vxx{{p>|rlpPp{z}{{~|Pmly$&#0T¶dZZz ;Rb˟Į``R( <( \,( 'x|?q !  }vw #  q ˼w! {$}˼w # $q ! I<} # ~Aq ! V%} # f;q wHV%9 }w # h%9 \q p! V%( \~ |# f;K( q ! V:} # h:q wHV%O }w # h%O q V ! V%@2}T́̃ # h%@2q ! 2A } # 8: q H H< }܃ # :vMq HwW( } # v( \q p! ;( \~ |# Gy( q ! N(}vw # W(q !  }vzw #  p;Ң C C q HS5}ʃ # $v5P P >iP1t3XXwj``&+}Tzϧ mt-oXlsrws ;* 4yeN_cyff|fshqvjy{l}SwȜzE ףjHcFzGla>eôѪѡϮ}Aq ! };~ Ч&> w9ɔڭʠXB%Qbq]`pha ϰѦ9D"5mٮӻzqq ! q p|foq| ~oo}v7sX_ono}s(rSuol~yn| }9%JBA^PnvsLizłrU9wx{oxz{jp}]m5(үĻ[=epw{owvvrtl}iGs˪xE}~%?jeec4 ׭DZul•Lb\Px /c JGw mFʹzBhf`[ry}z{~n}|}}{ҭvpmxvu !.EƭO0?XtžR`q !  t2}́̃ # 2m 43l{||}e}codcv$0KFoe}{}~vplLM_U]kerax`go_bdU_hvJw r|so+wr_  +  Ћ5=n ^ +G _& 6 M ~[o o˼w + $˼wЋ5=n@$ + f<Ћ5=4 (yA + s%Ћ5=4 (y;  >+ * W + Et( Ћ5=4 $y( U s(6.7s7NzFP 6CN~vz-7r7zvPvVwAvVwq  M ~z l|Ng|Nk0TzvRvg fw<gJɨ Y\MUbr}z d nr$0 (Nus\^j{g˼w 8/#3$g˼w$Y:@${/$/D%Y@{%/6< Y@{8< \p/M( \HYt@H{( a K "Kl ލ*0mS ~Ц'0Q l ˼w*0C$J˼w'0L$l *u<';Al *s%'#;l *A ': * _v J'(k *8_b [ J ~Ц':k[ l * "( *s( |'_3' F[( l ލ*0^( ~Ц'0(l *0v~ Jvzw'0K l * 5J' 35KKs@yb;KVҝӝ]\>OByp:M_}՞w7Ey-^gobo~k[0W"qpaowrmqqnk~SiDspah~F6Ws{_VnzoxwhjrZ߾Ů~u|w|cYӳٶKbdtOk+xo}AiJ & G +[jdY B .C&on  U' xwb * *<$ J́'K$ x|?A Q%x|?; C  C `* ( 6N({sMi* l ލ70Y ލm7 0 wҋrsszuyhzt+ sl%(PN@pn. vN7w vNm7 -w 7U!* m87 G* gQ7( mQm7 D( 7u;( mp7 g( 7u;' 5 m7 g' 5 N+5Ѻѫ$xw{xbw_h\lm F ǚȽtfH+(':(r|xxyNwx }}}~|yKDhP|W~bˤlgڞXrzcg}z,wxx{x n x{xi9$G[j}QL oRwj*alzn}qn^oո٨utz D noizIK5*|6+Wf.L ZU_& mst R r}vwE`Zz,*IM ~R_F6 ϸb7{Ep5 N+5 51A0Q-jk}n|ztrq |2?鴽p}:vO~uRpi]tTPyzz61> .vyzZ[vbzn{g F s( \Uēx]M( ϥM ~$ow'qwFrPf-C:RSٹM ~$x}rg|~x^tj[HXEN44K 2J||~ư  F hvww#M usk}Tu}<{yoswxB qe+-Wvwn'{zu[5wvvxv w^Hv{xuyxLq$f``)Y.iSOMG|{}w}Ǫl ލ,0:S 4)0fQ p~!kx/Gc+jrzz}z q$rjk& y /u|5 r r8_"$I~F}l ,B< 4)};A ,6* L 48)* , 3( J4) 3( , s( 4p)( ,z<$ J 4)K$ ,Ë Y 0*x~t&uwmpWf4i FzMy}}Dw~~xt)bmIgDuxnvsp^vȚxR~w ̯{{zpjitfŧe_}jv}l % 0 , 0 ˼w% 0P$J˼w , 0($% < , A% % , ;w%  %9 Jwf%9 \x% %(  x, ;K( % : , : w% (%O Jwf%O Ḱ̟% %@$ JT́ , %@$ % -A , q: ܟ%  W< JfDM\x% A(  x, =@( S _} ǺʢKQkUP % 0( , 0(Z vzw% 0 Jvzw , 0 wQ Ex w= @ vwwQ Ex () vww= @ ( \ wlQ zEx "( wz= l@ 4 ( vwwQ Ex (8(vww= @ ((vwiwQ Ex (I vw4w= @ ( ̩́Q Ex 6$ ̣́= @ $ % d , UKʟ%  R5Jf.5Z % }~]{^Ϗ|  {zgyƣ şwg^dvFon~tnltr~iɫќS| A}a}i[p}Xc[~{} h  I@ !BPuZjaX\[B  &G0?XtžR` Dxddlddtld5swv~d}}K}ut}@@"*HbnF1zJzzJ^;P:al޵lk]W79(*JZ4zz{?K=Vg{׿dlKv՟ wD vwGKv՟ vwwD vvwwG ̟́% M$ J́ , '$ Av16{e "ld1D)}x`}x'΢ 7_ȹ]Ë@ D Rjivx{yxyzDPaXyڀ³ v UcSv  UcSvF ȋɋla|& 0a|Nf+Cty, CyGD;%"ڬ\Z W&{'yqjys."x57AYM~t-]{o='|Y ^G]Xε֖xursvo~dmKvVXeɭء v{o|*Ufv=`:QM,4(SvlS||kO钪wS0}Pc}wstj|}|qo~OvzV}Qu4ssr1}9#mH \u}w{~kinsmunxgi{mhVQh mniw{neix|ywܘ|uh8 |8 |8 h̟I & vȘ{- 0L vJzs&d}^kwr gOh{~{Yc}|z|rsroi&<- c{A&F* 8- ?* &qA - l5: &( v{-  s( &f( \p- |( &f' 5\v{- |' [5jОFky=PgذO*L+}Tzj̚lq}d{}:Oz}[ԭ⠧q}~sn~u{듑'MEI,C ܪ_a!vV rxN ' |ssrxr }rsrxr űٰK =}~{xkW(}Jz}z||{}vsbfXjfhXdttsٸ_^ ٸvI^ unZz}}tx?}UƔ}sfT+-'$`msmun`@{slduqekUuq|zD@HCPzyrywmbj 7s-\ዛ0 KH6+Ɍ0P -\ዛ< 6+Ɍ:A 7s-nywT   6:~|}T m -\ዛ% 6+Ɍ"; <-\ዛo* <6+ɌM* \x-\ዛ( \ x6+Ɍm( VUC-`Zϣqsw5+(S0tquwcvkeaw;Pph{y]V~GsN^Z~|ssrws6vaEqutrxuu,]b~hylXP {nr}RIn>v o~njkˋ-rcxmm}~smvfhsoc4a ™_s~vvx[`AEA;wke& v8qpuz|Tdceqsgˬ@ 1l 1Xt<vd9X_e* gai0^tlw: oG P& zvT 04_o og[<9_ezyT ߦ 1* <9X_V* d9X_)< 1( \x9X_v( rrY &cv _zQAnlx..|ERlqLmslRtz~q}RylvʍM)}Tz/ EyGD;%"ڬ\Zr/L J Sif}sj; F[Sd yupjcRx}{}myXKwgf uv} yupicRx~{}myXKwgf vv}v2 k 2 2 Ni`1c5N x9X_;5{ zzgzƣ Şwg^dvFon~umlur~iɫќ ލ /J #0"S 3"0fQ ˼w/J #0eC$J˼w3"0L$ /J #*< 3"};A /J #(% 3"s#; /J #BA 3": /J # ` J3" f  /J #8` [ J 3"8f [ /J # ` <J3" f < /J #8` (J 3"8f (\ p/J ##s( 3p"( ލ /J #0 ( 3"0W( /J #0+~ J 3"0cK  w )Dttluop{~%#~}~Ez~rjfzpo~~{|iK /J # g5J3" 35r˺w+!zys}|sZ4_`]coks~}wb~є&]v OP P \%A?} z}g /J } .t=GKȖ4} ku@Ow^jg[`[B n  3 ‘R o}tw|Ox}w~oo`Atg%@i fc.bvwǜze!{U]8gĭVi]UZ[mRVXf%d?0Q jvp`\cpOa+Co>uv}v ٸ$/J #6CpiwpqzxJ¸ٸ3"6-L^ ́/J #b<$ J 3"K$ ލ8 0*S wvw9 r0v 8 0%w9 rH;8  v w9 r 6XMލ8 0(wvw9 r0p9(v\'p~<+YCx}{}{z}$xy6~rȩ|"qz9 y||}z}xygyeT9v]vZv9c$U9`ȍƺw^LvM ~{{vczznv`m{rusM rh;i|}n}R;nl ލ1 01S vw. g l 1 7% . g; 1  v . gCM 1 s( xj. g@)  p~ ,4op~#te5xw|w jV x d ~l ލ1 0"( vw. g (l 1 0:~  vzw. g  1 q<$ ́. g&x}]it|zgaUdtn}z|0 l ލ; 0 И6 0~? l ; <6 )Al ;  k( 6  8!( p; ( \`6 ( ;  F ˼w$_w$j) _w$j) g˼w,$Rv ?E <˼w$˼wU ˼wU w$n? w$n? vE vE QvdE a a< A%vw%9 {w%9 h;::w%O w%O %@2 %@2 0* A : :: vuv u`[ Y `[ vu<Y < LxMv u`( Y `(vK( Hix( ( FY( a   d *KN2+55 èN2+5 Ux5NٸSpiwpqzxNٸ.wSpiwpqzO Q ٸ.w`piwpqzO Q 5ٸIv^ v2 k+2 82 v v}~bv=sjxxװ}Au Q` 8 [  UK vw}~~>]ÖĘwtpyj zOYXY}~}}{pyw~YY[U[W}藗*{xY˜ȣɟ˾w|tx|x|`jkqU~zz|?Ϥv u%V|pdw|zt|v}|}UK Xl3qrypw;|̦-/]^uaa_zZǖo}E̫   vw 'vLPw uP~}~ |wxvg%k =yt~~uy~w<]Ny})@xrrwwr@rx?vrputprw\,( }Aq ލ!  };~ Ч&> w9ɔڭʠXB%Qbq]`pha ϰѦ9D"5mٮӻzq $ H >xursvo~uodxcV xovCcfv=`:[X{uwr(sb+itƫv Xƃz~{zjpt3 p~ |pjoPl4SMQъCqun)u{{m^ yz}z|RgVI(vȎ2cj SiАqIyzmu|mzizkZ[ZU%D09FP@qso\']/:ptkakt~hʰ˦ Zݷ Q4\[tf`s8L7_"(O=?p4dEįQ2 ilhuiMpݤݯlɐloSQQL|aYV^pL{M|ML^a|ʚʛF_x]fimj`dcfyvmi]_I=EF Ì +_ X^vE0MNQ  Z 2 c $ , n s w  + 0  ($-t| kosz}_go<@`d&,2_mr%,4LQUZbgou  &+39LPWinu $'.38=INRV\bmx{z)O|yl*$ b“8"7O_Ϡ ǰ^^ qqypsvj{zpyts6#|q~}o U$Ό > w9ɔڭʠXB%Qbq]9D"5mٮӻzq x }]it|zgaUdtn} z| 0 Y &cv _z^*ium7s_ݧRALns P ) ' xupurtxu nuhwlt{svdj|u}{zp~ |pjoP-iMJLElEHғBqun)u{ygT/.l]/¸gI I@ !.E &G0?XtžR` DByRQU~j^+r&wo|G|ԧurs{ J~w~or|xB ng#2Xba+]rwrf'}[^/kķ'vF6F{ zwrxtvzwGzwrxtvzw wv p~ 'tktkzi^hp~#t]KV KtƖ x}]it@|zgaUdtn}z|@0 ~}~Ez~rjfzpo~~{| w8᝜}sp~[CQclc ,EOAag~}wu΋|t"J [zsmy#FiQylyeu}Po~njoG x|pjoPx o{w1\y b ly|pjoPx\  s {z mcde^ o M ~ $ $% $% %$ %e&&&& o +h j\4(fYDz*G+} pÓb^DPV\flǽ 0he ԶME*ium7s_ݦRAMnsu_ i Yq YpW {u|ozHu M ~ |~*}sowpa ct=)Uj@4`&$qng5qҤ|s{m{ZJ $[xlp y OyTy  C)u{}|id[86d^ \ Х{x}jN8) 2(J`lGhdl~K{uy~o{屢~ư-i?EV=]Hsh7Xs ŵ“ ~QkUP'Z7O_Ϡ ǰ^^ }  piwpqzxxi9$~G[jQH& Rwp*[sznvqn^oյ٨4=~tzb C / ji Vimzz}zy~Vjn+\4(fYDz*G+ zQi O ihh Ok l& n Y &cv _pIF4Fv܆bjj_b[B ^*ium7s_ݧRALns ]қo}aXUϝK"$9Qg~3r,F(3Ol) }M:S:OVȾmVS>2B-@\V]9gGSmvo}|lu,+0PDO 0i[F),0.9ۭʢԻ9~Ѧ i Twp^^ehX}_{Epjzx݋rxjEMzeV} $ !w b nuhwlt`{svdj|u}{z 4z ?A}vor@Eyz d(/JnpyykZ}a}i[p|Wc[~{} & 7  yekdo`gy $0nNUr^ FDFLTcyrl*latn@"* #+"AZE 4CRT FMOL XROM lTRK  $, %- &.  '/!(0)12aalt.aalt6aalt>aaltFaaltNaaltVaalt^aaltfdligndligtdligzdligdligdligdligdligfracfracfracfracfracfracfracfraclnumlnumlnumlnumlnumlnumlnumlnumloclloclonum onumonumonumonum"onum(onum.onum4zero:zero@zeroFzeroLzeroRzeroXzero^zerod"*2:BJ @06x 4 "f9fk)9)k%f9%)9      0389NRdejky  '<' <    0389NRdejk y  Rj 0389NRdejky     5\y0389NRdejk      y DFLTcyrl latn,"AZE *CRT 2MOL :ROM BTRK Jsize2size6size:size>sizeBsizeFsizeJsizeN" d2PK! ""mdc/resources/lmmono10-regular.otfOTTO 0CFF ;2HbGPOSPc@GSUBj0pTOS/2iT `cmap lhead 6hheaK$hmtx\` maxpPname%x:9post~F( D_<i4i4==2P XKX^E UKWN@  "< c  :![Qk  s  6   t   _ " # Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.Latin Modern Mono10 Regular2.004;UKWN;LMMono10-RegularLatin Modern Mono 10 RegularVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853LMMono10-RegularPlease refer to the Copyright section for the font trademark attribution notices.LM Mono 10 RegularRegularCopyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LM Mono 10Regular2.004;UKWN;LMMono10-RegularLMMono10-RegularVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853Please refer to the Copyright section for the font trademark attribution notices.Latin Modern Mono10 Regular ggg5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%'8{ L]RV/C598bt'~(:;qp)&<=z KQU\.4B(I X~  !#%')+-157:<>@BDFHKMOQSUWY[]_aceikmoqsuxz|  7Y #&2? %'+/9CG]cmo      " & 0 ; = @ F R T !!!!'!.!"""""""##*$#%&j&'6F +/26;@CIMWZgko~8L$   "$&(*,.469;=?ACEGJLNPRTVXZ\^`bdhjlnprtvy{} 7X#&.? $&*.6BDXbln      & 0 9 = ? D R T !!!!&!.!"""""""##)$"%&j&'%8 ).15:@CHLPZckn~8C$?6!676957?KOKRzd_cHJy7K"z")BDRUWg?A9\^`bZ~H&40wޟDއ݁#}|_ G / at T`g5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%''t:~-&;%z \KQU!B.48l#8{ ]LRV"C/59m$q|}deY}~ (I9*HJ)|- "flqk]<=V')&Z    {ELMMono10-Regular2MNOPQ ;  Wo5;~7 $.5<CJQXeir} !:OXanx)>KSVaky,4EHKRYbr '18?FK[afkp$6ELR_mu  2HQ_nz *7DQ^ip{ '.9@GNY`kr}   ! , 7 E S ^ i x  # 7 G W ` i r {     % . 7 A K Q W ] c s    # - 7 @ I S ] d k w   ) 4 ? H Q Z c l u { '-39?LR]ht $0<FPYbhntz(1:CLV`jt(.4:@LXajt~ #,5>HR[djpy$.;HR\jx  )28>HRX^djt~",9<EKQ\jv'/48?CFJOQSZ]`cjqx}L\djacute.capacute.ts1anglearcangleleftanglerightAogonekaogonekuni2193uni2190uni2192uni2191asterisk.mathbahtbigcircleblanksymbolstar.altbreve.capbreve.ts1space_uni0306_uni0301.capspace_uni0306_uni0301space_uni0306_uni0300.capspace_uni0306_uni0300space_uni0306_uni0309.capspace_uni0306_uni0309space_uni0306_uni0303.capspace_uni0306_uni0303caron.capcaron.ts1cent.oldstylecentigradecircumflex.capspace_uni0302_uni0301.capspace_uni0302_uni0301space_uni0302_uni0300.capspace_uni0302_uni0300space_uni0302_uni0309.capspace_uni0302_uni0309space_uni0302_uni0303.capspace_uni0302_uni0303space_uni0326copyleftcwmcwmascendercwmcapitaldblbracketleftdblbracketrightspace_uni030F.capspace_uni030Fdblgrave.ts1dblverticalbardcroatDeltadiameterdieddieresis.capdieresis.ts1discountdivorceddollar.oldstyledongdotaccent.capspace_uni0323dotlessjeight.taboldstyleEngengEogonekeogonekestimatedfive.taboldstylefour.taboldstyleGammagnaborretnigrave.capgrave.ts1guaraniHbarhbarspace_uni0309.capspace_uni0309hungarumlaut.caphungarumlaut.ts1interrobangIogonekiogonekLambdaleafliralongsmacron.capmacron.ts1marrieduni00B5uni266Anairanine.taboldstylenumeroOhornohornOmegaone.taboldstyleone.superiorOogonekoogonekopenbulletparagraph.altperthousandzeropesoPhiPiPsipublishedquillbracketleftquillbracketrightquotedblbase.csquotedblbase.ts1quotedblright.csquotesinglbase.ts1quotesingle.ts1radicalrecipereferencemarkregistered.altring.capspace_uni030A_uni0301.capspace_uni030A_uni0301Scedillascedillaseven.taboldstyleSigmasix.taboldstyleThetathree.taboldstylethree.superiortieaccentcapitaltieaccentcapital.newtieaccentlowercasetieaccentlowercase.newtilde.capasciitilde.lowtwo.taboldstyletwo.superiorUhornuhornUogonekuogonekUpsilondotaccent.altuni2423wonXizero.taboldstyleEuroinfinityringhalfleftringhalfrightmacron.altmacron.cap.altspace_uni0311space_uni0311.capspace_uni032Espace_uni032Fspace_uni0331space_uni0332space_uni0330uni0301.capuni0301uni0306.capuni0306uni032Euni032Funi0311.capuni0311uni030C.capuni030Cuni0302.capuni0302uni0326uni030F.capuni030Funi0308.capuni0308uni0307.capuni0307uni0323uni0300.capuni0300uni0309.capuni0309uni030B.capuni030Buni0332uni0331uni0304.capuni0304uni030A.capuni030Auni0303.capuni0303uni0330space_uni0308_uni0301.capspace_uni0308_uni0301space_uni0308_uni0300.capspace_uni0308_uni0300space_uni0308_uni030C.capspace_uni0308_uni030CAbreveabreveAbreveacuteabreveacuteAbrevedotbelowabrevedotbelowAbrevegraveabrevegraveAbrevehookaboveabrevehookaboveAbrevetildeabrevetildeAcaronacaronAcircumflexacuteacircumflexacuteAcircumflexdotbelowacircumflexdotbelowAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAdblgraveadblgraveAdotbelowadotbelowAEacuteaeacuteAhookaboveahookaboveAmacronamacronAogonekacuteaogonekacuteAringacutearingacuteCacutecacuteCcaronccaronCcircumflexccircumflexCdotaccentcdotaccentDcarondcaronDdotbelowddotbelowDlinebelowdlinebelowEbreveebreveEcaronecaronEcircumflexacuteecircumflexacuteEcircumflexdotbelowecircumflexdotbelowEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEdblgraveedblgraveEdotaccentedotaccentEdotbelowedotbelowEhookaboveehookaboveEmacronemacronEogonekacuteeogonekacuteEreversedereversedEtildeetildeeturnedschwaGacutegacuteGbrevegbreveGcarongcaronGcircumflexgcircumflexGcommaaccentgcommaaccentGdotaccentgdotaccentHbrevebelowhbrevebelowHcircumflexhcircumflexHdieresishdieresisHdotbelowhdotbelowH_uni0303h_uni0303IbreveibreveIcaronicaronIdblgraveidblgraveIdieresisacuteidieresisacuteIdotaccentIdotbelowidotbelowIhookaboveihookaboveImacronimacronImacron.altimacron.altIogonekacuteiogonekacuteItildeitildeJacutejacuteJ_uni030C.capjcaronJcircumflexjcircumflexKcommaaccentkcommaaccentLacutelacuteLcaronlcaronLcommaaccentlcommaaccentLdotldotLdotbelowldotbelowLdotbelowmacronldotbelowmacronL_uni0303l_uni0303MdotbelowmdotbelowNacutenacuteNcaronncaronNcommaaccentncommaaccentNdotaccentndotaccentNdotbelowndotbelowObreveobreveOcaronocaronOcircumflexacuteocircumflexacuteOcircumflexdotbelowocircumflexdotbelowOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOdblgraveodblgraveOdotbelowodotbelowOhookaboveohookaboveOhornacuteohornacuteOhorndotbelowohorndotbelowOhorngraveohorngraveOhornhookaboveohornhookaboveOhorntildeohorntildeOhungarumlautohungarumlautOmacronomacronOogonekacuteoogonekacuteOslashacuteoslashacuteRacuteracuteRcaronrcaronRcommaaccentrcommaaccentRdblgraverdblgraveRdotaccentrdotaccentRdotbelowrdotbelowRdotbelowmacronrdotbelowmacronSacutesacuteScircumflexscircumflexuni0218uni0219SdotbelowsdotbelowTcarontcaronuni021Auni021BTcedillatcedillaT_uni0308tdieresisTdotbelowtdotbelowTlinebelowtlinebelowT_uni0303t_uni0303UbreveubreveU_uni032Fu_uni032FUcaronucaronUdblgraveudblgraveUdieresisacuteudieresisacuteUdieresiscaronudieresiscaronUdieresisgraveudieresisgraveUdotbelowudotbelowUhookaboveuhookaboveUhornacuteuhornacuteUhorndotbelowuhorndotbelowUhorngraveuhorngraveUhornhookaboveuhornhookaboveUhorntildeuhorntildeUhungarumlautuhungarumlautUmacronumacronUringuringUtildeutildeWacutewacuteWcircumflexwcircumflexWdieresiswdieresisWgravewgraveYcircumflexycircumflexYdotbelowydotbelowYgraveygraveYhookaboveyhookaboveYtildeytildeZacutezacuteZdotaccentzdotaccentZdotbelowzdotbelowuni00A0uni2127zero.slashOrogateorogatequotedblbase.cmquotedblleft.cmquotedblright.cmfraction.althyphen.dupuni2010uni2011uni00ADhyphen.althyphendblemdash.althyphendbl.altohmacute.dupae.dupAE.dupcedilla.dupcircumflex.dupdieresis.dupgermandbls.dupmacron.dupoe.dupOE.duposlash.dupOslash.dupquoteleft.dupquoteright.duptilde.dupDcroatuni0237GcedillagcedillaKcedillakcedillaLcedillalcedillaNcedillancedillaRcedillarcedillaAlphaBetaEpsilonZetaEtaIotaKappaMuNuOmicronRhoTauChiuni2040uni203Funi20542.004Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LMMono10-RegularLMMono10Normalm+~'I ps%+/3R-z06>kt = A E J O   ' R V P   $ o   ( 3 ^ c h =Cu x 5>KOS@OZ^p{ !(=DLz  DINQV[_d /3;Rimw{ %+0ARcs%1=BIMRX^dinyvvsq\`k[cukm_y|~u| }ln{e }t~mwg6#=X   `g~Ujh D FMDUSqv23rɋϖƘ֮T\@N pdnyxXuUo@@{K +'&D"ԙr$ wrrwxqrw } w||w~P}>|u~|~}u~E~V}>|u~|~}u~E~njmyusnx\g}|~شR}u q|& }& i j IaПstmfzoʋt}Ͱȴ? EO}r/ XjovuaJmkm{ʣͱ2Z^Q0CjP[ h oL|pG }XoLh sZ\V:?'-ٮtzvi|hca $IL ĵuw< ! ["\ "&  >i {s8 ~wipo{ztw|nuy s{#R"}:8 #1 (Krs{rK'Ƶ tzk xUZi]{h]-D@6`jx@{umhrA^G5N@HyX~a1E~| t0zpHR__WUa$ķ\V_@`''@5 q s{ R l kq sOy`Wʱu{tvwyq I U W & b F.a@h@n @Z @ b UhjvzMRt>8894{r8 omq{}~ /  _NWo\Ztwu\\MW 4 <|qI  x<stn):sb05*)]:z{y~rj]XJ l:gbp=:ae -luzmbU^@<6HIsp O N{}ZC ljw$M$jl[v ? b F.eM"W L 0W Z @b tn4,Tp}3|qg '| }u| u u } i i xu w Hg  @^  @{." z TWrbfc`wSPQSacrÿF`~`pjmsixefisp~ xs|tts|xbSSbhffh haJkvz~|]qvtMvp^J[=`uzXo SN;~[Ozb<q2{{|_'2{vv_ȋۘǜ j aПstmfzoʋt}Ͱȴ? EO}r/ XjovuaJmkm{ʣͱ2Z^Q0Cj q}^\ B _F -zeqhepltn|tvtuzn / qR VG |rR uw{@zoc +%QJXIyw| lZQ1BD3px2fZg .4_㧑 xW  U ) 4 r B9 oE . jjBy -Ћ0F $ ~{Semwsqyz F h~^yr ckx v 9``vk}' 5r|Sb}qH^gnn3r}S|rml}kvlm Ϊvkq]T~teqkv8 Y YE Zr oop}Fu_ V}p2snz.bwJ|VW::LNl@9 ${x\_U| Jô* M W u  pzyqac/[ ȵ+Ë+g[ oop}Fue Tr _(^ ){{  {)|~{|  [2[ES[1l)V>. 6,_J1 }Z1 .4 Z  up _93 _ %9% z@wx nkiI!  } 1 FS}}uwgzvu`a؄/ZGWh_`v|eL]4V'{r8&& u q|& fkxgdmwtq p w@ ~  9DWkU3WWzb^!yswg* ^B F5IRCJdwǽHA]TT,tBJAۦ6 7<:RYq@vKP@*38RM_BBMÿû[WFIS8R8ILN{ 8XKyLT и\ D I~y~ c , c DO˼ST s{r fbjyqsptxC<]{y} lb.kF. q}^ B F26 2jb`+,*õ YHFY T m "@A w \r |w~  {~| {x[dzzzu _xpxp_ i fv   z~qisz{{wxg ALip}j-B}z { F \7 \7 F vg2mb~do|ojkm}us  q| w  a 6 Ëؕ˜zJXGU v^ G ΋d xȋp Sv F.M@AAMJ0   U{{{ \  , ww ́ %}ID7TGF9R t Jк Gz {yz  sr s _xoxmb i9Dk Љ lUy|w  p  jj _$NjUǡ w /gw8  ݉    hvw } iosw~x 5l drsi y~  Q     x{   \ i j ϱk 8"# cmgz    ϱ.w ]vw6 j O[YO r  I    U T h _ vzw t  I r   t w y~ {x "B?_ !#C=]\^<>$D %E&F'G(H|)I*J+K,L-M.N/O0P1Q  2R h3S4T5U6V@7W8X9Y:Z;[U c }-moqsuy0/3t{5}a~7,8gp:<> yo`ec AjxkCE  FGI}|  srz{viwAu K!*,fb2649  NM<@DFHPR ` lndpx,'.&%2469OS;Q=@BD*$#)HJ+Lw B8>  ~%'.;M  "$+HT]jGnb&@L\KX_ 2>Zg   ? I \ g   B  E W   : ; Z q x -8 *=F5N\+L[h{)6Ik:N[o}MF@~TV4?_qw~On=  !'" """""#G#I###$"$r%% %)%%&&&'t'~''''''(((8(C(_(k((((())&)8)})))***@*R******+ +&+3+>+I++,#,z,,-U---.m...////000=0e0y0000001"1:2222f22233/3G3_3p33334 444&464F4U4d4s44444445 5,5@5U55555556R67 7F7P7_7n777777788b8p8888889909^9h::-:3:::::;<<=n=y={==>q>>?6?7?F?`?q?????@ @)@3ASAeAwAAAAAAAABB2B>BEB\BwBBBBCC7CMCfChCjCCCCCCDDDDjDqDDE EE6ELEoEEEEEEEFGMGYGdGGH:H|HHHHHHI+I4IIJQJuJKKsKLZLLMMMMM#M,MMMMMMMNNN"NGNXNyNNOoOP2P4P?PIPPQQ Q8QTR R9R;RSRpRRRRSSTTTTTUUPUUUVV2VWW.XSXXXXXY"YDYYYYYYZZZZ$Z+Z:Z_ZyZZZZZZ[N[c[u[[[\\,\4\\\]]])]]]]]^^a^j^u^^___``>`Q`````aa,aIa`b^bc c*c:cccycccdlddddde*e@eUefeveeeeeeeffHfffffg,g>gPg\ghgtggggggggggggh$hUh^hdhjhph}hhhhhhhhi ii!i-i9iFiLiSi]igiqi{iiiiiiiiij-jjjkklOlllllm,mkmumnnnoaouoooop0pHp]pvqzqqqrMrcrtrss0sBsTssttuBuVuuuuuvv$v+v>vQvdvww^wwwxyzzz zDzPzzzzz{U{|>A kȠȿ X   !7 n  ,?(s>b9]nurp3i ha U1E>(m@K(  8 7)( x> "(X2  +?D( .O 4H C O(etK S *d( -Ћ 6F ɀ w(@J.  ! x" E БÃëJËSd~$s{/5pDj5pV~bwƢvDYU^'`SLQKxs{h]@?C׿xXͨϻoqq_x~{fe0 nygYS|ťH Vfg}^ʦ{jtdsI7ڄ7f{r~PRVɕ>X^\Kn~^X( ) r  ' Wz ,jjhhwrbbV~ qA j и~%>}j>.4 Wjb{ih{bjQy4 R &[s{= M/H4 Ma Brr ,; &he}{xtxII~xtc 0  Bha x) iB[0" F_ EjN   U1E :[SS[l)Vu q|. 6,_J1 }Z1 .4 Z 8  x> h~IIx{}c~x~ed   l u vgG  + O H C ̋ xDv7&6w}ZI& e $ >vy&Zv:Iy&$&# * wNs{0mxe6Wx{vor:0{s8a r/ з  eYob  AIUy]qn` 1YBS ]hV@srw|85J'f0||w`e x wz #h#"D  wyιFew}u|[w}yx2k1wr/Ts{ZihzepbR%,*ϹkZ, ;a 2RZ99AJָ>Iȋ brM!ZISk|klqux%;2cd~9O : 8`: tsrwwrwT{v*]elAQ  2 g2޻Imegqoioh~Uex|}{|zvts{ xu~f'|wu|~F{yzF 8%}Wo  -2<+gܶ B rnlihxoƾֶù & <96f]3EZQITqN}lr   # T |M6 i1:k<{+sԴ\b;harL#LL% >~Vx?`*`q|P%? e v YY$s{ 1 4 /in! ?` 5 m ZTZZLZc5(q| RA&? |q (5c|q vlou8  x1 3 nTg|@yrj @  K  nN%'JNJF(J ==J (&)' vw !| vV   w !Ek-V  Pw !Ek! E*|w O}ykPwaP E E*|w O}yk\ OO~!Ek!  \ 2r|alU$`%Bm{׿lDEY+@FJɒ l=tvdyNE o  wPˮ !Ek! EkqsOywP˺aP E EkqsOy w !Ek! >I V >I  ̮́ !Ek =0{{= - ̺́c" E  =0 {{= - !<9 x" E C !I" x" E 7  w !Il 7 w}l 7 \OOz!I"= x 7 7H !I6 x" E 6 w !I"V  w}"V  ^̮́ !I  `g~Ujh@G Q̺́f" E ۪=~wipo{ztw|nuyT  0 !%' x" E ' O-OJ!W<%W% Лci" E N \OOz!F x f kȠȿ X  ȵމ+Ë+g[ o op}Fu@e Q r _( r Ƞȿvw @X 〗  " vw !A& vV & vzw !  zw~ 0   ! ʮ !RB2 }2vVwыzA|հ(Bfx{{x|}}|f RlmnGG nmlMvww U\uEܼ|xrrXzo$rypmisxtxMzuMvww s(,6vz{{y}}M~kb{si}wvrxI_)OgOzu| }ln{e }t~mwg6#drqg"=X_#>?`̱֓ѽ?F"x[ pW2I% b F.* W \ @ V32Ml@zs}a}{\kE|snnp!{~}{{~!Kldb#00 /i~0~y@z}}zz}@&V`rPLы~1L3[axljhjY}oϓ -`lswwssw;*ZЋb|X,?(s>b9]nurp3,Kx  ￙ {h]-D@6`jx{umhrA^G5N@yX~a1E~|! t1zpHR__WUa$ķ\V_@`''@5@4 i 1&r 6P7P7kNznPq6kNvzP7P7zvnPvVw! vVw!vmȤ4 sNhȤ4 ONm r/ Xvhv hh ɨO * Y "ZC b˼w$h>0 L.-b˼w# T>BB.-$h0 G"# TB G" gf0 :%W% ]\O N{}_93  _EC :%W%\$z0 QH \# zB[H a 8 {< < | vwT0>z vwY 05 | ˼wT0i- ˼wY 0{-| x)S:9 .QC| x)TG" .Q7 | x u#' .lg' )4:%W% Ђ.4zN }ȿН)=:%W%ga Ђ.=z%9%vm | i6W0J i6h)H iBt."uoouuoouU | vwT0=?& vwY 04&| vzwT86  vzwY 0- @2 . 2KKeuA}:KOҋǹ_ZMOC9O]kԘNj8Dm/\loawvf\/m! 纪anͽ$ OjjVkKw+k|!pt{d~Fpx~w~z~}}}a_)rxR}u q|& }& iqmca7_)$ &c "\ "&  >iqnca7 x)| ́Te% ́Y z% 6xN C F_ "6xN 7  U1E U1(m@K(| މ 8 0o | މx> 0)z qRRvg wvwvigvI Vu vߖȏoqkv| $ 8 m $ x> <8 7)( x8> "(bKFf8 kuoHouuooubKxF>  Юt8 CS i6h> .H Ю8 CS$ 2i6> .Huoouuoou2 IB*2Ѣeѫhuu ~(E (  |x{{x9w|xxyN }}}|{y ! 4zz,(x{{x y5 | ihwvF^=>q|6 mG\ ]f xgs{%F$ @/ W a X2 IB*2 B2͏J0\B\)]g{vbw{qln,7 'x I5CK:uNzšJ=vA;Do܍ygjgegj ruuswq\9`Z`Pvk}' @r|Sb}qH^gnn3r}S|rmTl}kvlHm fvkq]T~teqkv8@@ VH  c6 X$ hl DiYvgG_H j$xvhJESHTQ1CJ::CƢux$jkq}pZ{hkHnLoMF- mml}vqzƨ dr/TT4ryagF gvmkqqji}<gF a .rya: l0wvxv wFP)X}u opvde`4$`*(X lKK@r`| މ +0T T TO H C # {h R0|pG s $s 4r0h+ssa 5_ "B3$Hee` |  +!9 O H C C  <+?D( .O 4H *C O(| +(K TкO H C [ t+Kn  кZO hH RC [H |  +Q?% TO H C AG   +YV$ȽɩV/ʫGNYTT z\U}Gn`UôF~rr}yy@<=T]\epji~za`^_ysLu~zy|\C7d utswxrXuԥ@HC?J-b? V+u q|bF\SiMG΂f`O1C\ϔ }4 $O}r/ X}h}  Rwwz" "  "v zXqDAdTADu߮ >DJqlsip@! v,h+ u h -8U 2cM }{z{~z{}{ʲfntfWRfoxȋȋ;$ 9QsvvtzoMii8{w)ʦߋ s'FJ4ȋ)F%Rwu\:>$|tY8!፶~sB!,bZy[nh\/b9 *[%v\6Pw{uy~݋O-W6^z}wo}}ތE!S7_{rxw^: 8`: : 8`: : 8`:  ^ǰ: * T-Ћ$F !  h v{pq~swVCcD`wy~ztwdnv|{prqQOR} ɞ*9 ]1TC*d( -Ћ 6F  w(*']L'LP[X T-ЂЋ(F ! BH LP[X  -GЋjF  } LP[X$ 2 T-GЋeF  }$ ZU2j paПstmfzx JSt}Ͱȴ? EO}r/ Xjovuaf9Ez}m{ʣͱ2Z^Q0CjP[    uU @~{w|bL+~{z}~z{~~|th{y{6QpslZdlqϱ f fsq(.q|z~l[QZɬ瘣m=h^&I2?֘sq(.E-!r@~qż[Mjx=/~s{vwy}rSىJкeKAQ 0$ 2 g2޻01b elAQ 99 2 g2޻MNColЩde$l:gbp=:aeH -luamszmbU^@<6HIsp@w4W`P[T~uw/2òdshvlQw\wvmvȶxpL ryyrmw}Wtomujy E\dI(1vE`r/#  J{[ob wn~oh|w "tfROhsizyt@|z}{~yn||@inmok]we~{_n͵dDz} Ul{|@~@ FpC"sgQOhsizyt|z~{~~yo||inmok^wd~~{_n̶vw6@J. f@4. @4. "on*t\}Wno !Q]2I -2x<+gܶ2zy} XNPdbaxt_hsnjo.{> vw # 0+S vw;# ˼w # 0:B-˼w;B- # 9 DC #  "D7  # +'D3f' # , a h L (W  Z @b@ vwĀ# ; ga b vm # , |!9 a h L (W  Z @b@-9 vwĀ# ; f&&b u2&\t# co \T Gb F.1@M{rl@miU1:k< W T@Z  b[I vw # 0,&vw;$& vzw # 03 vzw;+  ow ^g .^ .N{..k . Y^ ){{  {)|~{w@  oȽvwHM ` @ \ow ы(g @a@^  {.b k h \ w h,,@^){{Q@  {)|~{R@w [F oȽvwHN&` A& oȾvwiH8H  w4 Xl+  oȞ́ @g  ^ !@{.$@z A =0{{= - ́Pl$A =0{{= - # p< D< #  G2ʹ b F.bM!W L (W Z @@bO2"roz~~y}ighggh}z|rt}zHҒ Siaiat*& & m_: IWWVJq|:5}nqtgf7ߝ_#T $u{tvwyqq}^i^1:k<{+sԴniqmca`WʱUii8zaBPf_)}cTC`DQkՋ6Wh+ u h5԰`jj ϱС齟# 6ffȱϱ b. F.`M @W n Z @b ^f ́ # 9>% ́;AA =0{{= - nvw! ?`0$T ى 5 0N n! ?`!" 5 !7 nȿ4X[4W4?`*%W%[;:[5 ,.N nvw! ?`0%&ى 5 0 & 44yzz4 <|qI }~|z}$z 9h;-r9rz}ᖦ}ku0T}9\^s9}$Sw剑9YasyaJЎ<ЎJo{_xxuuwChsr<shwwZww<rihxohiuxsj | މx10T vw3 j O | x1!" 3 nTg|@yrj$"7  14%W% YHݕ4Y@3 @j /N i6h1Tn xN)][ȧ0 3 jS | xxs{#RQ1M #1 e 5x{|wrs{r{xP(d w{{h| މx10& vw3 j &|  x18$  vzw3 j R | x1H?% ̧́3 jMKA =0{{= - | މ@ 0o ىK 0! | @ 0/9 K =C| @ (I wK! >I vKM vKM Qv5[M KuKu9 C"vwl 7 {wl 7 g7 66w"V w"V @  `g~Ujh@. @  `g~Ujh@. (<'<' &:'v  v hga n`vm v  |!9 n`-9 G" tN v pf&&n`u2&v  Bht & F1Y&  a    8 {< < IX*2X2  IX*2 UBt2Nϱ fN JôS  JôS 5}fv@J. f@J. 8@4. vww ,|w~~ay.qjuxۮ_)OgOru| }ln{e }t~mwg6#drqg =X | _#vw3s CE   U vwxQ{~}3\`ŇqopyD3}~|}{~}}q`kcpayvxv|vpkq̽w_u||gk<lTzz}|>v!wSu9brtB}|{s~ubͩU 6OEpr|y{~@R;:]RZt`~~y[[   vwCvQwwwyz0zxnzv+zywpy{ty1ynn}tuwm_ymrzwrtp\ * _) vws@( Ҁ) drqg@@  o ЉcdnyxXuUo@@{K +'@ &ܣȟD"ԙr$s !Ћۇ@;B$ 9Qsvvtzouu`k! u5}jVʐ8Ih`5X~|}z{{nfs!^[Zq&zvi|kgf}zy~}zP)k@ /1 kPz}uw<BP^ ĭvwC Hh!cJaH!;vJ _)rމxR}u q|& }& iqmca7i>z _)و["\ "&  >iqnca7i5 vNF_ 8^ މF_ 0sS ى6fN  vlab}ajܶ{y|ԔX^[{bC(YweE{{|;O^xX+kZ k ha;.o2 lfJ?ؒ)X_Z3EbvwvAH?^!_RI 7gxy{{t { 0m^ _ЋLgl..(3{kqpdc70n qIyr<dgwiCcd9:}G~}Vq{xs9qVI8"D S^: 8`: ^: R`: Jvww6< owqԄrvtD=EzD xuHrur}}}-[lo: 8`: : 8`: 8: R`: Jvwwm? ǶwrPu|yu~}~#mfvwm?`yttzztLJKsf hԢ8ZD54DE44Dt@OOA@OOA^HreQ3Ѥ}vX{}xmtѢw|dvEq,~BGy_O|vpqw}Ţӣ{_zqEo83:?N3w|g\zovʌw 6v9[`DyS{|wJA =0{{= - Mv <# :M MvT b F.@MW +@L  W *@Z  bBbM 0 KeG BAeG 9@ . 0 |  8 =Z% | x> ne% hx0 0xcc0 ' 0FMDUSqv23rɋϖƘ֮T\@Ngl?) ){?/2|'F.M@AAMJ0 o{Н{n@H\}Wʀo @@Q%g%W%| onE\}Wo @QOA  =0 {{= !- B-2<+gܶ5% k  QPȉtMɋfn{w~x\A@h}@U\|w|}V~P5S65>f{DwyRIbp!OOKˮH5lMˍlK q]`Q@u rxveGsu{tT[x]VTJ^mxxtzpqwvmH>Qw} d@vx0ʚVUet||tuHIGT0>pphqnox<xwcu~ ~w}z6xN X I &s{= M/H4 M a BrrS kQwO}s.xw{~tolufsqkz~-rxrCvNțw@ts{ @xu~ S NDlnrwb=ʬ"H },px㋓{DZep_tz|uo xMŸN%bdyljo:kTwC:NZTY|a\)'Lpntozn=J (nlbcOPPO}`cb^LMML^`}ǙF^^nimqbccbqnmi^^C=EF +X$)-Uio>Cd<H PbKOv| V  a 0 ; ` d l p t  {  YdmAEIMx|/4auz6=KW^y}&O_dotz&*;DHLPVZcmx  %*/9@H[nsw|$(/39HVZahuy  +0;@|w O}ykwszwGa`Hsxx9 r|alU$`%Bm{׿lDEY+FJɒ@l=tvdy : IWWVJq|:/ uoouuoou A  =0 {{=  - V $ Fub{ih{b_ Qi :}d gl..(,F.M@AAMJ0 6 5 ~vA =@0{{@= - + }4 s^h^4 O}r/ Xvhv , _kGnGޙmqzz}__x;t9g/z}~Vffj0\Srq*{r $s{ 1 Ci~fyl.4 /"r7~r 4 %syysR Y~yhxucwWtxysR t|ȝ㌙W z' {rI  ׂ @jvZMwj | ihwvF}q|6 }f ygjgyU~ `i~xn__|v   {h]-D@6`jx{umhrA^G5NA yX~a1E~|"t2@zpHR__WUa̐ķ\V_@`''@5 ~u|~>E}~u}|~V~u|~>E}~u}|~ gs{}9a |P uCyuxy|i |{ emwsrvxeSXJ@YkjX/0XY֋Ջۋu ձoOwd{r- hvMMvppM zg^Mb% F1 :1 u q| j T cYZ lm w' oeux]y vwzi i1:k< II9xϋ΋wz%9% _|X}u>b 5F Q+} ݾ >!vadwY^^Zwuы롱e {adsmpun{lmnus rI& .69x[nxrtu|kL\4 vw T@^ ){{  {)|~{@|  vw`HM W HL "W Z @b  m> 4 _V}p1 (}qu8ҁ tt} V vwwz@wx nkiI  emwsrxz7 s{!O Щ?c{C|*а:+Kt.EU{s8U/ކ YɺrsunX%{trT>N`V~vw|pfeA =0 {SVadr "u | MBMWMAM0Mt!tu q|#RD&>& #&  uu{s8stVVtu8L $W , A4 W} iY  r|alU$`%Bm{׿lDEY+FJɒdrf^ =tvdy _  ooqvKʧ& &-DJJJi^Koop}qjmrosJ1PtUlCv[kBJhmkerllfq \:r|alU$`%Bm{׿lDEY+@FJɒ l=tvdyJE G k   hvMMvpb-orugg78FMDUSqv23rɋϖƘ֮T\@N r |[v;[:ˡNv} }p9t1bkI*$^MjZdP4vB^l" E {s8 sw q r ji ioz}}zy~ju>b 5F Q+j}zPi\IïB E[Fj}ҋϽg^m|hpukqrgR|nlHQNSL0c>qxrtu|k2Q r / | onT\}Wo BQ  > h_ubRjkytݸBJ;DO7oKotv|md8E,&8 2=(+gvyqrwzmkDZ=TUR8:VӶtwd x njmyus`nx\g}|~ش|~sY[cNkw| _B f%W%  ypmdc dlЩ@! ihuwp c(e@eul!tzk  1  k+iM|nxvuyxtobtͣڎ aF+EJE=h L P7P7kNznP xRH ) c(eeult  g}x.7 ! 3A  Kz}s!F>fwmڹOO * dryl ]|xaq}~g]{ xN_[ u f}}fhh  wsswwssw |~ P r|  ?hhh?h z}}zz}  |wsxEG ?틴%  a %W% KMhPWbĤlgҵXreg}   ) .F   CvC  3 y45*b> uoouuoouǼȸtfsw7,';:(  {sl r{ r xR "#hhh#"hhh" ? |l2![^yli So  w   ;v B4}zz}}z  oD ZO cnt $|wx{{xb_h[fe [ ~ttuirbo~v s|ln|  : yw q  d[ZeQ@=S n }r  F. ы ыы fYYfPAAP fshsmt  Ӊ vwv;;wd }z zP x{{xw| S  8xg HqŇQ {}} T t ,v w   Н a F, |  v ~wj yiuxa \  ˼wPK  gv wyk|qm kI9TzaoQ [[ T ۮl}o T ~y}~ |   44  ˼w h z}  4   vN T uvzz     !  r  &   8    : J     8 +     X  2  F X D ,   :  9 9  ) ( I    $ :  7 , &   * 4  &   8   8 O N G 0    : 8     5 # 8 9 i    X #  & 8 ( >     4 H  , 5 :    , 4   8         0 ! 2  2  2  2  2  2  2  2  2  2  2  2  2  2  2   2  2  2  !  !  2  2   2 &  K  2  2  2 ;   ; E  2    WJJJJ  } ( I re ( I ( I ( I ( I  I   re (  \ B B  N {  $  $  $ u " & z : & 0  $ "  N 0  7  7  7  7  7  7  7  7  7  7  7  7  7  7  7   7 8 8  /  7   7    9  7 7 >  * F@ &   &  &  &  &  &   / .             \O O N O N O N O N O N O N O N O O N O N O N J J ' 0 O N O O N 0 G 0     :   :  :  :  :  =  & *  : J==    " &   \(                 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9    8 9  8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9  8    8 9 } b w 8 + 8 + 8 9 0  -  (  & &  >  |                       \    s s 4 H 4 H 4 H 7 4 H 4 H 4 H $ 8 (            8     XKK                                            9 9 ,   &              !                0 ! 0 ! 0 ! 0 ! 0  W W W W WJ W W W W W WJ W W te t t te t t t t X X  [ [N x x  t tz x      \O J J   J=    X XK   2   A L  Wo7>t&q8ONGG0989>Ki[X  ON:89 I/0,45i,5,/(2 FDFLTcyrl*latn@"* #+"AZE 4CRT FMOL XROM lTRK  $, %- &.  '/!(0)12aalt.aalt6aalt>aaltFaaltNaaltVaalt^aaltfdligndligtdligzdligdligdligdligdligfracfracfracfracfracfracfracfraclnumlnumlnumlnumlnumlnumlnumlnumloclloclonum onumonumonumonum"onum(onum.onum4zero:zero@zeroFzeroLzeroRzeroXzero^zerod"*2:BJ @06x 4 "f9fk)9)k%f9%)9      0389NRdejky  '<' <    0389NRdejk y  Rj 0389NRdejky     5\y0389NRdejk      y DFLTcyrl latn,"AZE *CRT 2MOL :ROM BTRK Jsize2size6size:size>sizeBsizeFsizeJsizeN" d_nPK!&mdc/resources/lmmonocaps10-regular.otfOTTO 0CFF |сGPOSQ7cGSUBiTOS/2i_ `cmap{B  fhead }6hhea$hmtxe maxpPname4otpost~F\ 7_<hh==2P XKX^E UKWN@  "< c  !:/iQ}    > ( t (  ,2 ^ Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.Latin Modern Mono Caps10 Regular2.004;UKWN;LMMonoCaps10-RegularLatin Modern Mono Caps 10 RegularVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853LMMonoCaps10-RegularPlease refer to the Copyright section for the font trademark attribution notices.LM Mono Caps 10 RegularRegularCopyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LM Mono Caps 10Regular2.004;UKWN;LMMonoCaps10-RegularLMMonoCaps10-RegularVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853Please refer to the Copyright section for the font trademark attribution notices.Latin Modern Mono Caps10 Regular ggg5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%'7{ L]RV.B488bs'~(:;po)&<=z KQU\-3A'I R~  !#%')+-157:<>@BDFHKMOQSUWY[]_aceikmoqsuxz|~  7Y #&2? %'+/9CG]cmo      " & 0 ; = @ F R T !!!!'!.!"""""""##*$#%&j&'6F +/26;@CIMWZgko~8L$   "$&(*,.469;=?ACEGJLNPRTVXZ\^`bdhjlnprtvy{} 7X#&.? $&*.6BDXbln      & 0 9 = ? D R T !!!!&!.!"""""""##)$"%&j&'%8 ).15:@CHLPZckn~8C$?6!676957>JNJQyc^bHJy7K!z")BCQUWg?A9[]_aY}G&4/vޟDއ݁"|{^ F . `t NZg5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%''s:~,%;$z \KQU!A-37k"8{ ]LRV"B.48l#p|}deY 'I9)HJ(|- !flqj\<=U&)&Y    {ELMMonoCaps10-Regular2LMNOP ;  Wam496 $.5<CJQXeir} !:OXanx)>KSVaky,4EHKRYbr ",3:AFV\afkz1@GMZhp-CLZiuz%2?LYdkv}")4;BIT[fmx    ' 2 @ N Y d s  2 B R [ d m v }   ) 2 < F L R X ^ n ~   ( 2 ; D N X _ f r ~    $ / : C L U ^ g p v |  "(.4:GMXco{ +7AKT]ciou#,5>GQ[eo| #)/5;GS\eoy '09CMV_ekt} )6CMWes}$-39CMSY_eoy '47@FLWeq "*/3:>AEJLNUX[^elsxG[gmacute.capacute.ts1anglearcangleleftanglerightAogonekaogonekuni2193uni2190uni2192uni2191asterisk.mathbahtbigcircleblanksymbolstar.altbreve.capbreve.ts1space_uni0306_uni0301.capspace_uni0306_uni0301space_uni0306_uni0300.capspace_uni0306_uni0300space_uni0306_uni0309.capspace_uni0306_uni0309space_uni0306_uni0303.capspace_uni0306_uni0303caron.capcaron.ts1cent.oldstylecentigradecircumflex.capspace_uni0302_uni0301.capspace_uni0302_uni0301space_uni0302_uni0300.capspace_uni0302_uni0300space_uni0302_uni0309.capspace_uni0302_uni0309space_uni0302_uni0303.capspace_uni0302_uni0303space_uni0326copyleftcwmcwmascendercwmcapitaldblbracketleftdblbracketrightspace_uni030F.capspace_uni030Fdblgrave.ts1dblverticalbardcroatDeltadiameterdieddieresis.capdieresis.ts1discountdivorceddollar.oldstyledongdotaccent.capspace_uni0323dotlessjeight.taboldstyleEngengEogonekeogonekestimatedfive.taboldstylefour.taboldstyleGammagnaborretnigrave.capgrave.ts1guaraniHbarhbarspace_uni0309.capspace_uni0309hungarumlaut.caphungarumlaut.ts1interrobangIogonekiogonekLambdaleafliramacron.capmacron.ts1marrieduni00B5uni266Anairanine.taboldstylenumeroOhornohornOmegaone.taboldstyleone.superiorOogonekoogonekopenbulletparagraph.altperthousandzeropesoPhiPiPsipublishedquillbracketleftquillbracketrightquotedblbase.csquotedblbase.ts1quotedblright.csquotesinglbase.ts1quotesingle.ts1radicalrecipereferencemarkregistered.altring.capspace_uni030A_uni0301.capspace_uni030A_uni0301Scedillascedillaseven.taboldstyleSigmasix.taboldstyleThetathree.taboldstylethree.superiortieaccentcapitaltieaccentcapital.newtieaccentlowercasetieaccentlowercase.newtilde.capasciitilde.lowtwo.taboldstyletwo.superiorUhornuhornUogonekuogonekUpsilondotaccent.altuni2423wonXizero.taboldstyleEuroinfinityringhalfleftringhalfrightmacron.altmacron.cap.altspace_uni0311space_uni0311.capspace_uni032Espace_uni032Fspace_uni0331space_uni0332space_uni0330uni0301.capuni0301uni0306.capuni0306uni032Euni032Funi0311.capuni0311uni030C.capuni030Cuni0302.capuni0302uni0326uni030F.capuni030Funi0308.capuni0308uni0307.capuni0307uni0323uni0300.capuni0300uni0309.capuni0309uni030B.capuni030Buni0332uni0331uni0304.capuni0304uni030A.capuni030Auni0303.capuni0303uni0330space_uni0308_uni0301.capspace_uni0308_uni0301space_uni0308_uni0300.capspace_uni0308_uni0300space_uni0308_uni030C.capspace_uni0308_uni030CAbreveabreveAbreveacuteabreveacuteAbrevedotbelowabrevedotbelowAbrevegraveabrevegraveAbrevehookaboveabrevehookaboveAbrevetildeabrevetildeAcaronacaronAcircumflexacuteacircumflexacuteAcircumflexdotbelowacircumflexdotbelowAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAdblgraveadblgraveAdotbelowadotbelowAEacuteaeacuteAhookaboveahookaboveAmacronamacronAogonekacuteaogonekacuteAringacutearingacuteCacutecacuteCcaronccaronCcircumflexccircumflexCdotaccentcdotaccentDcarondcaronDdotbelowddotbelowDlinebelowdlinebelowEbreveebreveEcaronecaronEcircumflexacuteecircumflexacuteEcircumflexdotbelowecircumflexdotbelowEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEdblgraveedblgraveEdotaccentedotaccentEdotbelowedotbelowEhookaboveehookaboveEmacronemacronEogonekacuteeogonekacuteEreversedereversedEtildeetildeeturnedschwaGacutegacuteGbrevegbreveGcarongcaronGcircumflexgcircumflexGcommaaccentgcommaaccentGdotaccentgdotaccentHbrevebelowhbrevebelowHcircumflexhcircumflexHdieresishdieresisHdotbelowhdotbelowH_uni0303h_uni0303IbreveibreveIcaronicaronIdblgraveidblgraveIdieresisacuteidieresisacuteIdotaccentIdotbelowidotbelowIhookaboveihookaboveImacronimacronImacron.altimacron.altIogonekacuteiogonekacuteItildeitildeJacutejacuteJ_uni030C.capjcaronJcircumflexjcircumflexKcommaaccentkcommaaccentLacutelacuteLcaronlcaronLcommaaccentlcommaaccentLdotldotLdotbelowldotbelowLdotbelowmacronldotbelowmacronL_uni0303l_uni0303MdotbelowmdotbelowNacutenacuteNcaronncaronNcommaaccentncommaaccentNdotaccentndotaccentNdotbelowndotbelowObreveobreveOcaronocaronOcircumflexacuteocircumflexacuteOcircumflexdotbelowocircumflexdotbelowOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOdblgraveodblgraveOdotbelowodotbelowOhookaboveohookaboveOhornacuteohornacuteOhorndotbelowohorndotbelowOhorngraveohorngraveOhornhookaboveohornhookaboveOhorntildeohorntildeOhungarumlautohungarumlautOmacronomacronOogonekacuteoogonekacuteOslashacuteoslashacuteRacuteracuteRcaronrcaronRcommaaccentrcommaaccentRdblgraverdblgraveRdotaccentrdotaccentRdotbelowrdotbelowRdotbelowmacronrdotbelowmacronSacutesacuteScircumflexscircumflexuni0218uni0219SdotbelowsdotbelowTcarontcaronuni021Auni021BTcedillatcedillaT_uni0308tdieresisTdotbelowtdotbelowTlinebelowtlinebelowT_uni0303t_uni0303UbreveubreveU_uni032Fu_uni032FUcaronucaronUdblgraveudblgraveUdieresisacuteudieresisacuteUdieresiscaronudieresiscaronUdieresisgraveudieresisgraveUdotbelowudotbelowUhookaboveuhookaboveUhornacuteuhornacuteUhorndotbelowuhorndotbelowUhorngraveuhorngraveUhornhookaboveuhornhookaboveUhorntildeuhorntildeUhungarumlautuhungarumlautUmacronumacronUringuringUtildeutildeWacutewacuteWcircumflexwcircumflexWdieresiswdieresisWgravewgraveYcircumflexycircumflexYdotbelowydotbelowYgraveygraveYhookaboveyhookaboveYtildeytildeZacutezacuteZdotaccentzdotaccentZdotbelowzdotbelowuni00A0uni2127zero.slashOrogateorogatequotedblbase.cmquotedblleft.cmquotedblright.cmfraction.althyphen.dupuni2010uni2011uni00ADhyphen.althyphendblemdash.althyphendbl.altohmacute.dupae.dupAE.dupcedilla.dupcircumflex.dupdieresis.dupgermandbls.dupmacron.dupoe.dupOE.duposlash.dupOslash.dupquoteleft.dupquoteright.duptilde.dupDcroatuni0237GcedillagcedillaKcedillakcedillaLcedillalcedillaNcedillancedillaRcedillarcedillaAlphaBetaEpsilonZetaEtaIotaKappaMuNuOmicronRhoTauChiuni2040uni203Funi20542.004Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LMMonoCaps10-RegularLMMonoCaps10Normal,x);fI,3~OVw'fM PV[_    _ j  : ? ] e o z  ( 3 ; G 8 @ '/04 [fuz %)04<DIbms58Zdhnrz&*06;RWmrv}  '/5;@FKZk| *7DOVZfrx~|wO}yk|vusp]ZvY{~axhu^}{~wszwGa`Hsxx9 = FMDUSqv23rɋϖƘ֮T\@N |{ omq{}~~wipo{ztw|nuy {{ -wrqxwrrw }w||w~Pnjmyusnx\g}|~شaqxHHwurqtIHqFA}z }B3 {4 R } q| O } O  wtffIwfzKxVrr lz~~zcTdHJI_mxs{ y !PoL|pG }rYMroLh * Ga}oQG}oQa ~v }{ =^h^{ P}rP Mrvhvh oN DI :{rxXf Ҕ :h w |{omq{}~~wipo{ztw|nuy{{- <P_NWo\Ztwu\\MW M<|qLh~^yr | @ ihsy2  ~m i F@ w!  ׂ @jvZMwi |ihwvF}q|6P}fo i~xn__|vR`i~xn__|v= ljw$M$jk[v ?2 @~@m i uihvwCyuxy|i emwsrvxeSXJ@YkjX/0XY֋Ջۋu |rO tn4,Tp}3|qLg {'|}u| {u }֑  wH\  @T @{." k  ȤȤm X nmn~a-$m~nis l},nm mHmplBx',r 0 haJkvz~|]qvtMvp^J[=`uzXo02{vv_ȋۘǜN;~[Ozb<q2{{|_ xu  azn~ itB  mihsy^syjiZ h ] @ Z ]`B/7 %N ڻgg `W  4 P l z~ppvxwvnlmnvv @}{{~~{  lm H {py1g$ ~RzplyZQM |J| pwAyxl M {sU L y45*b{rLO }u{rLO b 5F Q+} jjBC {adsmpun{lmnus l bSSbhffhô M~ MFqxrtu|k2Qg  TS}WcBH Ⱥw |{omq{}~~wipo{ztw|nuy{{-~w}vxy{sXpw de~s ԓ lG > h_ubR jkytݸBJ;DO7oKotv|md8E u| }ln{e }t~mwg6#gwL f%W% x l S 9'r%rsrr'&&srrrrs&&'rrsr%r uxЋ V Y j f L kNvzP7P7zvnP p| |O ) t r , fbjyqsptxC<]{y}{zyJNeOU^ħhdֱUnf|e| \*ѲF w trB {sl Ev" i qM  {~| ?hhh?h Vȟ$ |wsxE G  #| d ]nxlhus2!} n } z}}zz} ) i  Ch C  rrB q2njdc=# i  µ~orx4/.4U6 }z  0h a  F`\^6%C[d  vw  rt ;h r n)  x{{xw| u oD o} 1|wx{|w]WcZff ^  uU l ́ {yz l ԥfrlf_hB. x u l GYy}~ d[ZeQ@=S  F5IRCJdw  ы ыы ` lO y|w fshsmt v ~ m nPQ   ݛ g    :  O  {}} iosw~x y~ drsi ,v w w ww   v rM 9` ~~{ z~ yiuxa z jad\î i i j cmgz 8"#  ǽHAx q ]vw6 ۮl}o כ   wpQ \ v  h P y~ uvzz g  . nM  "B?_ !#C=]\^<>$D %E&F'G(H|)I*J+K,L-M.N/O0P1Q  2R h3S4T5U6V@7W8X9Y:Z;[T b },lnprtx/.2tz4|~a~6,7gp9;= yo`ec @jxkBD EFH|{  srz{viwAu J )+fb1538  ML;?CEGOQ _ kmdow+&-%$1358NR:P<?AC)#"(GI*Kv A~7= }(:O~   WcjpGnG.;"Pr*}'1>HQZfs{  ( z  K T O W  = w x !*3;]foz8z?LY$1:M_{ %-?Pf}.@P+Jf^egDNnsR%> 7 !!!!f!|!!""""#A#b$4$L$_$$$%% %%:%J%m%~%%%%%%&1&A&\&f&&&&&&'+'k'''((&(6(Y(j((((()/)))**++p+z+|++,,,-----0-R-|------...6.v.../@/K/V//00"020E0^0y0000000111(161D1S1`1n1|1111222(2;2P2e2l2s23b333444,4=4Q4Y4i4y445 5J5555606F6h666747`77777899:J:U:W::;K;^;r<<<<*<:>>+>?>O>V>f>n>>>>>>???3?L?[?b?{?????@@@(@*@=@P@k@@@@A%AKAUA{AAAAABBBB BCCCCCD:DDDDEdEwEEEF1FGG7G_GH)HIIIIIIIIIJ$JJJJJJKKKSKaKKLLLMyM{MMMNENaNNNNOOO7OSOtOOOPPQQRQUQ`QmQRR8RHRcRRS SeSTUU!U-U9UEUpUUUV VV2V@VLVZVgVrVVVVVVW W#W@WZWvWWWWWXX/XWXYY)YQYcYYYYZZZ(ZwZZZZ[,[[\\\0\C\U\g\t\\\\\]^h^|^^^^^^^_q______```(`8`P`h`}`````aaOa\ahauaabbbb+b7bbbbccc c(c.c4cCcRccctc}ccccccccccddd!d,d8dDdPd]dcdjdtd~dddddddddeeeMeeefgfggugwgyg{ggh2hjIj\jwjkkXkmkllllm2mHmRm\mmnn n]nobooppNppppppppq q/qqr+rrrsctttttuuZuuuuv8vw!A  ^@ !5 a  + ?' >: D 6'C c8d*T@ ^ *B@ ѵX>>'N6' 67)' r .DҬ/*'X0 +?D'/*'[ V Kv՜wBc * d' @ (Z @`B/7 %/N @ڻggjS'@J-  x! БÃëJe~$W /=pDj5pV~bwƢvDYU^'`SLQKxs{h]ƀ?C׿xXͨϻoqq_x~{fe0 nygYS|ťH Vfg}^ʦ{jtdsI7ڄ7f{r~PRVɕ>X^\Kn~^Xp( ) f3nWTz ,jjhh bbV~ qA& jи~{rLO }j{rLO .MWjb{ih{bjH q R{ [W = MPHMMٌ Brr+ : D  &vwe}{xtxII~xtc  . _5 ѵXx) w,FU Щ> > N 6Hr DH vw~IIx{}c~x~e[ n + /9k| jX{v7&6wZ}Z I&e $ >h y&Zh :Iy&$&v# (wN 0mxe6Wx{vor:0 z C~mE[ ]soNvwAIUy]qn` 1YBSNvw ]hV@srw|85J'f0||w`ex  vRRz #h#" v=  wyιFew}u|[w}yx2k1w 6v 'ncsaqxHHwurqtHwYyyz˟.F-xq{yzu|zxqrp +: z:vȋbrM!ZISk|klqux%;2cd~9O% n7mtsrwwrwT{v* Gv , m{ 8d*T@  vImegqoioh~Uex|}{|zvty xu 9W  8G,f'|wu|~F{yzF8}WcH  89 ^ Btrnlihxoƾֶù & <96f]3EZQITqN}lf#  $ ,ѵOXry)yssy)yhv5NH{olro{H|Zm2v53 j sroR4 pzH{om}L*Ho{G{oM 4RorQw{tlx.  w1 ; EvnN%'JNJF(J ==J (&)' vA xvI|  A I P0 E*|wO}ykP4E*|wO}yk\ ˼wi| %  w˼wi|! % !w  EkqsOyȺw ! EkqsOy A A2!IA2!   3|{omq{}~~wipo{ztw|nuy{{-! 3|{omq{}~~wipo{ztw|nuy{{-  6 X h9  " X O5 0 7 x4R 7 \ ip " =%  wip! O57w%   4 X R4 0" ?!x 4R" ?! ^ " @1xk! R" @1   0   ' X "'  DG x! f\A \ ip %  wip! % ^@ȵ ޛ +Ë+g[ o op}Fu@\Q f_( r @s  vA&xvIA& v[A!xv[Ix!    ?0 x! R\0 vVwыzA|հ{xBfx{{x|}}| f RlmnGG nmlMvww U\uEܼ|xrrXzo$rypmisxtxMzuMvww s(,6vz{{y}}M~kb{si}wvrx I_) OgOz}u "=X z!ϱ R S xԱϱ.w! `R S  <~wY]uejByyzytBe]Yw~~|}}]KŹЗouzyiowfwlpp}uvuxvuwoyxi|~iyzweajvnjlxjyaew A~FQqqJQ]F~}}|~BtBjuvBwyM [m~{pssq~w}mxlzmxPr x}~u~~~j|||mlm}w~x{z|~{qs{s~p|{~z{x|||j~~~u~ xzx  11x! Dx1 N[&v;[:ˡN}zy~}zM4}}p{rL5Mz}1epQ<]ߡMj< K^QZdP4vB^QKvm ȋm #R* .< Jkdjz}Uo˼wK" b˼w5" Mv5CF ˼w5" v5F Mv hhhy~.{xx{~yh  ; K03 C 0; !9 9 ; KH6 C Wx9 8Ћdq; G~1Щipplw~SCw^+BwG{j{ozz^L${wwywc(eeult ڜ¾ ; KI" C W_5v; K($% C (l%  7"pplw~``ucsY ~ma T 0" Tz}n@9OژJȋOY/Z@zyw|mjy9QVmϺ{}ڗӊi|'wvyzssl=\HKpsQIL##Vve gzlqPqhUj !5 5)x<stn@Zkb|aJz{ my~rskh W |(?@ |Vz}v;Fڞ \' K @~~{W`~tZ]ۺĻs_{}yrpEOC)(Cʹ0w2ѡv19'rs}rsrruttqonp}ussrrrrss~upooputtrrsr}sr;3`hg`_hg`WvwVXP]BhdckhQs]kn  rwrzCV+<,}ʑ{P LvVVwVXڰ(]q4cpgwnhboq  mi}jcohj [}rtvglqĘËq~hr}n`ilmp[fwnw~|yosa~SthJ9ьw%\o7 r@q~rQoQ/9'\Vnqyzx{8o{xzyE/ &' MvwUgfR2+6 WC9s  M x{{x  MF>?`̱֓ѽ?FI g xRpW0  xWz0 MY>Doomy||yy|xqmoD }zJ@X4%3|xW1;%  h%  \h*%  w,Щ> vwp( ) fo |ߟ /  ˼wp( ) fL^"|˼w/ T"p( ) f/6 3*9p( ) f<" 3*5wp( )  < 7 |wJ $ 7 \w к{и\z( Y) f<" =% d *57w% p( ) f<4 3$4 wp( )  <" ?!|wJ $" ?!V́p( ) f<" @Y |`́/ $" @yp( ) f=' 3E' ]X\@( ) @f/G |hL[@ ihsy2  ~ b @@к{и\( ) fQ?% |жxд[@ ihsy:kI% \w к{и\z( Y) fQS% d IT% vwp( ) f4&|ߟ / & p( ) f!| / !p*əCi Cp( )  Y50 |J a0 ѵXѵX>g PVы~1L3W]wihh-}rP MrД -`lswwssw;*>PRы~: []|rhh@7 ƪݼ50F>bsswwssw _)w p}( ) u AKx Zl   ihsyS2  ~ @]humja?   p( ) f\иr{m}q| ilBwv_hiux.xuuhiux2k |[дso  ijZys~hirzL -DhirzNievv{nvw{mp`d;O./6AI @8ױD 4  .s ) L )usM  wqB LE6S4#0 q}#));́p( ) fKZY |́/ Sye ɋɋg{g~{|}ejoebnv{# 0K Foe}~{~rmlMX_Ujte}a`go_bdU_h % t~phcAWTVVq[ U vw +   כ *ѲF: D  Q  | P}fP6q|S}H ˼w + R" ˼w*ѲF: D [K" + !h6 : D 1=9 + "u" : D 1$5 >+ ?' >: =D 6'+ Kx%  YѲF: D B1uoouuoouC c8d*T@ ^ *B@  1&r 6P7P7kNznPq6kNvzP7P7zvnPvVw! vVw!   m{ =Nh{ PNmrP Mrvhvhhhɥ_t~mq_t q~trB ܔ ._.~  __b˼w  >.L."b˼w _>5 b."  .G"  _5 p5 gf.:G Ў5 A \ z.QH% \ 6_v5 H%  v 4!{8 8 uޛ x)0>z  ޛ w,0f u˼wx)0i" ˼ww,0"x)S:6 w,9x)TG"  w,5xu#' w' )4:G Џ,4IA }ȿН)=:%W%ga  Џ,=I%9%vh ui6)0J% i6h)H%  i5h,.H% uޛ x)0=?& ޛ w,0e&u x)0:!  w,8b!@0 0 KKeuA}:KOҋǹ_ZMOC9O]kԘNj8Dm/\loawvf\/m! 纪anͽ% OjjVkKw+k|!pt{d~Fpx~w~z~}}}aKg xR } q| O } O oszhe?  Kw* Ga}oQG}oQpszhe? x)ux)e$ w,$Щ> ?9FU " Щ> &5>8>>' 8N6'uޛ 60o x zBr DBv wfvg wvwvigvLO  {vߖȏoqkv| vN 6mnjmyus`nx\g}|~شxTvNzBr DJLnjmyus0nx\g}|~ش <67)' r .D/*'bKFf6kuoHouuooux8F[Br Dbvuo$ouuoouЮt6CS% \ "r ZD";T%  }Ю6CS% 0 \ Ы!r UD;T% 0 IB*0 ыɆѡѓO^_aUы@   Rq ttut@ SA4zz,{xx{{x    |ihwvF^= @q|6Pj`fo Hr az!>#n~ M-itB H X0 IB*0 B0 ͏J0\B\)]g{vbw{qln,7 'x I5CK:uNzšJ=vA;Do܍ygjgegj ruuswq\Z`Pvk}@r|Sb}qH^gnn3r}S|rmTl}kvlH݌ fvkq]T~teqkvU@@݌ VH%  tn CI% j$xvhJESHTQ1CJ::CƢux$jkq}pZ{hkHnLoMF- mml}vqzƖ [r/TT4ryagF gvmkqqji}<gF a . ya: l0wvxv wFP)X}u opvde`4$`*(X lKK@r`uޛ +0T  /0!T {y !PR0|pG s$srYHr0h+ss 5_ "B3$Hee` +!6 /=@9<+?D' (7&W/~}|0.{.lr}z/z}/zw :9ޔKv՜wBc Kv՜vwwBYf Jv٭ vwwƊa3Gy~v|zz\i~Hwur3SywhxbHr9KeK2KKz2,` v́̾ #I$́̾($Av6{e ,"1"D}x}xö_ɵ2fYwy{}}ywYfPAAP{  # ȋɋt@At O cNm{rLO  q|m*FV`F+!FVG x< q|+ O ->HC?J-b|qM O + q|b2C\ϔO2\SiMG΂f`  }M$P}rP Mr}h}h Rz " " "h zXqDAdTADu߮ {{rLO DJqlsip@! v,  -8K 2cM }{z{~z{}{ʲfntfWRfoxȋȋgw; % 9QsvvtzoVii8{w)ʦߋ s'FJ4ȋ)F%Rwu\:>$|tY8!፶~sB!,bZy[nh\/b9 *[%v\6Pw{uy~݋O-W6^z}wo}}ތE!S7_{rxwTn7n7n7 TǺi~xn__|v*  ߟ @ Z Y@`B/7 %  v{pq~swVCcD`wy~ztwdnv|{prqQOR} ɞ* 6 G9* d' @ (Z @`B/7 %/ jS'* ' Ga' E  X%  Z Z@`B/7 % ^% E  X% \ PZ .@`B/7 %^ ^}% E  X% 0 \ PPZ - `B/7 %]PN ڻgg^}% 0 I stmfzt ISt}Ͱȴ? EP}rP Ɏm{ʣͱM0w}rjovuaZ^Q0Cj     uK @~{w|bL+~{z}~z{~~|th{y{6QpslZdlqz ϱe  eT;spyfZmJYѿɨ~^}ox{lb*>9()7˸T; ?(9K^No̽QGEWTMn_slw|F~u}  , m{0$ ȋכ c&d*E@ ^ ,   , m{96 8d*T@ ^ Hv9v , s|qȋ1̧c9 9}' ЬЏ9 *qA \ 6rS}Wkc H M%  5v9 E% rrвв= FS>[T~uw/2ò dshvlQwhvw\wvm  xpF {"|}g|" {g EX^M0/vKZȦCȥ~iE L wn~oh|w"t fROhsizyt@|z}{~yn||@inmok]we~{_n͵dDz} Ul{|@~@ FpC"s gQOhsizyt|z~{~~yo||inmok^wd~~{_n̶vw6 q @J- f@4- @4- I *tS}Wnc!H ]0  |9 e0 zy} XNPdbaxt_hsnjo.{>vw# 0+S  u$ 0T ˼w# 0:B"˼w $ 0SN"# 6  $ )@9#  "  $ )'5# +'  $ D'  # , }{$ ,ovw Ā# ; ga  }{Ā$ ;ovh  # , |!6 }{$ ,o(6 vw Ā# ; f&& }{Ā$ ;ou-&\t# co% \t$ J% vw# 0,& u$ 0& # 0/p! $ 0P!ow^\ .T.N{.._. PQ  K_  oȽvw?M  vwHQ  K_  ? \owы(\ @a@T {.b _h% \lw(Q ez~ppvxwvnlmnvv }{{~~{e_ Z % oȽvw?N& vwHQ  K_  @&oȾvwJ?41! wPQ  K_  &!oȞ́@\  T!@{.$@k Y ́ @Q  K_  %1# p8  $ n8 ʲ#  G0 ʲ $  `40 "roz~~y}ighggh}z|rt}zHҒ  S q 0iX0iXt*mK  O  IWWVJq| O 6zus~li? rK&ЕN 2 1?tgbC2 'Nރts}ki? Ҟ Uii8zaBPf_)}cTC`DQkՋ6W 5԰`jjϱС齟# 6fR ɱϱМ齙$ 6M8é̲# 9>$̲́ $ RP$ޛ 20$T v5 3 0U 2!" v53 "(528G v53 85A ޛ 20%&v5 3 0&v\ <PzzM<|qL}~|z}$z9h;-r9z}}ku0T}9\^s9}$Sw剑9Yasƺw^LvJЎ<ЎJ@{p jjxxuuw堣ihxohiuxsj ?hsr<shwwZww<ruޛ x. 0T  w1 0 T x. !"  w1 /'5 . 4G Џ1 4 i6h. Tn%  i5h1 D% xxy Q1M|#Ye5x{|w rb{xP dw{{huޛ x. 0& w1 0 &u x. 0 q!  w1 8P!ux. H?$ w1 XP$uޛ ;0o  E0# ;0/6 E?9u;(v!wSu9brtB}|{s~ubͩ K 6OEpr|y{~@R;:]RZt`~~y[[   vw C vQwyz0zxnzv+zywpy{ty1ynn}tuwm_ymrzwrtp\*% _)w vwps@( Ҁ) u @@ o Kx Zlvw   ihsyRd2 ~ P]humja?   !gwЋۇ@;!% 9Qsvvtzouu`k!Ԁ u5}jVʐ 8Ih` 5X~|}z{{nf !^[Zq&z mvi|kgf}zy~}zP)k@ /1 kPz}uw<BP^ ĭvw C Hh!ZJXH! ;h JKg ޛ xR } q| O } O oszhe?  >z K w* Ga}oQG}oQpszhe? f vNFU 8^njmyus`nx\g}|~شޛ FU 0sS ޛ Щ> 0S vlab}ajܶ{y|ԔX^[{bC(YweE{{|;O^xX+kZ k ha;.o2 lfJ?ؒ)X_Z3EbvwvAH?^!_RI 7gxy{{t l 0m^ v 0t qIyr<dgwiCcd9:}G~}Vq{xs9qVI8"D S Tn7T7Jvww6< owqԄrvtD=EzD xuHrur}}}-[lon7n787Jvwwm? ǶwrPu|yu~}~#mfvwm?`yttzztLJKsf hԢ8ZD54DE44Dt@OOA@OOA^HreQ3Ѥ}vX{}xmtѢw|dvEq,~BGy_O|vpqw}Ţӣ{_zqEo83:?N3w|g\zovʌw 6 q v9[`DyS{|wJ|{omq{}~~wipo{ztw|nuy{{-Mvݶ<# :F MvȲ <$ SF  .Ke1 _5 G19@ aς u 6=Z$ zBr DB11hx0 0xcc00FMDUSqv23rɋϖƘ֮T\@N adz+ +ykedj,+dFA}z }B3 {4 o{Н{n@HS}Wʀc@@H %gG uonES}Wc@H O|{ omq{}~~wipo{ztw|nuy {{!- 9 W$% Yȋpplw~SCw^ta yq}w|}~N$&2g~IxyZCUg OOKˮH5ɮlKq]hIyurxveGsu{tURof_TJ^m򀗆xxtzpqwvmH>Qw}dvxʚHcdt||tu IGT>pphqnox<xwcy|s|zЩ> n} k{I  = MPHMM ٌ Brr}9Dk| dfVwO}s.xw{~tolufsqkz~-rxrhvNțw@tW @xu wDW  SZ tNDlnrwb=ʫ"H },px㋓{DZep_tz|uovxMŸN%bdyljo:kTwC:NZTY|a\)'Lpntozn=J (nlbcOPPO}`cb^LMML^`}ǙF^^nimqbccbqnmi^^lEF aQUgy`c ;Yx/.Qvu # 1 5 U Y ]  & @   & K q v +  ,c  H[_h{7;>~%@FM`tx/?FNY_ckp #+26;JPcny  &*?DHNU[`s  %19>CHLQ`n| $*06AEPYdjot x ypjhx|qL wg6#gwU=X㊃ɘȍt@ ypw de~s ԓ lG]nx-!}   `g~Ujh   O  IWWVJq| O /r N 2 1?tgbC2  L & uoouuoou }>|u~|~}u~E~V}>|u~|~}u~E~ihvwFub{ih{b_ H i O }m{rLO I stmfzoʋt}Ͱȴ? EP}rP MrjovuaJmkm{ʣͱ2Z^Q0Cj  Z\V:?'-ٮtz mvi|hca $IL ĵuw< l:gbp=:ae -lu mszmbU^@<6HIspw4W`PE}~u}|~V~u|~>E}~u}|~~i jiZ qJO mzr {Q WeVN?CڷqO}{}  x<stn):sb05*)]:z{ my~rj]XJ uepzvtzzfW^NAekld,CC,edՋ֋Njy hvMMvppM ZN }oQx~m|~qn~brwvtxzq6Í d\îw}vxy{s tbqoZ/Xd^khsy: %9%L pplw~SCw^+BwG z^L$ kxybV )"i   stmfzoʋt}Ͱȴ? EP}rP MrjovuaJmkm{ʣͱ2Z^Q0Cj II9xϋ΋wz%W%VC J @@ ihsy@2 ~b @@ $ $% $% %$ %e&&&& o}:7 ml ^xd-zê/g[g<D$  s m eqyvt||Mz~~{ xs|tts|xV ( >!vadwY^^Zwuы롱e r I O .69x[nxrtu|kL\4 VxȃV9PW  nmn~TPa- m~ni)rku"}iffi"@0 |Vq;v\]$'W@x=rs{ x! |{omq{}~~wipo{ztw|nuy{{-rw~wxr Yw YE Zroop}Fu _ V}p 2snz.bwJ|VW::LNl@9${x\_U| emwsrxz7 vw` |qp݋ z~^`ml{ w <   C oGX ud m i F Jv٭ wƊa3Gy~v|zz\i~Hwur3SywhxkHr9KeK2KKz2,\жxд[ ihsyV2 @~@m i FF  lx[дsojiN -hirzL ~BihsyZj@I  } hhh mkerllfq  t!t q|D&>&|# O  uu{s stVVtu _  hvMMvp_'uslk? ;FMDUSqv23rɋϖƘ֮T\@N |[v;[:ˡNv}}p{rLt1bkI*$^MjZdP4vB^|np|`sxh}7f6f}xs`|pQndnd P  i D I~y~t ihtx }o m drqg\`Wʱu{tvwyq aqxHHwur^g ts~ki? 8jFA}z }B3 {4 u x W  Lt@At O }m{rLO  q|mLFV`F+!FVM  ,&8 2=(+gvyqrwzmkDZ=TUR8:VӶtw j  Ϡp T?vlmw[bc[w 4%9% tzk  N @ڻgg Y !w wЎ P7P7kNznP dSwЩ@!ihuwp kU3WWzb^!yswg* ^B   r ȋc Kz}s!F>fwmڹ q} :    ]|xaq}~g]{ f}}fhh fv 2" wsswwssw |w~   {x[dzzzu _xpxp_  vw  W  %W% z~qisz{{wxg P  ALip}j-B  aП 1 " u 3  y45*b{rLO q|  |qM  m i Ëؕ˜zJXGU "#hhh#"hhh" J }r  _ g o  ^  U{{{ \ h{rLO  {h }zz}}z {x  :?9+K<<-I {} {oz [ g ` n u ~ttuirbo~v Gz s|ln|  sr  P[ sL _xoxmb  vӛ  `М o}  fYYfPAAP  O cnt vwv;;wd FmF  д[ zqM    8xg } 5l x{   Н  l ߛ  v  ~wj ~~{ z~ }z KNɹw U  zr v  K kI9TzaoQ ϱk Єv[ v j vJwh ЧZ f u \ h  U ˼wP H w I   n| v[w    !  r  & ,; 8  ,  7 J  0  $ 8 >    + X  &  F X D ,  - :  9 9  ) ( /    ' :  1 , &   3 4  & ,  8  + 8 O u G P  ,  7 8  #  0 5 # 8 > i  1  X #  & 8 > >    + 4 ;  , 5 :   ! , 4   8      *  " 0 6 2  &  &  &  &  &  &  &  &  &  &  &  &  &  &   &  &  &  !  !  &  &   & &  K  &  &  & ;   ; E  &   - WJJJJ  h ( / re ( / ( / ( / ( /  /   re (  \ B B  N {  '  '  ' u " & z : & 0   %  u P  1  1  1  1  1  1  1  1  1  1  1  1  1  1  1   1 8 8  +  1   1    (  1 1 >  3 F@ & ,  & , & , & , & , & ,; / .    +  +      + \O O u O W O r O r O [ O u O u O O u O u O u J J ' 0 O u O O X P G P   ,  *   7  7  7  7  =  &   J==   # " &   \(  0    0  0  0  0  0   8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 >  $  8 >  8 > 8 ? 8 ? 8 ? 8 ? 8 ? 8 ; 8 > 8 >  8    8 > h j { 8 > 8 > 8 > 0  -  (  & &  >  |        +   +  +  +  +  +  +  \    f f 4 ; 4 ; 4 ; 1 4 ; 4 ; 4 ; $ 8 (    !  !  ! !  ! 8  1   XKK  !                                          9 9 ,   &              !  "  "  "  "   "  "  " 0 6 0 6 0 6 0 6 0  W W W W WJ W W W W W WJ W W te t t te t t t t X X  [ [N x x  t tz x      \O J J   J=    X XK   &   A L  Wo1>t&q8OuGGP98>>Ki[XOu8>!//P,45i,5,/(2 FDFLTcyrl*latn@"* #+"AZE 4CRT FMOL XROM lTRK  $, %- &.  '/!(0)12aalt.aalt6aalt>aaltFaaltNaaltVaalt^aaltfdligndligtdligzdligdligdligdligdligfracfracfracfracfracfracfracfraclnumlnumlnumlnumlnumlnumlnumlnumloclloclonum onumonumonumonum"onum(onum.onum4zero:zero@zeroFzeroLzeroRzeroXzero^zerod"*2:BJ @06x 4 "f9fk)9)k$f9$)9      0389NRdejky  '<' <    0389NRdejk y  Rj 0389NRdejky     5\y0389NRdejk      y DFLTcyrl latn,"AZE *CRT 2MOL :ROM BTRK Jsize2size6size:size>sizeBsizeFsizeJsizeN" d2PK!>!+!+mdc/resources/neurips.sty% partial rewrite of the LaTeX2e package for submissions to the % Conference on Neural Information Processing Systems (NeurIPS): % % - uses more LaTeX conventions % - line numbers at submission time replaced with aligned numbers from % lineno package % - \nipsfinalcopy replaced with [final] package option % - automatically loads times package for authors % - loads natbib automatically; this can be suppressed with the % [nonatbib] package option % - adds foot line to first page identifying the conference % - adds preprint option for submission to e.g. arXiv % - conference acronym modified % % Roman Garnett (garnett@wustl.edu) and the many authors of % nips15submit_e.sty, including MK and drstrip@sandia % % last revision: March 2019 \NeedsTeXFormat{LaTeX2e} \ProvidesPackage{neurips_2019}[2019/03/13 NeurIPS 2019 submission/camera-ready style file] % declare final option, which creates camera-ready copy \newif\if@neuripsfinal\@neuripsfinalfalse \DeclareOption{final}{ \@neuripsfinaltrue } % declare nonatbib option, which does not load natbib in case of % package clash (users can pass options to natbib via % \PassOptionsToPackage) \newif\if@natbib\@natbibtrue \DeclareOption{nonatbib}{ \@natbibfalse } % declare preprint option, which creates a preprint version ready for % upload to, e.g., arXiv \newif\if@preprint\@preprintfalse \DeclareOption{preprint}{ \@preprinttrue } \ProcessOptions\relax % determine whether this is an anonymized submission \newif\if@submission\@submissiontrue \if@neuripsfinal\@submissionfalse\fi \if@preprint\@submissionfalse\fi % fonts \renewcommand{\rmdefault}{ptm} \renewcommand{\sfdefault}{phv} % change this every year for notice string at bottom \newcommand{\@neuripsordinal}{33rd} \newcommand{\@neuripsyear}{2019} \newcommand{\@neuripslocation}{Vancouver, Canada} % handle tweaks for camera-ready copy vs. submission copy \if@preprint \newcommand{\@noticestring}{% Preprint. Under review.% } \else \if@neuripsfinal \newcommand{\@noticestring}{% \@neuripsordinal\/ Conference on Neural Information Processing Systems (NeurIPS \@neuripsyear), \@neuripslocation.% } \else \newcommand{\@noticestring}{% Submitted to \@neuripsordinal\/ Conference on Neural Information Processing Systems (NeurIPS \@neuripsyear). Do not distribute.% } % line numbers for submission \RequirePackage{lineno} \linenumbers % fix incompatibilities between lineno and amsmath, if required, by % transparently wrapping linenomath environments around amsmath % environments \AtBeginDocument{% \@ifpackageloaded{amsmath}{% \newcommand*\patchAmsMathEnvironmentForLineno[1]{% \expandafter\let\csname old#1\expandafter\endcsname\csname #1\endcsname \expandafter\let\csname oldend#1\expandafter\endcsname\csname end#1\endcsname \renewenvironment{#1}% {\linenomath\csname old#1\endcsname}% {\csname oldend#1\endcsname\endlinenomath}% }% \newcommand*\patchBothAmsMathEnvironmentsForLineno[1]{% \patchAmsMathEnvironmentForLineno{#1}% \patchAmsMathEnvironmentForLineno{#1*}% }% \patchBothAmsMathEnvironmentsForLineno{equation}% \patchBothAmsMathEnvironmentsForLineno{align}% \patchBothAmsMathEnvironmentsForLineno{flalign}% \patchBothAmsMathEnvironmentsForLineno{alignat}% \patchBothAmsMathEnvironmentsForLineno{gather}% \patchBothAmsMathEnvironmentsForLineno{multline}% }{} } \fi \fi % load natbib unless told otherwise \if@natbib \RequirePackage{natbib} \fi % set page geometry \usepackage[verbose=true,letterpaper]{geometry} \AtBeginDocument{ \newgeometry{ textheight=9in, textwidth=5.5in, top=1in, headheight=12pt, headsep=25pt, footskip=30pt } \@ifpackageloaded{fullpage} {\PackageWarning{neurips_2019}{fullpage package not allowed! Overwriting formatting.}} {} } \widowpenalty=10000 \clubpenalty=10000 \flushbottom \sloppy % font sizes with reduced leading \renewcommand{\normalsize}{% \@setfontsize\normalsize\@xpt\@xipt \abovedisplayskip 7\p@ \@plus 2\p@ \@minus 5\p@ \abovedisplayshortskip \z@ \@plus 3\p@ \belowdisplayskip \abovedisplayskip \belowdisplayshortskip 4\p@ \@plus 3\p@ \@minus 3\p@ } \normalsize \renewcommand{\small}{% \@setfontsize\small\@ixpt\@xpt \abovedisplayskip 6\p@ \@plus 1.5\p@ \@minus 4\p@ \abovedisplayshortskip \z@ \@plus 2\p@ \belowdisplayskip \abovedisplayskip \belowdisplayshortskip 3\p@ \@plus 2\p@ \@minus 2\p@ } \renewcommand{\footnotesize}{\@setfontsize\footnotesize\@ixpt\@xpt} \renewcommand{\scriptsize}{\@setfontsize\scriptsize\@viipt\@viiipt} \renewcommand{\tiny}{\@setfontsize\tiny\@vipt\@viipt} \renewcommand{\large}{\@setfontsize\large\@xiipt{14}} \renewcommand{\Large}{\@setfontsize\Large\@xivpt{16}} \renewcommand{\LARGE}{\@setfontsize\LARGE\@xviipt{20}} \renewcommand{\huge}{\@setfontsize\huge\@xxpt{23}} \renewcommand{\Huge}{\@setfontsize\Huge\@xxvpt{28}} % sections with less space \providecommand{\section}{} \renewcommand{\section}{% \@startsection{section}{1}{\z@}% {-2.0ex \@plus -0.5ex \@minus -0.2ex}% { 1.5ex \@plus 0.3ex \@minus 0.2ex}% {\large\bf\raggedright}% } \providecommand{\subsection}{} \renewcommand{\subsection}{% \@startsection{subsection}{2}{\z@}% {-1.8ex \@plus -0.5ex \@minus -0.2ex}% { 0.8ex \@plus 0.2ex}% {\normalsize\bf\raggedright}% } \providecommand{\subsubsection}{} \renewcommand{\subsubsection}{% \@startsection{subsubsection}{3}{\z@}% {-1.5ex \@plus -0.5ex \@minus -0.2ex}% { 0.5ex \@plus 0.2ex}% {\normalsize\bf\raggedright}% } \providecommand{\paragraph}{} \renewcommand{\paragraph}{% \@startsection{paragraph}{4}{\z@}% {1.5ex \@plus 0.5ex \@minus 0.2ex}% {-1em}% {\normalsize\bf}% } \providecommand{\subparagraph}{} \renewcommand{\subparagraph}{% \@startsection{subparagraph}{5}{\z@}% {1.5ex \@plus 0.5ex \@minus 0.2ex}% {-1em}% {\normalsize\bf}% } \providecommand{\subsubsubsection}{} \renewcommand{\subsubsubsection}{% \vskip5pt{\noindent\normalsize\rm\raggedright}% } % float placement \renewcommand{\topfraction }{0.85} \renewcommand{\bottomfraction }{0.4} \renewcommand{\textfraction }{0.1} \renewcommand{\floatpagefraction}{0.7} \newlength{\@neuripsabovecaptionskip}\setlength{\@neuripsabovecaptionskip}{7\p@} \newlength{\@neuripsbelowcaptionskip}\setlength{\@neuripsbelowcaptionskip}{\z@} \setlength{\abovecaptionskip}{\@neuripsabovecaptionskip} \setlength{\belowcaptionskip}{\@neuripsbelowcaptionskip} % swap above/belowcaptionskip lengths for tables \renewenvironment{table} {\setlength{\abovecaptionskip}{\@neuripsbelowcaptionskip}% \setlength{\belowcaptionskip}{\@neuripsabovecaptionskip}% \@float{table}} {\end@float} % footnote formatting \setlength{\footnotesep }{6.65\p@} \setlength{\skip\footins}{9\p@ \@plus 4\p@ \@minus 2\p@} \renewcommand{\footnoterule}{\kern-3\p@ \hrule width 12pc \kern 2.6\p@} \setcounter{footnote}{0} % paragraph formatting \setlength{\parindent}{\z@} \setlength{\parskip }{5.5\p@} % list formatting \setlength{\topsep }{4\p@ \@plus 1\p@ \@minus 2\p@} \setlength{\partopsep }{1\p@ \@plus 0.5\p@ \@minus 0.5\p@} \setlength{\itemsep }{2\p@ \@plus 1\p@ \@minus 0.5\p@} \setlength{\parsep }{2\p@ \@plus 1\p@ \@minus 0.5\p@} \setlength{\leftmargin }{3pc} \setlength{\leftmargini }{\leftmargin} \setlength{\leftmarginii }{2em} \setlength{\leftmarginiii}{1.5em} \setlength{\leftmarginiv }{1.0em} \setlength{\leftmarginv }{0.5em} \def\@listi {\leftmargin\leftmargini} \def\@listii {\leftmargin\leftmarginii \labelwidth\leftmarginii \advance\labelwidth-\labelsep \topsep 2\p@ \@plus 1\p@ \@minus 0.5\p@ \parsep 1\p@ \@plus 0.5\p@ \@minus 0.5\p@ \itemsep \parsep} \def\@listiii{\leftmargin\leftmarginiii \labelwidth\leftmarginiii \advance\labelwidth-\labelsep \topsep 1\p@ \@plus 0.5\p@ \@minus 0.5\p@ \parsep \z@ \partopsep 0.5\p@ \@plus 0\p@ \@minus 0.5\p@ \itemsep \topsep} \def\@listiv {\leftmargin\leftmarginiv \labelwidth\leftmarginiv \advance\labelwidth-\labelsep} \def\@listv {\leftmargin\leftmarginv \labelwidth\leftmarginv \advance\labelwidth-\labelsep} \def\@listvi {\leftmargin\leftmarginvi \labelwidth\leftmarginvi \advance\labelwidth-\labelsep} % create title \providecommand{\maketitle}{} \renewcommand{\maketitle}{% \par \begingroup \renewcommand{\thefootnote}{\fnsymbol{footnote}} % for perfect author name centering \renewcommand{\@makefnmark}{\hbox to \z@{$^{\@thefnmark}$\hss}} % The footnote-mark was overlapping the footnote-text, % added the following to fix this problem (MK) \long\def\@makefntext##1{% \parindent 1em\noindent \hbox to 1.8em{\hss $\m@th ^{\@thefnmark}$}##1 } \thispagestyle{empty} \@maketitle \@thanks \@notice \endgroup \let\maketitle\relax \let\thanks\relax } % rules for title box at top of first page \newcommand{\@toptitlebar}{ \hrule height 4\p@ \vskip 0.25in \vskip -\parskip% } \newcommand{\@bottomtitlebar}{ \vskip 0.29in \vskip -\parskip \hrule height 1\p@ \vskip 0.09in% } % create title (includes both anonymized and non-anonymized versions) \providecommand{\@maketitle}{} \renewcommand{\@maketitle}{% \vbox{% \hsize\textwidth \linewidth\hsize \vskip 0.1in \@toptitlebar \centering {\LARGE\bf \@title\par} \@bottomtitlebar \if@submission \begin{tabular}[t]{c}\bf\rule{\z@}{24\p@} Anonymous Author(s) \\ Affiliation \\ Address \\ \texttt{email} \\ \end{tabular}% \else \def\And{% \end{tabular}\hfil\linebreak[0]\hfil% \begin{tabular}[t]{c}\bf\rule{\z@}{24\p@}\ignorespaces% } \def\AND{% \end{tabular}\hfil\linebreak[4]\hfil% \begin{tabular}[t]{c}\bf\rule{\z@}{24\p@}\ignorespaces% } \begin{tabular}[t]{c}\bf\rule{\z@}{24\p@}\@author\end{tabular}% \fi \vskip 0.3in \@minus 0.1in } } % add conference notice to bottom of first page \newcommand{\ftype@noticebox}{8} \newcommand{\@notice}{% % give a bit of extra room back to authors on first page \enlargethispage{2\baselineskip}% \@float{noticebox}[b]% \footnotesize\@noticestring% \end@float% } % abstract styling \renewenvironment{abstract}% {% \vskip 0.075in% \centerline% {\large\bf Abstract}% \vspace{0.5ex}% \begin{quote}% } { \par% \end{quote}% \vskip 1ex% } \endinput PK!mdc/templates/__init__.pyPK! r r mdc/templates/iclr.tex\documentclass{article} \usepackage{$if(local)$iclr$else$resources/iclr$endif$,times} \usepackage[utf8]{inputenc} \usepackage[T1]{fontenc} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{url} \usepackage{graphicx} \usepackage{subcaption} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} % Pandoc mods \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} \makesavenoteenv{longtable} \let\oldincgfx\includegraphics \renewcommand{\includegraphics}[1]{\makebox[\textwidth][c]{\oldincgfx{#1}}} % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 % Put year in citet \newcommand*{\nolink}[1]{{\protect\NoHyper#1\protect\endNoHyper}} \renewcommand{\citet}[1]{\nolink{\citeauthor{#1} (\citeyear{#1})}\citep{#1}} % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} $for(include-before)$$include-before$$endfor$ \title{$title$} \author{% $for(author)$% $author.name$$if(author.equalcontrib)$$if(skipequal)$$else$$$^\ast$$$endif$$endif$\\ $author.affiliation.name$\\ \texttt{$author.email$} $sep$\And$endfor$% } \newcommand{\fix}{\marginpar{FIX}} \newcommand{\new}{\marginpar{NEW}} $if(submission)$$else$\iclrfinalcopy$endif$ \begin{document} \maketitle $if(skipequal)$$else$\blfootnote{\textsuperscript{\ast}Equal contribution.}$endif$ \begin{abstract} $abstract$ \end{abstract} $body$ \bibliography{$bibliography$} \bibliographystyle{$if(local)$iclr$else$resources/iclr$endif$} $if(appendix)$ \appendix \section{Appendix} \input{$appendix$} $endif$ \end{document} PK!|+  mdc/templates/icml.tex\RequirePackage{luatex85} \documentclass{article} \usepackage[T1]{fontenc} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{graphicx} \usepackage{subcaption} \usepackage{dblfloatfix} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} \usepackage$if(submission)$$else$[accepted]$endif${$if(local)$icml$else$resources/icml$endif$} % Pandoc mods \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} \makesavenoteenv{longtable} \let\oldincgfx\includegraphics \renewcommand{\includegraphics}[1]{\makebox[\textwidth][c]{\oldincgfx{#1}}} \renewenvironment{figure}{\begin{figure*}}{\end{figure*}}{} % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 $for(include-before)$$include-before$$endfor$ \icmltitlerunning{$if(running-title)$$running-title$$else$$title$$endif$} \begin{document} \parindent=2em \setnowidow[2] \twocolumn[ \icmltitle{$title$} \icmlsetsymbol{equal}{*} \begin{icmlauthorlist} $for(author)$ \icmlauthor{$author.name$}{$if(author.equalcontrib)$equal,$endif$$author.affiliation.id$} $endfor$ \end{icmlauthorlist} $for(institute)$ \icmlaffiliation{$institute.id$}{$institute.name$} $endfor$ $for(author)$ $if(author.corresponding)$ \icmlcorrespondingauthor{$author.name$}{$author.email$} $endif$ $endfor$ $if(keyword)$ \icmlkeywords{$for(keyword)$$keyword$$sep$, $endfor$} $endif$ \vskip 0.3in ] $if(skipequal)$\printAffiliationsAndNotice{}$else$\printAffiliationsAndNotice{\icmlEqualContribution}$endif$ \begin{abstract} $abstract$ \end{abstract} $body$ \bibliography{$bibliography$} \bibliographystyle{$if(local)$icml$else$resources/icml$endif$} \end{document} PK!e*WX X mdc/templates/neurips.tex\documentclass{article} \PassOptionsToPackage{square,numbers,sort&compress}{natbib} \usepackage$if(submission)$$else$[final]$endif${$if(local)$neurips$else$resources/neurips$endif$} \usepackage[utf8]{inputenc} \usepackage[T1]{fontenc} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{url} \usepackage{graphicx} \usepackage{subcaption} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} % Pandoc mods \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} \makesavenoteenv{longtable} \let\oldincgfx\includegraphics \renewcommand{\includegraphics}[1]{\makebox[\textwidth][c]{\oldincgfx{#1}}} % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 % Put year in citet \newcommand*{\nolink}[1]{{\protect\NoHyper#1\protect\endNoHyper}} \renewcommand{\citet}[1]{\nolink{\citeauthor{#1} (\citeyear{#1})}\citep{#1}} % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} $for(include-before)$$include-before$$endfor$ \title{$title$} \author{% $for(author)$% $author.name$$if(author.equalcontrib)$$if(skipequal)$$else$$$^\ast$$$endif$$endif$\\ $author.affiliation.name$\\ \texttt{$author.email$}\\ $sep$\And$endfor$% } \begin{document} \maketitle $if(skipequal)$$else$\blfootnote{\textsuperscript{\ast}Equal contribution.}$endif$ \begin{abstract} $abstract$ \end{abstract} $body$ \small \bibliographystyle{unsrtnat} \bibliography{$bibliography$} \end{document} PK! mdc/templates/note.tex\documentclass[letterpaper]{article} \usepackage[T1]{fontenc} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{cfr-lm} \usepackage{nowidow} \usepackage{parskip} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage[square,numbers,sort&compress]{natbib} \usepackage{graphicx} \usepackage{subcaption} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} % Pandoc mods \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} \makesavenoteenv{longtable} \let\oldincgfx\includegraphics \renewcommand{\includegraphics}[1]{\makebox[\textwidth][c]{\oldincgfx{#1}}} % Put year in citet \newcommand*{\nolink}[1]{{\protect\NoHyper#1\protect\endNoHyper}} \renewcommand{\citet}[1]{\nolink{\citeauthor{#1} (\citeyear{#1})}\citep{#1}} % Disable page numbers \pagenumbering{gobble} % Configure acronyms \renewcommand*{\acsfont}[1]{{\addfontfeature{LetterSpace=10.0}\scshape\textsmaller{#1}}} $for(include-before)$$include-before$$endfor$ \title{$title$} \author{$for(author)$$author.name$$sep$\quad $endfor$} \date{} \begin{document} \maketitle \setnowidow[2] $body$ $if(bibliography)$ \bibliographystyle{unsrtnat} \bibliography{$bibliography$} $endif$ \end{document} PK!mdc/templates/simple.tex\documentclass[letterpaper,12pt]{article} \usepackage[textwidth=360pt,textheight=600pt]{geometry} \usepackage[T1]{fontenc} \usepackage[no-math]{fontspec} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{cfr-lm} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{fancyhdr} \usepackage[absolute]{textpos} \usepackage[square,numbers,super,sort&compress]{natbib} \usepackage{graphicx} \usepackage{subcaption} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} % Pandoc mods \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} \makesavenoteenv{longtable} \let\oldincgfx\includegraphics \renewcommand{\includegraphics}[1]{\makebox[\textwidth][c]{\oldincgfx{#1}}} % Configure float placement \setcounter{topnumber}{2} \setcounter{bottomnumber}{1} \setcounter{totalnumber}{2} \renewcommand{\textfraction}{0.10} \renewcommand{\topfraction}{0.85} \renewcommand{\bottomfraction}{0.85} \renewcommand{\floatpagefraction}{0.80} \makeatletter \setlength{\@fptop}{0pt} \setlength{\@fpsep}{12pt} \setlength{\@fpbot}{0pt plus 1.0fil} \def\fps@figure{htbp} \def\fps@table{htbp} \makeatother % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 % Put year in citet \newcommand*{\nolink}[1]{{\protect\NoHyper#1\protect\endNoHyper}} \renewcommand{\citet}[1]{\nolink{\citeauthor{#1} (\citeyear{#1})}\citep{#1}} % Set fonts \setmainfont{ebgaramond12}[ Path=resources/, Extension=.otf, UprightFont=*-regular, ItalicFont=*-italic, SmallCapsFont=ebgaramondcaps12-regular, ] \setmonofont{lmmono10}[ Path=resources/, Extension=.otf, UprightFont=*-regular, ItalicFont=*-italic, SmallCapsFont=lmmonocaps10-regular, ] \renewcommand*{\acsfont}[1]{{\addfontfeature{LetterSpace=10.0}\scshape\textsmaller{#1}}} % Configure page no. \pagestyle{fancy} \fancyhf{} \renewcommand{\headrulewidth}{0pt} \fancyfoot[R]{{\scriptsize\thepage}} $for(include-before)$$include-before$$endfor$ \title{% \begin{minipage}{\textwidth}% \begin{flushleft}% {\normalfont\Huge $title$}% \end{flushleft}% \end{minipage}% } \author{% \begin{minipage}{\textwidth}% \begin{flushleft}% {% \normalfont\large\scshape% $for(author)$$author.name$\textsuperscript{$author.affiliation.id$$if(author.equalcontrib)$$if(skipequal)$$else$,*$endif$$endif$}$sep$\quad $endfor$% }% \end{flushleft}% \end{minipage}% } \date{} \begin{document} \maketitle \thispagestyle{fancy} \parindent=3em \setnowidow[2] % Add author-info footnote. \newlength{\lmargin} \setlength{\lmargin}{\dimexpr(\paperwidth-\textwidth)/2\relax} \textblockorigin{\lmargin}{\paperheight} \setlength{\TPHorizModule}{1pt} \setlength{\TPVertModule}{1in} \begin{textblock}{360}(0,-1) \parindent=0pt \normalfont\scriptsize\raggedright \hrule \hrule \vspace{1.5ex} $if(skipequal)$$else$\textsuperscript{*}Equal contribution.$endif$ $for(institute)$\textsuperscript{$institute.id$}$institute.name$.$endfor$ Email:~$for(author)$\texttt{$author.email$}$sep$, $endfor$. \end{textblock} $if(abstract)$ \section*{Abstract} $abstract$ $endif$ $body$ $if(bibliography)$ \footnotesize \bibliographystyle{unsrtnat} \bibliography{$bibliography$} $endif$ \end{document} PK!|mdc/templates/standalone.tex\documentclass[preview,varwidth=100in]{standalone} \usepackage[T1]{fontenc} \usepackage[no-math]{fontspec} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{cfr-lm} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{graphicx} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{mathtools} \usepackage{amssymb} \usepackage{mleftright} \usepackage{bm} \usepackage{algpseudocode} \usepackage{subcaption} \usepackage{pgf} % Pandoc mods \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} \makesavenoteenv{longtable} % Configure acronyms \renewcommand*{\acsfont}[1]{{\addfontfeature{LetterSpace=10.0}\scshape\textsmaller{#1}}} % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 $for(include-before)$$include-before$$endfor$ \begin{document} $body$ \end{document} PK!Cmdc/templates/stylish.tex\documentclass[letterpaper,twocolumn,10pt]{article} \usepackage[textwidth=492pt,textheight=600pt,columnsep=12pt]{geometry} \usepackage[T1]{fontenc} \usepackage[no-math]{fontspec} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{cfr-lm} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{fancyhdr} \usepackage{sectsty} \usepackage[square,numbers,super,sort&compress]{natbib} \usepackage{graphicx} \usepackage{subcaption} \usepackage{dblfloatfix} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} % Pandoc mods \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} \makesavenoteenv{longtable} \let\oldincgfx\includegraphics \renewcommand{\includegraphics}[1]{\makebox[\textwidth][c]{\oldincgfx{#1}}} \renewenvironment{figure}{\begin{figure*}}{\end{figure*}}{} % Configure float placement \setcounter{topnumber}{2} \setcounter{bottomnumber}{1} \setcounter{totalnumber}{2} \renewcommand{\textfraction}{0.10} \renewcommand{\topfraction}{0.85} \renewcommand{\bottomfraction}{0.85} \renewcommand{\floatpagefraction}{0.80} \makeatletter \setlength{\@fptop}{0pt} \setlength{\@fpsep}{12pt} \setlength{\@fpbot}{0pt plus 1.0fil} \def\fps@figure{htbp} \def\fps@table{htbp} \makeatother % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 % Put year in citet \newcommand*{\nolink}[1]{{\protect\NoHyper#1\protect\endNoHyper}} \renewcommand{\citet}[1]{\nolink{\citeauthor{#1} (\citeyear{#1})}\citep{#1}} % Set fonts \setmainfont{ebgaramond12}[ Path=resources/, Extension=.otf, UprightFont=*-regular, ItalicFont=*-italic, SmallCapsFont=ebgaramondcaps12-regular, ] \setsansfont{futurabook}[ Path=resources/, Extension=.ttf, UprightFont=*-regular, ItalicFont=*-italic, BoldFont=futuramedium-regular, ] \setmonofont{lmmono10}[ Path=resources/, Extension=.otf, UprightFont=*-regular, ItalicFont=*-italic, SmallCapsFont=lmmonocaps10-regular, ] \renewcommand*{\acsfont}[1]{{\addfontfeature{LetterSpace=10.0}\scshape\textsmaller{#1}}} \sectionfont{\normalfont\sffamily\bfseries\Large\raggedright} \subsectionfont{\normalfont\sffamily\large\raggedright} \subsubsectionfont{\normalfont\sffamily\normalsize\raggedright\MakeUppercase} % Configure (sub(sub))section numbers \renewcommand*{\thesection}{\arabic{section}.} \renewcommand*{\thesubsection}{\arabic{section}.\arabic{subsection}} \renewcommand*{\thesubsubsection}{\arabic{section}.\arabic{subsection}.\arabic{subsubsection}} % Configure page no. \pagestyle{fancy} \fancyhf{} \renewcommand{\headrulewidth}{0pt} \fancyfoot[R]{{\normalfont\sffamily\scriptsize\thepage}} % Footnote without marker \newcommand\blfootnote[1]{% \begingroup \renewcommand\thefootnote{}\footnote{\raggedright \hspace{-20pt} #1}% \addtocounter{footnote}{-1}% \endgroup } $for(include-before)$$include-before$$endfor$ \title{% \begin{minipage}{\textwidth}% \begin{flushleft}% {\normalfont\sffamily\bfseries\Huge $title$}% \end{flushleft}% \end{minipage}% } \author{% \begin{minipage}{\textwidth}% \begin{flushleft}% {% \normalfont\sffamily\Large% $for(author)$$author.name$\textsuperscript{$author.affiliation.id$$if(author.equalcontrib)$$if(skipequal)$$else$,*$endif$$endif$}$sep$\quad $endfor$% }% \end{flushleft}% \end{minipage}% } \date{} \begin{document} \maketitle \fussy \pretolerance 400 \emergencystretch 2em \thispagestyle{fancy} \parindent=2em \setnowidow[2] % Add author-info footnote. \blfootnote{% {% \normalfont\sffamily\scriptsize\raggedright $if(skipequal)$$else$\textsuperscript{*}Equal contribution.$endif$% $for(institute)$\mbox{\textsuperscript{$institute.id$}$institute.name$.}\enspace$endfor$% Email:~$for(author)$\mbox{\texttt{$author.email$}}$sep$, $endfor$.% }% } $if(abstract)$ \hrule height 1pt \vspace{0.5em} {\parindent=0pt \normalfont\sffamily\small $abstract$} \vspace{0.5em} \hrule height 1pt $endif$ $body$ $if(bibliography)$ \footnotesize \bibliographystyle{humannat} \bibliography{$bibliography$} $endif$ \end{document} PK!H3I88#$)shinymdc-1.2.1.dist-info/entry_points.txtN+I/N.,()MIb= MPK!Hu)GTUshinymdc-1.2.1.dist-info/WHEEL HM K-*ϳR03rOK-J,/R(O-)$qzd&Y)r$UV&UrPK!HT !shinymdc-1.2.1.dist-info/METADATAn0#qI(Tɢ=po' y{;gg{TH0&흄wxT%N6(sv;X(aP{Ah|K9C ] A 0"{uD!ɪj5uWy%V;Q—xh6,́,6cS<2psY^/_oŭQ)FV,:-)H WP'm޻޽zrC՘{>|ߛ !DbkzVcFe`\;S͸QQԃl01ۨKOb烮sbOhҘbYK`Iī[TG 2.~PK!H5Go/x shinymdc-1.2.1.dist-info/RECORDɒZ}? T3@ 2FETmU];ɟ&-@+4!FRhuCl& \nh(2v:+ aد<'+9vhcIGem1JC2vpIJ"hA4m!r¤'XUCZϏt.pQ .@X56y&hET5{_ ޼ X#$px>`R5붾Ԝ)#٢r- 36r™׃"rQ rpbo&·[X ^w '+cؚbTFIzK=E#P O3ŦdB9;hZyOD:c C~Ipg\ًnˢ߃(U ĵYRV( aunC*GݑŚH^[0hc09N]=d/Zc, }͜ODy#-|ΕG>mBJfD`hט`a {CbpѦ]тG+ x,$<>uٞ(IOfe, ©}w'p1_2ح2 }礪Ju3 x}7B 36'p6ẙ%lnjx\ mdc/resources/ebgaramondcaps12-regular.otfPK!G}#;mdc/resources/futurabook-italic.ttfPK!a88$:mdc/resources/futurabook-regular.ttfPK!b2&mdc/resources/futuramedium-regular.ttfPK!Q\i\i`mdc/resources/iclr.bstPK!$##fmdc/resources/iclr.styPK!D:j j j[mdc/resources/icml.bstPK!LiiXmdc/resources/icml.styPK!U``!mdc/resources/lmmono10-italic.otfPK! ""mdc/resources/lmmono10-regular.otfPK!& mdc/resources/lmmonocaps10-regular.otfPK!>!+!+Jmdc/resources/neurips.styPK!mdc/templates/__init__.pyPK! r r mdc/templates/iclr.texPK!|+  mdc/templates/icml.texPK!e*WX X mdc/templates/neurips.texPK! ^mdc/templates/note.texPK!emdc/templates/simple.texPK!|umdc/templates/standalone.texPK!Cmdc/templates/stylish.texPK!H3I88#$)'shinymdc-1.2.1.dist-info/entry_points.txtPK!Hu)GTU/(shinymdc-1.2.1.dist-info/WHEELPK!HT !(shinymdc-1.2.1.dist-info/METADATAPK!H5Go/x *shinymdc-1.2.1.dist-info/RECORDPKl0