PK!sFmdc/__init__.py__version__ = "0.2.0" PK!" mdc/mdc.pyimport argparse import atexit from collections import defaultdict import importlib.resources import os import shutil import subprocess import sys from tempfile import NamedTemporaryFile, TemporaryDirectory from mdc import __version__ as mdc_version import mdc.resources import mdc.templates __all__ = ["build_pandoc_cmd", "run_compile"] DEFAULT_FROM = "markdown-markdown_in_html_blocks-native_divs" AVAILABLE_TEMPLATES = [ "icml", "neurips", "note", "simple", "standalone", "stylish", ] DEFAULT_TEMPLATE = "simple" TEMPLATE_RESOURCES = defaultdict( list, { "icml": ["icml.bst", "icml.sty"], "neurips": ["neurips.sty"], "simple": [ "ebgaramond-regular.ttf", "ebgaramond-italic.ttf", "lmmono-regular.otf", "lmmono-italic.otf", "lmmonocaps-regular.otf", ], "stylish": [ "ebgaramond-regular.ttf", "ebgaramond-italic.ttf", "futura-light.ttf", "futura-book.ttf", "futura-medium.ttf", "lmmono-regular.otf", "lmmono-italic.otf", "lmmonocaps-regular.otf", ], }, ) DEFAULT_BIBTYPE = "natbib" DEFAULT_META = [ "figPrefix=Figure", "eqnPrefix=Equation", "tblPrefix=Table", "lstPrefix=List", "secPrefix=Section", ] DEFAULT_PANDOC = "pandoc" DEFAULT_LATEXMK = "latexmk" DEFAULT_CROSSREF = "pandoc-crossref" DEFAULT_IMG_EXT = "pdf" DEFAULT_VERBOSE = False def build_pandoc_cmd( input_file, from_=DEFAULT_FROM, template=DEFAULT_TEMPLATE, bibliography=None, bib_type=DEFAULT_BIBTYPE, crossref=DEFAULT_CROSSREF, include=None, meta=DEFAULT_META, pandoc=DEFAULT_PANDOC, ): """Build required pandoc command from given arguments.""" cmd = [pandoc] cmd.append(f"--from={from_}") cmd.append("--to=latex") if template in AVAILABLE_TEMPLATES: template_context = importlib.resources.path( mdc.templates, f"{template}.tex" ) template = template_context.__enter__() atexit.register( lambda c: c.__exit__(None, None, None), template_context ) cmd.append(f"--template={template}") if bibliography is not None: cmd.append(f"--bibliography={bibliography}") cmd.append(f"--{bib_type}") if crossref is not None: cmd.append(f"--filter={crossref}") if include: for f in include: cmd.append(f"--include-before-body={f}") if meta: for m in meta: cmd.append(f"--metadata={m}") cmd.append(f"--default-image-extension={DEFAULT_IMG_EXT}") cmd.append(input_file) return cmd def run_compile( pandoc_cmd, template, output_file=None, latexmk=DEFAULT_LATEXMK, verbose=DEFAULT_VERBOSE, ): """Run pandoc command to generate tex/pdf output.""" if TEMPLATE_RESOURCES[template]: # Create and populate resources directory if not os.path.exists("resources"): os.mkdir("resources") for resc in TEMPLATE_RESOURCES[template]: if not os.path.exists(os.path.join("resources", resc)): with importlib.resources.path(mdc.resources, resc) as resc_path: shutil.copyfile(resc_path, os.path.join("resources", resc)) if output_file is None: subprocess.run(pandoc_cmd).check_returncode() elif output_file.endswith(".tex"): pandoc_cmd.append(f"--output={output_file}") subprocess.run(pandoc_cmd).check_returncode() elif output_file.endswith(".pdf"): # Generate tex, then compile with latexmk with NamedTemporaryFile(dir="") as temp_file: pandoc_cmd.append(f"--output={temp_file.name}") subprocess.run(pandoc_cmd).check_returncode() with TemporaryDirectory() as temp_dir: latexmk_cmd = [ latexmk, "-pdf", "-lualatex", f"-output-directory={temp_dir}", f"{temp_file.name}", ] if not verbose: latexmk_cmd.append("-quiet") subprocess.run(latexmk_cmd).check_returncode() # Copy generated output file tf_only_name = os.path.basename(temp_file.name) shutil.copyfile( os.path.join(temp_dir, f"{tf_only_name}.pdf"), f"{output_file}", ) else: raise ValueError("output file extension must be .tex/.pdf") def main(): """Entry point.""" def _meta_arg(string): """Argument type for passing meta variables.""" if "=" not in string: raise argparse.ArgumentTypeError( "meta var should be passed as " "`key=val`" ) k, v = string.split("=") return f"{k}:{v}" arg_parser = argparse.ArgumentParser() arg_parser.add_argument("input_file", type=argparse.FileType("r")) arg_parser.add_argument( "-V", "--version", action="version", version=f"%(prog)s {mdc_version}" ) arg_parser.add_argument( "-v", "--verbose", action="store_true", help="make latexmk verbose" ) arg_parser.add_argument( "-o", "--output-file", type=str, default=None, help="write output to this file (default stdout)", ) arg_parser.add_argument( "-f", "--from", type=str, dest="from_", metavar="FROM", default=DEFAULT_FROM, help=f"pandoc input format (default {DEFAULT_FROM})", ) template_parser = arg_parser.add_mutually_exclusive_group(required=False) template_parser.add_argument( "-t", "--builtin-template", type=str, dest="template", choices=AVAILABLE_TEMPLATES, help=f"use one of the built-in templates (default {DEFAULT_TEMPLATE})", ) template_parser.add_argument( "-T", "--custom-template", type=str, dest="template", metavar="CUSTOM_TEMPLATE", help="use a custom template", ) arg_parser.set_defaults(template=DEFAULT_TEMPLATE) arg_parser.add_argument( "-b", "--bibliography", type=argparse.FileType("r"), default=None, help="bibliography argument for pandoc", ) arg_parser.add_argument( "-B", "--bib-type", type=str, choices=["natbib", "biblatex"], default=DEFAULT_BIBTYPE, help=f"bibliography type sent to pandoc (default {DEFAULT_BIBTYPE})", ) arg_parser.add_argument( "-i", "--include", type=argparse.FileType("r"), nargs="*", help="files to include before body", ) arg_parser.add_argument( "-m", "--meta", type=_meta_arg, nargs="*", default=DEFAULT_META, help="additional meta variables to pass to pandoc", ) arg_parser.add_argument( "--pandoc", type=str, default=DEFAULT_PANDOC, help=f"path to pandoc executable (default {DEFAULT_PANDOC})", ) arg_parser.add_argument( "--latexmk", type=str, default=DEFAULT_LATEXMK, help=f"path to latexmk executable (default {DEFAULT_LATEXMK})", ) arg_parser.add_argument( "--crossref", type=str, default=DEFAULT_CROSSREF, help=f"path to crossref executable (default {DEFAULT_CROSSREF})", ) args = arg_parser.parse_args() try: pandoc_cmd = build_pandoc_cmd( args.input_file.name, args.from_, args.template, args.bibliography.name if args.bibliography is not None else None, args.bib_type, args.crossref, [i.name for i in args.include], args.meta, args.pandoc, ) run_compile( pandoc_cmd, args.template, args.output_file, args.latexmk, args.verbose, ) except ValueError as e: print(f"ERROR: {e}", file=sys.stderr) return 1 except subprocess.CalledProcessError as e: print(f"ERROR: {e.cmd[0]} failed with return code {e.returncode}") return e.returncode PK!mdc/resources/__init__.pyPK!p p #mdc/resources/ebgaramond-italic.ttf FFTM#m,GDEFnHGPOSjMW(J@GSUB)OhNOS/2A `cmapSMlcvt )8fpgm]Y gasp0glyfgٳlkheadjdP6hhea c $hmtx'zloca/9('maxp ]` nameĖ`8post܈ldpprepnQ |%hD3       ;<DE   % & ( ) * + O P t u { |                 `4lt| $,4<DLT\dlt| (08@HPX    4@4           mwQn "<DFF  % | * DFLTcyrl,grekPlatnbBGR MKD SRB (AZE (CAT (CRT (DEU (LAT (TRK (kernmark"mkmk(size.x_&.6>F\R&''((( (4(<(v(*6>@D$D%F$#n yL(<yyy( y ~~y#88tVeee8[ ~jj~te8jjjjjjG3j`t~=ottBj-t`j=B`~j```-88-888j~~LVVAFZ(((3VB88 I $$(())//0022 33 44 779:<<IIJJKKPQUUYZ"\\" !  !!""##$$  &&    &&++1133 55 99;<>>\amm |  H I M N    0$$&&**2244779: << DDFHIIJJLM]PQlRRSS/TTUUlVVWW8XXlY\g]]mYca)%'(-d.bk^:hRZe_[" #<+*&]l]'^l  ,  lf`3457!!##6''8))8++j--;//911i33^55l77g99Q<<T>>V@@UCCDDFFlTT=VV>XX\ZZ?^^:``:bb:jj!nnss>xx@zzABCEEDccleelgglii^kklmmloolyyE{{F}}GHIJgggggKLMNgO.SP1  2!!""1##2$$$$&&MMW        &&W''(()+,,-3445566778899::;< == >> ??\aXbbWll|XWXW C C O O | | } } ~ ~]  l   r $()/023479:<IJKPQUYZ\ !"#$ & &+1359;<>\]^_`am|}~ H I M N F\ ~t~y~{{Q{&/ # $,41 #&&\b| (/( #A1A #$ (Q t  ((0&6 )[g"(9Li "(.4:@FLRX^djpv"B@2\3/d.Ic~"&(*0259 S T V >DJPV\bhntzRTMvvvMvMvRT  &,28>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|'Bg_ {(l or&'&<&,&,,%,&x&B&7D&& &R&Q&&3&$&&'g*&'&B&r&<&B5g&a&%,(w&&l &R &,B& &B&<&&&&&'hO6 hr&&<&&&&+&B&7D'&&&;&&& ,>&& ,f&6L&+&&D&&CD=DDDDDDD/DDD7DzDDDsDDDYDuDDDIDDDrDCD=DDDDDDD/DDD7DzDDDsDDDYDuDDDIDDDrDVD/DCd&2&&h&&&&&& , ,DDKDDKDDDDD$%&'()*+,-./0123456789:;<=DFHIJKNOPQRSTUVWXYZ[\]   !()45ABCDEFGmn%,lnpx{}~!&?E     &'()*+,-./0123456789:;<=>? - { | }     ) * P Z g j( l s, 4 7 = ? @ NO>DJPV\bhntz "(.4:@FLRX^djpv| YZ&(&&&&&&3&&&e&[&G&2&Z&w&&2&B&k&d&&Ycu[0Wh|3&Q(&Z&(&&G&&&&B&k&B&k&Z&(&Z&(&&[&Z&(&&&&3&&e&[&G&&2&B&k&'n Z`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\N^)kd>:v08cRYfz^s8/4y0d:s40c)NNcrwX^C}f)}r^xxxsxxxsxL^^^NsUU$%&'(*+,./012356789:;<=DEFGHIKLNOPQRUVWXYZ[]()ACDEF",lnx{}~!&?E     &'()*+,-.012345789:;<=>?    - | } ~   [ ^ a f &' "(.4:@FLRX^djpv|=bddYddddGz6}bc}U`<j`LT 9tz "(.4:@FLRX^djpv|VqqQPj!Pj!UEPj9$(,28DHLRXCDEF,x}   &*+-.1249:> - | } ~   ` f K "(.4:@FLRX^djpv| $*06<BHNTkU "CwU|C"U||B CCr^z$5 "  1 z$5 "  1 7|:KrrrCC 1K$&'(+/2678;FHKVW()CE,lx}!?  &()*23489:= - | } ~   _  &,28>DJPV\bhntzwldgwpztpzM~_]tpzz /GOW)1 t $:pp:d  &,28>DJPV\bhntz "(.4:@FLR|CzCx>543S'Y+U6L>9.x0^iRDbN::{F..4l{]DcDXNNi665'7A2]2|::  Q R S T U V W Y g h i j k p q r s  P Q R S T U V Y g i j k n o p q r s ~ &,2p6*]LlLp V $ *t4 VtDFLTcyrlpgrek,latn&  !"#$%&'()*BGR MKD hSRB h&  !"#$%&'()*'  !"#$%&'()*&  !"#$%&'()*(AZE zCAT CRT zDEU "LAT vTRK z&  !"#$%&'()*'  !"#$%&'()*'  !"#$%&'()*'  !"#$%&'()*'  !"#$%&'()*+c2sccalt caseccmpclig*cv012cv028cv03>cv04Dcv05Jcv27Pcv47Vcv82\dligddnomjfinapfracxhliginitligalnumloclloclloclloclloclnumronumordnpnumsaltsinfsmcpss01ss02ss03ss07ss10ss20subssups swshtnum&'LOR @F1345678:;? W=U>!"$<%'*+/09 T#Y"*2:BJX`hpx *2:BJRZbjrz$,4<FNV`hpx 0NRVp~"`*T< !"$ $$@$h$p$x$$%"%R'*~*****+^+|, ,,,",&,0,R-r-v-z------.. .R.000@01p223(383H3X3h3x45565V5v5555559f>>>AtBBBC`CjCDDDEjE~M ILyOO y//O @y By  I ' &8XY HHDRH! P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f *! )v $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|     $ * 0 6 < B H N T Z ` f l r x ~     & , 2 8 @ H N T Z ` f l r z     $ * 0 6 < B H N T Z ` f n v ~    & , 2 8 > D J P V \ b h n t |     & , 2 8 > D J P V \ b h p x ~  $,4<DLT\djpv| "(.4:@FLT\dlrx~ &,28>DLT\dlt| (08@HPX^djpv| &,28>DJPV\bhntz$,4<BHPX`hnt| "(08@HPX^dlt| &.6>FLRZbjrz"*2<FPZdnv~$,2:@FLRZbjpv~  (.6<DJRX^djp$ P$ $ Q$ R$ V$ W& _( P( ( Q( V, P, , Q, V1 R2 P2 2 Q2 R2 V8 P8 8 Q8 V< DDDDDDFHHHH    QRRRRRXXXX\\$ SD$ TD$ `D& F& QF& UF& YF' YG t( SH( TH( UH( `H( YH* QJ* TJ* UJ*J+ QK l, R , S , T , `L, U- Q .N/ O i/O/ tO t1 Q1Q1 YQQ t2 SR2 TR2 XR5 U5U5 YU6 V6 QV6 _V6 YV7 _W7 YW t8 RX8 SX8 TX8 WX8 XX8 `X: QZ< Q\< V= ]= U]= Y]$ YD, YL2 YR8 YX8 V SX j8 V iX o8 V YX q8 V kX n$ V SD j$ U SD g j S* YJ. YN m2 `R2 SRG Y * J1 PQ$ W iD h i  $ ZD$ D( ZH( H, ZL, L2 ZR2 R5 ZU5 U8 ZX8 X6V7W+ YK m$ UD( _H2 V SR j2 R SR r j2 UR2 U SR g j< S\  " & ( * 0 5 9 I * V5 VA E G I U IUO U Y 5 5 V$ ^D% UE% \E% fE& _ F' UG' \G' fG' _G' bG( S kH j n( S iH j o( bH( eH( _ TH) UI* SJ+ UK+ \K+ VK+ _K+ cK, eL, V   o. N. \N. fN/ \O/ \ SO/ fO/ bO0 P0 UP0 \P1 UQ1 \Q1 fQ1 bQ2 R iR r o2 R VR r2 S kR j n2 S iR j o3 S3 US5 UU5 \U5 \ SU5 fU6 UV6 \V6 i UV i g6 Y UV q g6 \ UV7 UW7 \W7 fW7 bW8 ]X8 eX8 bX8 R iX r o8 S VX j9 RY9 \Y: PZ: Z: VZ: UZ: \Z; U[; V[< U\= Q]= \]= f]KWZ\DA$ \D$ D$ Q D p o$ Q D p n$ Q D p $ Q RD p r$ \ QD$ T D s o$ T D s n$ T D s $ T RD s r$ \ TD( \H( H( RH( Q H p o( Q H p n( Q H p ( Q RH p r( \ QH,  , \L2 \R2 R2 Q R p o2 Q R p n2 Q R p 2 Q RR p r2 \ QRC DC PDC DC RDC \D8 \X8 XE FE PFE FE RFE \F< P\< \\< \< R\AAA A A A A A """ " " " " " EEE E E E &&& & & & GGG G G G G G ((( ( ( ( ( ( III I I I I I *** * * * * * OOO O O O 000 0 0 0 UUU U U U U U 55 5 5 YYY Y Y Y Y Y 999 9 9 9 9 9 A A E E G G I I O O U U Y Y AAA A A A A A GGG G G G G G YYY Y Y Y Y Y AAA AA AA" T" S" "    G GG GG& & ( (    III I II* T* S* *    UUU U QQUU5 T5 S5 5 2   Y YY YY0 0 9 9   " )/4EYbf ls'y*@Ssw!:@Z^ bc$ LM GOW EGIKNO pLM k i l m*  k i p r j s g h q *  g m p s  n o p r j s g h q :"&(*059AEGIOUY<"&(*059AEGIOUY<"&(*059AEGIOUY "&(*059AEGIOUY hNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ahi^xx`abc%&dHHfMMgh !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~b_ ahi^xx`abc%&dHHfMMgh      ahi^xx`abc%&dHHfMMgi  ahi^pp`xxabcd%&eHHgMMh%77 ]f  77 )2 J.:123456789'0 0()*+,-./0'1: .'()*+,-./0123456789: .':6&'()*+,-./0123456789:;<=>?s{|}~          8 +8%+:; ./DEFGHIJKLMNOPQRSTUVWXYZ[\]  !#%')+-/13579<>@ADF&EHM ' ( j     \]^_`abcdefghijklmnopqrtuvwxyz            `rx  )       $%&'()*+,-./0123456789:;<=   "$&(*,.02468:;=?CE  I * 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L P Q S T U V W X Y Z [ \ ] ^ _ ` a b c d e f ( t  )9) ,   t J   - + ,q|X$=D] 4 ACF    !&& <F HIMM ' ( . / 1 L | 8 AX,-Y$=D] 4 ACF    !&& <F HIMM ' ( . / 1 L | 8 A8.XY8  / 2YZ KNlGKU2VDEFGHIJKLMNOPQRSTUVWXYZ[\]  !#%')+-/13579<>@ADF&EHM ' (V R#  w x-M m $  . / y . y y . / yY . z  JF{ M N 9:;<& G t/ O tW t'   t B$.8 |V }V ~V V VDHLX. W N SWFV` \$,4<DLT\dlrx~ IW MW IN IM IK IEIOILML=N<K@M?W>EOLI M J \"*2:BJRZ`flrx~ %AW $AN #AM "AK !AE AL AOBEAMVOA LDNCKW"*28>D IW MWILML?WOLM4IJAMK7"(ADV$=D] 4 ACF  !&&<F HIMM ' ( . / 1 L | 7 @"(BHV$=D] 4 ACF  !&&<F HIMM ' ( . / 1 L | 7 @"(CV$=D] 4 ACF  !&&<F HIMM ' ( . / 1 L | 7 @"(DLV$=D] 4 ACF  !&&<F HIMM ' ( . / 1 L | 7 @"(EXV$=D] 4 ACF  !&&<F HIMM ' ( . / 1 L | 7 @ |VD }VH V ~VL VX$DHLXVDEFGHIJKLMNOPQRSTUVWXYZ[\]  !#%')+-/13579<>@ADF    !&<=>?@ABCDEFHM ' ( . / 1 2 | } ~  DVGHVHVILVJXVK |VD }VH V ~VL VXM46I$,.3 5=DHKLNRU[$]]+,3BIP_dhz}~  "#&368:@CFJLSikltwy&. 05)7?/\b8dr?tzN|U\kpt      I$,.3 5=DHKLNRU[$]]+,3BIP_dhz}~  "#&368:@CFJLSikltwy&. 05)7?/\b8dr?tzN|U\kpt       N46I$,.3 5=DHKLNRU[$]]+,3BIP_dhz}~  "#&368:@CFJLSikltwy&. 05)7?/\b8dr?tzN|U\kpt      I$,.3 5=DHKLNRU[$]]+,3BIP_dhz}~  "#&368:@CFJLSikltwy&. 05)7?/\b8dr?tzN|U\kpt      I$,.3 5=DHKLNRT[$]],-4CJQ`ei{~  "#&368:@CFJLSikltwy &.!05*7?0\b9dr@tzO|V]lqu       $ 46 $ 46 PIAME "$%&'()*+,-./0123456789:;<=>?@EIKLMNO^_`p   "#$&(*,.024689:;=?@ACEVXjs')+9;ACEGIKMOQSUWY[]_asu  "#,-.4589:  &<=>?@ABCDHIM     ! " # $ % 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L"(QIAMEIKLMNO#9@AVXjs')+9;ACEGIKMOQSUWY[]_asu  &<=>?@ABCDHM     ! " # $ %&E F&IAM&E F&IAMS & '$=D] 4 ACF  !&&<I MM ' ( . / 1 L | 8 A  (G & '@ 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L O H I$=$$ M NYZ  "" $@ D`)ccFmmG}}H I ACF  $**23  !&&&+<F,HI7MM9 ' (: . /< 1 L> | Z cVYZ  . 1YZH  "" $@ D`)ccFmmG}}H I ACF  $**23  !&&&+<F,HI7MM9 ' (: . /< 1 L> | Z cHX zH2=1 PdPfEd " 22~37EPTY\v 3<>EQWt~_pw.1:<CIMRX[ehjEMWY[]}   " & * 7 : > D I W ` q !!!!! !"!'!+!!!"""""&"6"<"A"`"k"o""#$%&&*v,}'1 &7EPTX[u#9>@QWt~pt,03<>GMOV[ahj HPY[]_  $ * 2 9 < D G W ` p t !!!!! !"!&!*!`!!"""""#"6"<"A"`"j"n""#$t%&&*t,|&1yvi_\YX@-& vhXU= ge$# `]RPGFCA }nieG><; ۀ{^^%@    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a%rdei'xpkhvjsgwPl|9cnm}*b"# :7_23&y!$qz!*,+3!'3#! f!X\i)@&l:GWCH%" +>32#"7>2#"&546 & q !`%%= ,.E''h@'&#4K&PX@ WBH@SWKY(% +6767632#&6'6767632#&6D!#6 w!#6 LL  PK UC  PK  M@1>L FKPX@Il  `^ _  _]_ BG:G;H@Hlm  `^ _  _]_ BG:HY@MMJHFD<:97/-*("%!%## +?#"&?"&54>3?"&54>3?632?63272#72##"&?r!q1,,?  C"@  E*)q+*;  8"= :++ Ƴ        S@ ]i@JGU^6) !FK PX@6l  loHY@a`SQEC?>0.$#  +2?6#"#"&?6#.'&5&67>32676'.7>76?632#"&76'&3>76&'&(J 1X8   (=X2 !0  q,&wP    8    1` 6f7C sB(37 $ @:$L O ^ :J  +U75h  Q O d ;E!My "/97K PX@1 _ _:GW :G WCG>HK PX@1 _ _:GW :G WCGCHKPX@1 _ _:GW :G WCG>HK-PX@/ _ _ _:G WCG>H@/o _ _ _:G WCHYYYY@$# 6510+)#/$/  $" +632#"&2#"&7>"26762#"&7>"2676zF %' i>9mD4?:;%' i>9mD4?:;  w 3L,MroEFp^25rb913L,MroEFp^25rb91ppKPX@] lljjj  j  b  j_  `\ W< HKPX@^ lljjj  j  j  j_  `\ W< HK-PX@d lljjj  j  j  j  __  `SXL@j lljjjj  j  j  j  __  `SXLYYY@)caZXSQNLJH=;750.*("  pp +2#".#"32632#"&#"32>54'&#"325<>32#"&54>7>54&#"#"54632#".5467>'&546P-?(. #<- % 2-?ʼnNg^T "*7O[g$GO &*DNM*f\gW1uN, 4&&4 ( &B*y>|N7 ?+ 1! #)D62`4 %% $B*';  ?|GZLZ &Q]H&K&PX@ oBH@ neY% +6767632#&6!#6 UC  PK ^*@o<H,$ +>7632#"'&w$M   L$% #  % u>  >u9 ;+d@o<H*$ +#"&7676&'&632M%I  G%#% !x; :x< '|mz5d@2*"FEKPX@ljmBG:H@ ljjmBHY'*$'! +43267632632#"'.'#"&?&54?&'&  ,  I Z$  ,   02 Z$o/'0Z  ,/'0 Y   ,2&)'@$Fn_;H$44$52 +;2+"#"&=4+"&546;2=4632J  " $      x@ne$" +74632#"547>54&-%!k2,4=P+Fm D%2 ,+7546?6>  )"e @WCH   +72#"&546Z&&e&&  @oBH$" +632#"&  n / I - OK PX@W=GWCH@W=GW>HY@   +2#"&54>"32>54&4"1H~F!-F|;,Z8 (Z;1#Te2"OksA iI l<K-PX@lj=G;HK2PX@ lj=G;G;H@ lj;GW;HYY@ 64310.)(s) +764.#"&543226323#"&#"#"&54676zQ . /  35;ED       m  lEA@>FljW=GW;H641/-+ ED +727>32#"&#"#".56?>54&#"#"5463236 5 ZbH "" 17 cC"<  )r  A4 f  0 ! : S6! $W>D7P@M"Fljjj[W=H31., 77 +2#".543232654&#"&76767>54&#"#"&546%5,.f$@N!&  .#!-[8$SGB#Y nH; 6# N!K*6y@ 2.FEK-PX@#lm__=H@+nlmS_WKY@,++6,54%SD$ +76767323272#"#"#"?6&#""&5472?4'&3+q7 JF 5  >, @ "h'& ?N =]/ L  5E{ >K,.@+ll[W=H"%*!"+ +74'&5476767632&#"#".54632326X # FB %2  ;0f $@B=f" 7  4 'KP&r   \`'@ FEK PX@nW=GWCHKPX@nW=GW>H@n_W>HYY@" ''$,# +74>327632#""32>54&`!4|  ,0jW,M'K8qb c* E(vzaw,#5RG F*+@(FlmW=H%!R&"s +6&'"&#"#"#"54>5632332>32#"547g 7 \   $ Z$1( F' /6 : ,M%1@_WCH+++$ +#"&54676'&54632'>54#"3254'&7D($5>,$_+,f2;f6'1YCJ0Bg3&,PB58$K9&*PC/K'/VMK/n&*@'o_W=H" &&$*# +#"547>76&#"&546322>54&#"n_ !A  -7{Z%8!3 '_c 9F'eO6RP"&g# +@(_WCH      +72#"&5462#"&546_&&l&&e&&&&mu,@)FlmSWK4% +7.7>32#"567>76&2"&6['" x*'F V*(*7*E` 50 Y!,!!,5@FW;H& +7+&#%&5467%2172| S)      % 2l;@8F_SWK  +!2#!"&546!2#!"&546J  C   C l      5@FW;H! +-.546323""&767%6 ) K u    % Fp".@@=ljWBGWCH$#*(#.$."" +2#"&5467654&#"#"&5462#"&546:EOX  "=E].! .X%%^Gb)- +  13B ,@1'&O]*JVr@o31 F  ll _   _  S `SWKLKRPKVLVA@<:64*($"JJ +%2654&#"3267632#".54>32#"&54676'#"54>32762'"32>54KBm~d/B@$Y. 0g=cU0zqpl;e3 \;$XI !_BGhF`ϙ5R0 D1 ;V9gHopj`)& +AR &    +]: P["& MhK&PX@%lj_BG;H@ nnn_;HY@DB><310+!MM& +?6?>&#""&#"#"547>?6&#"#"&#"#"54767>327>32  :  ^? %1)t  ;M%F: 8     ,{ |"  9  Y  i7DK@H3F `:GW:GW;H98?=8D9D*('"77  +"32654&"&#"#"547>76&'&4326326362654&#"P% ' !MqH<G$'. "!, L dWd=l"Ju68- 2 W${L# dIAP ""$T9;M 'WnwOB2;  `0@ +FEK PX@4lj:G:GWBG;GW CHK PX@7llj:GWBG;GW CHKPX@4lj:G:GWBG;GW CHKPX@7llj:GWBG;GW CHK2PX@9lljd:GWBGW CH@:lljl:GWBGW CHYYYYY@/-'%#! 00 +"&546323262#"&76'&#"327632&#"t$B'*  DƊTNH 8 5n U  E#Uxt 4eFK-PX@W:GX;H@$W:GX;GW;HY@ /-,' 44$" +4&#"326"&#"#"547>746.'&543232632y:2S+=$,!  Y/]^po3B7632#"&#"#"547676&'&54Q   ( E'   f3:!9  N(L$Z " / . $ 7D S D ;#  UKPX@3l  d  _W:G=G;G;H@4l  l  _W:G=G;G;HY@SQLJ"65'"m!!( +7#"&#"#"547>76&'&54323!2>32#"&54'&+"3767632#"54&'&#"9G$%$ #Q      :'   fq  %#  . .  $ 7D bI@ 6FEK PX@/l_:G:GWBGWCHK PX@2ll_:GWBGWCHKPX@/l_:G:GWBGWCH@2ll_:GWBGWCHYYY@HGFDB@<:%%% +#"&76'&#"326?6."&543232632#"&546323262*  D_QW(1  H4  ) e0$B'uU  E#qb^}2l   $U   (~ ~[RK-PX@` :G;H@` :G;G;HY@UM8}!!(7!& +%#"&"#"5476?6#!"#"&#"#"547>76&'&543226323!2?6'&543232632 2$9$D:9 >;$$ 3"7%C:Y::=,%" d$"   < -  %"   ; :   !(@:G;HQ- +6&'&543232632#"&#"#"54767 !=9%&( #=H$N&#  "<"!  <{8(HKPX@d\:H@l\:HY@%# (( +276&'&543232632#"&54632 =1 !</$# }5?G*)$ '#  $gbwB# :_K-PX@-lW:GW:G W ;H@1lW:GW:G;G W ;HY@][PJGF@?5- __ +"&#""47>/.#"#"&#"#"547>76&'&5432326322?>&'&54;2632d #.6 "6G$%& !:0%$ 9#-  2k%\EM+? +$  !%#  ( (    16 C  a3$@!l:GX;H!U$: +76&'&543232632;2>7632#"$#"#"5476 ";F$ :!9  S'L$Zc$   :S D rc@ QR FKPX@4d  j  j W  :G;G;GCHK&PX@5l  j  j W  :G;G;GCHK-PX@7l  j  jj W  :G;GCH@;l  j  jj :G W  :G;GCHYYY@_]\ZUSLG,!X#$!!( +#"&#"#"547>7>"#"76#"#"&#"#"547>7>.#"&5463232327>32632 ! XD#,1 C( ;,#.* *"   )W #LG#,  $#o 53/p)  #5     ) \]K-PX@W:GX;H@W:GX;G;HY@RPJE0.-,+)\[ +2632+"&'&#"#"&"#"547>7>/&'.54332327676'&543 M%') v I  t=&;  ! Nc' WY !* #   #'   @(,#$ Y -@*WBGWCH   +2#"&54>"32>54&aarcdk_DaDHxI)a]wЃcs{$hDaXM>R u45@2lW:G;G;H31)'44 +7"#"547>76&'&543232632#"547>54&#"#"&J$&+ 2OO V~o*ewM<;. "#8' ^Of  aS@_#K  4B!FKPX@3ljjjWBGW?H@0ljjj[WBHY@65=;5B6B.-+)%#' +.547>32327632#".#""547676"32>54&Fx1ʐW`eDWC 1(/H.'( &/{xaTiSIm<M3@0_W:G;GW;H'$%",!!% +7#"&#"#"547>76&'&54323263232#"'&'.#"732>54&#";.J$&+ 2$OO Tq72*);("*c8-& ,5*E5εFKPX@2 _:GWBG W;G;G WCHK!PX@0 _  _:GWBG;G WCH@3l _  _WBG;G WCHYY@;9310.,*  >> +7264&'&546323632#"54#"#".#"#"54>7632/N37_n\J     h4?Z#$/Y:$   K@PQ>kEPd /"D1B]%(V%M[ +H"'9Ts?43FK PX@&lbBGW:G;HK-PX@'ljBGW:G;H@%lj_BG;HYY@ 9&!2%"8Q$ +%#"&#"#"5476764+"#"&5476323!2632#"5746.+"GE=I%M @, .     fB B!S  .F  2Z:@:GXCH)& +#".76'&5432326323267676'&543232632_1HfA/P?^' & :2 $&WTQes)'"* 3 %.# >[L'9Y?E=  (hlIb    p9K PX@l:GCHK-PX@l:G>HK2PX@l:G:G>H@l:GW:HYYY@ 'Q,*!W +6.'&543232632#"54>76&'&5432326323271  I7%G.F  E- OA %7 6 %   9?..11,   F" SNY?FK PX@ l:GCHK-PX@ l:G>HK2PX@ l:G:G>H@$ lW:GW:HYYY@XV!Z'Q*&'!W +6.'&543232632#"'&7#"'&76&'&54323263232767.'&543232632327  I7%G.a @a E- OA %7 6 1 ![A%' 6 %   9?w Xtw X1,   F"   " &b1@.:G:GX;HXVNF643.b_ +2632#"&#"#"5467>&/&#"&#"#"54>?6/.'&54323263232?6'&5432N %X(9[ {9  + >SLH/ ;  &e7%&% x92 2 B*9       )2" &)   #7} A WM@:GW;HIDCA( +?6/.'.543232632327676&'.543232632#"&#"#"5476- *  # M2 %$ #B6!" 1E$I- !>H$Ml-9&  &&&HC)(   7 !?"+  >H@E-FljW:GW;H641.% >; +"+"&?6776'&#""54>7632327232767632#"&KHMFBE^10;0nqgQ+=zKY5 > 8MKQ*<Q]o05*@[W<H4)UE +>;2#"&#"32#'"&7>+  )  )Q-$ 65   y5wA"  =A  @oBH$" +#"'&632   / 5-/@,'F[W<H$ -+ +2#".767632676676&#"#"'&'454637  76 ^?1 *  <8 !H4ͱ  1[@De-$ ++&'.'&#"&7>4 .$4 [Y >5M +J| '@$ FSWK   +!2#!"&7>X $ W@oBH$" +>32#"'. ( +|  /M!.<|*FK(PX@&l=G W=GWCH@&nl W=GWCHY@0/75/<0<%# .. +"&5476"#"&5467>3276323267>"32>54&,* ]l3 Z9   g /  P r[ !|`$WgO LA &    7oh& y =7/@,54'6'.547>32767632#"&54>7ef,)5H $36V Q2 Q#XM#' sT5$T;:*0j?<   2*:v-%! /*[!K PX@#djW=GWCHKPX@#djW=GW>H@$ljW=GW>HYY@ &$$#"" +#".#"32>7632#"&74>32[ .\)( $M+"/;d<VH -./40nhD& AF@C%Fljj7632#"5476##"&5467>32?6.5467632`%v,9r\! 3  -K+|u$T?)]$ GH =+c:JX r%   77231 #?=(1    *w%uK PX@'l_W=GWCH@'l_W=GW>HY@!%%  +"&54>2#"32762"32>54!4>{@ 2<0Xk&cDE<5?n?6P $;M? 28k5$ UC`KPX@:d  dW32#"54&#32>32#"#"546320&aB OCKEW *#$8"* PP#x3[!Qm~  Oy@7)?,4S  2ER_@ (&FKPX@2 _ W=GW=GW=G W?HK2PX@0_ _ W=GW=G W?H@.__ _ W=G W?HYY@GF[YNLFRGR><.,#!  +>'&54>7>'.5&6323>32#"&#"#"#"&54>76"32>'&&32'&'&[$  ,J%6 .C/#$ ]Fv;10!@#o@tjB  "   7H .-<!|=1, "$r'6Wi"3-*6 .H*9.9K PX@"dHK PX@"dH@#lHYYY@ $(.)$!" +7463232654&#"#"&5476'.547>327632#"& ! .W -We  3N n8GXCHKPX@5ljjGX>HKPX@5ljjGXCH@5ljjGX>HYYYY@ #%##"(*.# +7#"&5476'.547>3267>32327632#"/&#"4#"326j  3N y4x&F< . %# V)&'&y <~ .<   iDT+3s m8 ,M1j, c5g23$$@!lj32#"547654&547>32326", 2P  =c  (Q#&,    +7\K PX@.l W=GW=GW CHK PX@.l W=GW=GW >HK PX@.l W=GW=GW CH@.l W=GW=GW >HYYY@XVQP$$$((()' +6.'&#"&54?>&#"&'&676727>327>3232>7632#"&76.'&#"&547  (?Y,  W%#  &7 6 ;y3" ;y3"K3 [Qi  (?Y4 5M4P  <  . !1ei:JFei;I$   n M4_ <7BK PX@*lW=GW=GWCHK PX@*lW=GW=GW>HK PX@*lW=GW=GWCH@*lW=GW=GW>HYYY@ $$%(()' +%6.'&#"&54?>&#"&'&676727>3232>7632#"&#i  (?Y,  W%#  &7 6 ;y3K3 [Q$M4P  <  . !1ei;0$   n -@W=GWCH$$&$ +#"&54>324&#"326%?a5"=%?a5"=@8v8v(.k^?A5.k^?A-((L((IKPX@6nl=GW=G;GXCG W ? HK(PX@3nl  [=GW=G;GXCH@6nll  [W=G;GXCHYY@IG%"#.-(" +4&#"32>547>76#"&'&76767>3232>32#"/"#"e"%= 68(K $5 .;',BXx1 : +Z'< )*De 6   A.BG=DV!  8FKPX@-l=GW=GWCGW?HK#PX@*l[=GW=GWCH@*nl[W=GWCHYY@ 64-+ 88%! +73267654#"2?632#"547676&#"&5467>32^%w+9%u`E  (bN/ tu$T?&_%!='`9JX.o +  'Q#=C)0(. K PX@#dW=GW=GCHK PX@#dW=GW=G>HK PX@#dW=GW=GCHKPX@#dW=GW=G>HK-PX@$lW=GW=G>H@"lW=GW=G>HYYYYY@ $(()$ +#"&54?>&#"&'&676327632#"'&" W4 W%#  '68>"*4_ <  . !2)t 5#)&%KPX@#dbW=GXCHK&PX@$djW=GXCH@%ljW=GXCHYY@ %% +2#"&#"#"&546322676'&546! yA&2 b ! ;358Q ##1/;6U1^98FK PX@(bllW=GCHKPX@'nllW=GCH@%nll`CHYY@ $!%%45" +7#"5476#'&54>;26?>3232#"32>76#Z!Z( $ &  08R    D!1% +    );  :@0@-lj=GWCH$$%%()' +%676&#"&?>&#"&547>3227>763232>7632#"&=  qu( Z B "` y  S:  s4!  [N$$ |e2  ;.;V< '!  n#7*$@!l=GXCH((%(" +732654'&54632#"&6?>&#"&547>32B%+ gQX" , 8 $O,.R'%% z_6J%w  609-7fG[KPX@ l=G=GXCH@"lj=GXCHY@ $(''&(! +%32654'&7>32#"&76#"&?>&#"&547>323267676763b/8s% r+@&% #]+$0 8 $OW o   fQ* &!3+R4  8NOL  609-"+/U4/ %HKPX@Ed  j  jW=GW=GW CG W CH@Fl  j  jW=GW=GW CG W CHY@B@=<970.,*&$ HH +"&54632327676/&#"#"54632?632#"'&#"326762#"/&  ;." H$  D,.   = E)+ b#' GWCHKPX@A  lljjjW =G>GW>HK#PX@>  lljjj[W =G>H@<  lljjj _[>HYYY@ECB@97/-$" GG +2232654&5<>32".#"#"&'&76&'&#"#"&5467>323276 j aD=- "  U6 =q   N2*T++"  " &#gf48@5( Fl[W<H#($( +32#"&7>76'&7>2767>7>32#". - 62 K\ . N c  K2V  V) O,n#32DA$qQ##Qo$AD  23#n,Gd @76&#".76322#"&763267>7>\ * - 62 J] . N c  J 2V  _F-n#32DA$qQ##Qo$AD  23#n,O2~.@+FS_WK!$#!" +>323267632#"&#".2Lj#C N t@  "D0J0! 8LH/@,lmSWK  +"&76>32"&7>2V j  6 #.-.-!##:**###2Y1K@HFnlloW=GWCH""%$-! +7#".7>?632#"'&'327632#"&7ʅ5c 94TA' P(Kd5Ke=BVR tIV2 1, ) + X3 uR@  J FK PX@Gd  lj  j _  _W:G CGWCHK PX@Ed  lj  j_ _  _ CGW>HK PX@Fl  lj  j_ _  _ CGW>HKPX@Hl  lj  j _  _W:G CGWCHKPX@Hl  lj  j _  _W:G CGW>HKPX@Hl  lj  j _  _W:G CGWCHKPX@Hl  lj  j _  _W:G CGW>HKPX@Fl  lj  j_ _  _ CGW>H@Cl  lj  j_ _  _[ C HYYYYYYYY@RQLKA?<:%!%#"'## +4>32#".465.#"72#3232654&5<>3#"&'&#"#"&54676767"&546?-fFe +1:  u5?." \=.A1(  <$T  KUGZR%0y =|=!  9T" 2 0AC"2E@B2.'#Fno_SXL##*#% +"2>%&632627632#"/#"'#"&?&767ng$3ng$ >|#9 85 #: ;4VvVVvi-)). -3CA5/.))./4BB3n@,!g7\?SFKPX@(d  `  _:G;H@)l  `  _:G;HY@kiec`^ZXQ'#!#)( +&'.76323263232767>'.76323263232+32+#"&#"#"&7676?#"&7>;767#"&7>;.'  I2 ". $ "M+ * > !(RrevdE <H  Lultc Y    .''R96   X 0 YF  FY  d 2@/lj.'&7>7>. 54 67676&%$ *D( **HM   '1:8+_C      )"%8\6l@3E2U)   R  %aS=S(1N  ,6O0  ,6OR+v&.9FKPX@1lj_ _  [W:H@7lj__ _  S W KY@64$#$%! +%632#"&54632'"'.#"322"&4$"32654 SFesM,!2??7Bښmn $jDH^  M8;XmnomKM /<I@ ,GAFK PX@2lbj _ S XL@3ljj _ S XLY@?=EB=I?I42)'#" // +".#"#"&76?>?6&#"&767>23276'3276?6&32+"&7>$ &L   ,<*) #o  >Q )'     |' J  ex}'222+&~&@#oSWK  +"&54>3!2#"&=4#@  "B   P/ @ Fne  +7#"767672X |>y54+vR]K PX@>   l   d ___[W:HKPX@?   l   l ___[W:H@E   l   l_ ___SWKYY@#\ZWUNMLK=;:986,*'%! RQ$ +2"&4$"32654'23262#"/&#"#"&"#"&547>=4&4&4&"&#&5434&#"326ښmn*>B (:$  $    %&,vmnom<*%)o a L      SA!B  @[W:H +2654&"62"&4H+<++<+`HI^I ,,++[E`NN`2&c)8u@ 4FK&PX@"nl\W=H@(nl_SXLY@+*2/*8+7$44$52 +;2+"#"&=4+"&546;2=4632"&5463!2#@                81@.Fl_SWK.d>& +&7>32;2762+&#"54?>76&#"V+#! 82 /.& %/C01& "B7&  -&2  :! (!#%6@ 1'FK PX@&db_SXLK.PX@'lb_SXL@(lj_SXLYY@,*$" 66 +"&7>3232>76&#".7>76&#"'&763 "  &    , 8>R @n&   HE%%8G0OJF@C' Fl=GXCGXCG?H#"'(&,& +%&'&#"'.#"&547>547>27>7>32327632#"& N%G) 4>  (J0P> &L#, /?$"Z8F2BJ,e Rt&OL9)E 42$t%C, "V8/<M@J d  bl  __W:GW?H<:53!$$$!#&#" +3276#"&54>32#"&#"#"&54632#"&#"6&#"32@T dPUn<S9$/"  #\G* PqWTK%  8A!$6 N@E]h @SWK +2"&76*(* !   /++Q FK-PX@nSWK@nlSWKY!!/! +632#"&#"#"767>?6'&67>     " %  /, &"^<    Ks $I@F"F__SWK  $$    +2#"&7>"32676&32+"&7>++,W8-*^* *  H08PC58P!3&)>3''? 2D}'33/+/+k)R^j @ ZFK PX@.  l_  _ :G;G > HK PX@.  l_  _ :GCG C HK-PX@.  l_  _ :GCG > H@5  ll  o_  _ :GCHYYY@TS+*igcaS^T]MH:51/*R+O!! +632"&"#"767>?6'&67>"#"?6&#"#"&76767676;272#"&'2?6'&3632#"&N     "&  /, &( VKa: $E";>F  r+^<    T fJZ2 uJ#(o4< w k)5n%@ : FK PX@7l  l _  _:G U ;G>HK PX@7l  l _  _:G U ;GCHK-PX@7l  l _  _:G U ;G>H@>ll  l o _  _:G U ; HYYY@mk]YTSPM><42.,!! +632"&"#"767>?6'&67>632#"&%&7>32;2762'&#"54?>76&#"N     "&  /, &F  {V+#! 83 //& %/C00& "r+^<     w B7& -&2  :!(!#%k(4@w1@h X 0FK PX@K  l  b  j j  __:G W :G;G>HK PX@K  l  b  j j  __:G W :GCGCHK PX@L  l  j  j j  __:G W :GCGCHKPX@L  l  j  j j  __:G W :GCG>HK-PX@J  l  j  j j  _  __:GCG>H@J  l  j  j jo  _  __:GCHYYYYY@-BA*)srmkecSQMKIGAwBw?=97)4*3# (% +%"#"?6&#"#"&767676732;272#"&'2?6'&3632#"&".7>3232676&#".7>76&#"'&763?' VKa: !E";>F \ 2   &    , 8>R @ nlT fJZ2 Kt#(o4< w " #&.   HE%6!8GMK#+9@6l_SWK)(%$## +"'.7>767>76322632"&>25  )@$  9' R $ /+ ' V$sL' W$0@ +q FK PX@Kdbj l j S _W:G W ;HK-PX@Ldjj l j S _W:G W ;H@Pdjj l j S _W:G;G W ;HYY@%}zomlfa`[XSOMKFE@<740.) %4 +;26?>#""#"&767676&/&632326;2#"54'&+"3276767>2#"54'&#";2676763#"&+"#"&767>7676&+"#"&It I5S "8F N o#<    (z: 3.  &9  a: &  9)?  '+  )Q0K 9E  R =* # 1  +Y%&o/  2  ;+ !#Ec /g= `' _& /+R' Ps(R' (/' QT( ' Vc(R' P,R' @,/' Q, ' V,4' R1YR' Pm2YR' 2Y/' QR2Y4' Rz2Y ' Vc2m5.+@(FlSWK$ +?632#"/&"'.?6/&>76"    y +    !y Y!*46@3,)(!FWBGWCH#"/-"*#**#*! +7#"&54?&54>327632#"'"&32>54&6dpZD&   1arVC/_D1JY0NHxI)  )AWs{6( ";KwЃ8Jh$7`;:XMZR' P8ZR' 8Z/' Q8Z ' V8WR' <N@.@++Fl`:G;H($*Q& +7#"&#"#"547676&'&543232632632#"547>54&#" #>H$N !>9%&( V~o*ewM<c""  <#  "^Of  aS@_XuUK PX@-ddWGX?HK#PX@.dlWGX?H@/llWGX?HYYY@LJHFCA(##*' +>54&#"#"5463232676767>325463232654'&54>6%"'.)M;,>* 1H)[#+*@w/A*/:& A:6C *!$! +!0"-1SU/0_Y823BFc7*5#&! +<  32-)&BH 8 'D'JD'Dd'DR'D' D-7AK PX@0  dj   _ W=GX;H@1  lj   _ W=GX;HY@#98/.><8A9A42.7/7(&" -- +27>32327>32#"'&#"&54>"326547"32654  A+D?  (I*H"XIXF,8l$ B? '<)7G " " $AV X+&~_Bm6,uCp\7 G(.[&F*w'H*'H*'H*R'H1'1d'1<&o1lR&v- =t@ <3+#FK PX@&d327654'#"46?&'&54327632F8v8vY?h;"=%?a5   ,R hE V,  =7d'Q-'R-'R-'R-d'R-R'R2EB@? F__SWK  +7"&5463!2#'2"&462"&4@   &&&   &&&&- '.@.! FKPX@=GW=GWCG>HKPX@nW=GWCG>H@noW=GWCHYY@ $$)#*! +#"54?&54>327632#"'7&#"326=F %?a5%?a5 8v 8v *.k^? &.k^?SL:LB')XB'[XB'XBR'X'\GzKPX@1l'32>32#"/"#"547>76'.547>32O$ 7 68({),BXx1 : +ZN6V &8)*DeG=DV!   <   R'\' S $ /+B'D4' T$n'D#& $'D`R' &*'F`C' Q&/+*n'F`'' U&*[e'F`7' Y&*'F _/+7' Y'' t@G@/+& 'c& G' Sk(/+*B'H+' T( /+*n'H'' U(*we' H& (w&H7' Yy(*'H _/+b/' Qw*'Jb*' T* /+n&vJb'' U*e'Jb'5*'J~/' Q+.f' lK/+~nK-PX@&`  _:G  ; H@*`  _:G ;G  ; HY@% gedba_WTMKJIHF?=:81)#" n n3 +!3!27%"46;76&'&54322632!76'&54323263232+#"&"#"5476?6#!"#"&#"#"547>7Y  = 3"7%Cm:=,%" I  9m 2$9$D:9 >;$$ ma ^;"   ;;<:   !< $"   < -  %e.IFK2PX@- d `;6'.547>3232+7632#"&5463232654&#"#"&547z? 3N wi[n87632#"54=H1 OT g 7 %+L08/  % 3N#8''-a,1e'ML{8/' Q-Q8&k:'.7&nNG2FK PX@0dbjW =GCGWCHK PX@1djjW =G>GWCHKPX@1djjW =G>GW>HKPX@1djjW =G>GWCH@1djjW =G>GW>HYYYY@FD)%##")!#' +67>32#"&#"327632#"/&#"#"&54?>&#"&'&6767208#2  %c ! %# V1# '  O%#  &7 kI|3 N"$d 8 ,M1w+6a  & . !1 aR' T/2r' iO /+ a'/3&O ' -/-/+2' t@O@/+ a'y-|/|/+2^'yO/+ aG9@6G Flj:G=GX;H!U$7+! +#"546?6&'&5432326327632;2>7632#"$#"#"5476?   RH ";F$ ?  <:!9  S'L$Z8 $   ; ;S D ;248p(FKPX@'ljj32#"54?#"546?654&547>3272632326", H7 >;2P PEDO =c  (Q#&  ,   # # +R' 17'PQ'@16&gQK' Y1/+7'1Q _/+7g& tQ gKPX@)l d  \W:G;HK-PX@*l  l  \W:G;H@.l  l  \W:G;G;HYY@a_\ZVTGA860+!+" +%&#"#"&"#"547>7>/&'.54332327676'&54;2632#"&5463232>7>Y t=&;  ! Nc' WYkM%') V Q?G*)$ 2++   #'   @(,#$  !u[B# CT3D,K PX@/dW=GW=GCGX?HK PX@/dW=GW=G>GX?HK PX@/dW=GW=GCGX?HK2PX@/dW=GW=G>GX?H@0lW=GW=G>GX?HYYYY@<:20'% DD +2#"&5463232>7>54#"#"&54?>&#"&'&676727><[4"k; ! 5>EY,  W%#  &7 6 9XJoJd /"#27/&%4P  <  . !1ckY' Sp2-B'RY4' T2-n'RYR' X2-'RYRbKPX@Nl d j  _ WBGW:G=G W ;GWCH@Ol  l j  _ WBGW:G=G W ;GWCHY@%^\WUQLGEA>:831,*(%! RR +"&54>323!2>32#"&54'&+"3767632#"54&'&#";2>7632#"&#".#"32676Icdp8SI    ( E'   f3:!9  HHmK+_DaD1`cs{ / . $ 7D S D> $hDa2U&2=@  FK PX@4l  _ W=GWCGWCH@4l  _ W=GW>GW>HY@43973=4=$$&#$$$! +632#"32762#"&'#"&54>324&#"3267"32>54mIUJYj& 6<0Af. ES"=%?a5518v8v&gFGNP?%A '8M? j'$JA5.k^?+C((L((ԝk5$ R' 5('U'5&U7' Y=5('U _/+ R' E6z'V /' Q6R'V & _P6 /+&&V 7' Y6'V _/+j& _i7/+^&Ws7' YF71' t%W%/+sO)(FK PX@3lbBGW:G W =G  ; HKPX@4ljBGW:G W =G  ; HK-PX@2lj   `BGW:G  ; H@0lj_   `BG  ; HYYY@!IDCA<:7530'% OO +"546;764+"#"&5476323!2632#"5746.+"32+#"&#"#"54767 p- @, .     -v  eJE=I%MJj !S  .F  2 B B1^Iҵ? FK PX@3bl l  _W=G C HKPX@2nl l  _W=G C H@0nl l`  _ C HYY@EC530.+)'%$#  II +7"546;76#'&54>;26?>3232#"32+32>76#"54?: &%( $ &  08%C 5!    #Z!( m    );o c  !1% +wZ4' R8Bd'XZ' S8BB'XZ4' T8Bn'XZL' W8B'XZR' X8B.'(XZ& 8B'XSN/' Q:7f'4ZW/' Q<'\W ' V+<R' =']'' U=e']7' YM='] _/+F ^KPX@#djW32#"&54&#aH"|2%;6.Q59=g "@ɑ"$1MiM7)  UKPX@3l  d  _W:G=G;G;H@4l  l  _W:G=G;G;HY@SQLJ"65'"m!!( +7#"&#"#"547>76&'&54323!2>32#"&54'&+"3767632#"54&'&#"9G$%$ #Q      :'   fq  %#  . .  $ 7D Y "15@2nlWBGWCH$#+)#1$1&#%% +#"&54>323254&54632'"32>54&arcdp*R6',+8( _DaDHxI)a"06wЃcs{ ) &*BLhDaXM>R-".5@2Fn_W=GWCH$$#&"&& +#"&54>323254&54632#"4&#"326%?a5"=%?a5.'%,C):8v8vM.k^?A5.k^?  2,@!((L((A2@/nW:GXCH=;50'% AA +#".76'&5432326323267676'&54323254&54632FB_1HfA/P?^' & :2 $&WTQes)'"j(,+F_: >[L'9Y?E=  (hlIb    )&5:cL=@:n  l j W=GWCHLJ&5())$$" +32>7632#"&7676&#"&?>&#"&547>3227>76;254&54632#"s4!  [N=  qu( Z B "` y  S: /'%,C)^'!  n#$ |e2  ;.;V<  2,@cCa@^l  j  j  lW:G W:G WCHB@<:75*($"  CC +"54?6+""54>7632;2722>32#"&547>3232654&#"/2;CE ?O`O5z T32#"7*' -  T$ @32#"7>32#"7l' - V' -  T T7'?''@' _/+'@G _/+ 8'-T/ v'MT/2 'MO8'-1='M17e'MQK' Y$/+'+D _/+K' Y,/+1{' _/+YK' Y2/+-'R _/+ZK' Y8/+B '<X _/+Z{' Sw' V8w/+B' j'X/+Z' i6' V8 6/+B' ol{'X{/+Z' Yi' V8i/+B' q@'X/+Z' k6' V8 6/+B' nE{'X{/+{' Sw' V$w/+' j'D/+' S|' U$|/+' j' g?D/+' SB'b7' Y*'J _/+:7' Y.7=f' mN/+Y& 2&RY' SpmB'nl7' YDG' _/+Qw' _/+'='']'']GbR' *'JR' P17'Q' if' W$ f/+!' iE' h!D/+/+R' w'YR' -'kR' Z=$'D4' $}'DR' Z(*'H4' v(*}'HR' Z,1<&~4' ,1[}&jYR' Z2-'RY4' v2-}'RR' Z5('U4' :5(}'UZR' ZE8B' XZ4' 8B}'X &w6&&Vs'7^&W~7' Y+. \' m|K|/+Q'' U$e'?D' _( /+w&HY{' Sw' Vc2w/+-' j'R/+Yv' Sr' R2r/+-' jm' rRm/+Y'' U2-e'RY' S|' U2|/+-' j' gR/+W' S8<B'\Q?KPX@nbX?H@nnX?HY!$/! +6#"&547676#"&546323271 OT u7"( +/08/  "(Kj ")b&Av5FK&PX@ljBG;HK-PX@nnn;H@nnn;G;HYY@ +$*!W +7#"&#"#"&76767>327>32#"&#"#"&767>7>&#" ;M !F: 8  ^? !2y !f#  9  Y     +~  !:IO@L8Fljjj=GCHFD?=31*( :: +232>32326767676#"&?>&#"'&7>6&#"327> 8  4#e  ' B&$& B 2 #   0:;"<* ")  " 5$  &t* M7) 0@-ljW=GWCH$$#%" +%#"&'&763232676&#""&7>32N5 $ ,N&:.5 e7@1^ [;Ht7  @u* 1<@9l_W=GWCH-+%"116" +.;2"&'&76323267>&#'.7>32M%!&('M5 $  "S i! QC$SmNr1 +<@9l_W=GWCH '%! ++%# +%>'#"32"&7676;2676&#"#"&7>32 M( 5H>3 , 15(`7A3V .20I*6 765.7>32#"54&#"32632"&#"32762 &  = _6" 0  % - !$13 X&#):*&97 )&)(  ,!")1 80|A^@[F  ll__W =GWCH;953/-,*'%$"AA +2#"'&76763232676&#"#"&763232676&#"#"767676)30 " (I"  :#=  # % !.5   D/5- 0(#4 %L5,4 $9@+W6@3F]W=GWCH"" +%#32767'36&#"72#"&7>".B) %-1'%KD]IBEj7&P&@](&mwR^rWV8Yh~@{(Flj  l  j ___ W ;G W C Hdb][WUQOMKEC?<5431-+&$ YY +32>32#"5<.+"3767>32#"54'&#"&"2>7632'&"#"&54632&#"326?6    , i  L " M"4  ( I!##Jl{,Ac-@.$6 N  "    Ap >bHy3]E.B($%6JK-PX@=GXCH@l=GXCHY@ !(($ +#"&5476.'.542262327654'&543226322wkUrC ($"&("P:K60( X:I^rWZE    e6Mu7'O)   E@ 97 F EKPX@=l  ll b  _W=G X ? HK2PX@>l  ll j  _W=G X ? H@<l  ll j_  _ X ? HYY@B@<:1/-+*(! EE +232654#"#"'&6?6&'&#"#"&5467>323276327632#"546"CSw_ +  U6 =q   4J̀[5Mu  " &# "K7o2\=.@+18" Fo`<H).9)6 ++"&7676?6&#"+"&767676'&676732632h  d " ! b W 0 3. Co  l &%a'!\- )5@2FljmW:H* +6'&67>7363#"&7636767>2" #!""@ %N% \n]50#v/ ]g.6@3! FoS_WK!$).7 ++"&7676?6'&67673276?632#"&#"  j " :  (.cp%    @E;@8B, FlSWK@=53*'8&" +#"5'4#"5'&'&7>;2?6'.>;232?6'&7>;2 h  `  9 _   ?  I     h S%   ^ V  1n 52@/FnbSXL.-,+'%3 +&76;2?>'&76;2#"&767227676/&  ]  A  K 1& E   f \   ,C2  cA iA |1v/KPX@ o:H@ neY@  +2#"547654&'&546&7l9U# v,#76&'&4676732  f Y H@   # &l <2H@E1Flj_SWK/-)& 22 +"#"&'&76232676'.67>;2#"&76    @2 %  ;%   !)   ( X N7@4" G7FlSWKEB52%$ e +.7>;2632?>'&7>;2"+"&7>/&+"&7676?6' 0"  C 9 ] % 5 @@    "   7 a  7 8  @ ?@<FnllmSWK"!&"!# +67632327632#"&#"#"&.2'"#0$:%/  T@FWBH&$ +&54632#"8. (H5   @o:H% +"4767632). Y;U m @o:H%&# +#"54767632#"'&'&(5 4-$   :)3  J4*l <&d9@6noS_WK  +"5463232632#"&#"(G Q #D V ( E" D%B @SWK   +32+"546"  B   G @SWK32 +463!2#!" Q !  ( #Nn&@#FnSWK$#"# +327632#"&54632uB Q8.Y= 5I)) de @SWK   +2#"&546B! e"%R -@*SWK      +2#"&54632#"&546=! ! R"$"$O!hK PX@laWBHK#PX@lmWBH@lmSWKYY#()! +632#"&767676&#"#"'&76b*)" :     %     ! #@ [WBH   $" +32654&#"72#"&546F'"IJ&I0-,H1?!*C &o _ _/+F &K(PX@ oBH@ neY$" +4632#"5    ,K(PX@ oBH@ neY$$$" +4632#"574632#"5  P     &j &'@$l[W:H$%"" +327632#"&546326462"[ 2-0 6 ?B(&&#,  9 && }BFKPX@oW:H@oSWKY"$#! +#"54632#"'&#"? Z/#%-H ;E-")F5KPX@ [<H@nSWKY#'" +463232#"&o2'<!!54'&5462e1"0#2rK PX@cWBH@oWBHY@   +2#"&=#"&5463 x  `  O"+@(_SWK  +"&54632#"32}'47( .!'2 # NK PX@bSXL@nSXLY@  +"&546;5463232#"  $ /  O a NK PX@cSWK@oSWKY@  +2+#"&=#"5463  $ /  WO a 4@1noSWK  +"&546;5463232+#"&=  3 >  ,+ = -  7Ks @SWK   +"&546;2#     @n @SWK$" +4632#"& **(( < -@*SWK      +2#"&54632#"&546B! ! `"$"$! )@&_SWK   $" +32654&#"72#"&546F'"IJ&I-,H1?!*C~6K!PX@_?H@oSWKY#'" +#"547>54#"54632~o2'<!!!  4dNC& H!=0 $ B'@$FnW?H  +&54733267>4DH"'  >,j/[B$   T- @ne%" +4632#"&5 b   sNKPX@cSUI@oSUIY@  +2#"&=##"&=463  K  7-  C ~':@7 FnSWK#! '' +2>32#"&/#"&543232>54632+#+    ##S"O  0 _/+ 0 0/+N0 0/+ !0 0/+&0 0/+Fr0 0/+s @SWK    +!"&5463!2q k     0@-_SWK      +!"&5463!2!"&5463!2q k   k   j  ,+@(_SWK  +2#"54632654&#"546:'47( W.!'2 # sLKPX@bQXL@nQXLY@  +"=4632354632#  K  7-  C  0@-]QWK   +2+"=46335  z  Opg  o UU+?@<FlmSWK&$ ++ +"#"54>32>32#".#"#"&54.F  & !    #" $ i/KPX@ o<H@ neY@   +2#"&54654&5468  9 # ,>+= T &d9@6noS_WK  +"5463232632#"&#"(G Q #D V ( E" D% & p /+("IK PX@bnSXL@nnSXLY$#"" +32>32#"&54632j   ) ! $ /-%('"%@"[W:H  +"&54632#"32}'47( .!'2 # ,%@"[W:H  +2#"54632654&#"546:'47( .!'2 # Amu ' L' 0 u#' #"#/+hy& #&#/+~& #(#/+& #*#/+& #0#/+T& #5#/+;& 1#9#/+ Dv' & <I/+ΰ/+#$i%6&@#lW&G'H5'lQ&+7#"&#"#"547676&'&54323!2?2#"&54'&+" #DV$Z "Q    b"!  ;#  / .  1dK(PX@"lj.GW'H@nnnW'HY@'%!1- +%267>&#";26"#"&547>327>32#"&#h5 y !p  - K  C9(~  !l8 K   (=~+ :KPX@,d  ` W.G1GW/H@-l  ` W.G1GW/HY@ :742,*(%"   #2 +>732#"&"32676&632#"76&+"#"76767632;2+}|X~c")Leg(.D1 0 s3  .  @pŕ BA &>7 ,:.&Av5FK(PX@lj.G'HK-PX@nnn'H@nnn'G'HYY@ +$*!W+7#"&#"#"&76767>327>32#"&#"#"&767>7>&#" ;M !F: 8  ^? !2y !f#  9  Y     +~  !r01 DeK PX@Ed  d b  `.GW&G1GX 'HKPX@Fd  d  j  `.GW&G1GX 'HKPX@Hl  l  j  `.GW&G1GX 'HK-PX@Pl  l  j  `.GW&G1G1G X 'G 'H@Pnl  l  j  `W&G1G1G X 'G 'HYYYY@3FE#!a_[YWTQPJIEeFdA?:96321(&!D#D  +"#&7676323!27632#"76#!27>32#&#!""&7676327"#&676762;27632#"&76#\$# )  32 & *2'F+" T) )!      0  M74 52&:)94@( 1I c'Y2E*@'W&G'H<764' ED+"#"&#"#"547676&'&54323!2632#"&#"#"547676&#'' #>H$N !>9%&( #>H$N "b"<"!  <#  "<"!  <# u3LK!PXFK-PXFFYYK!PX@,  l j.G W&GW'HK-PX@1  l jb.G W&GX'H@5  l jb.G W&GX'G'HYY@EC$"n!a$#1 +73;>7632#"&#&#""#"&7676%6'&'&'&6332727632#".45&'&#"03&4 ? . ;nM!< )" Y fz^3:  4e b ^% d& !+&+a& A  s7T?3@0:/!FW&G'H53+) ??+2'&#"#"&#"#"&7676?6'&#"&767>327>* !?BZ&'55AT !PC3r"+  FaD35)::::)U?GH@E8@F`_.G/HCA?>2*$" +"#"&#"#"5476?.54>;6&'&543232632#32654&qTDD #>H$Nan]>9%%' XukVhLmAU1!!  <nXU=  !uSP|=\f<\&;e^:@7BKFl_&G'H$/$%Q'+%#"&#"#"&767>?64&#&'&'&#"7676326?6&'.763232632767>32#" # <J  '- 4B<&"#MA ! <:  &' CTI+\#<9G27M c""  ""  '$jV\J}  #  "  |I] Vj$( LYK-PX@ XGF@ XGFYK-PX@(W.GW'G W'H@$W.G W'GW'HY@WVUR'!+q&"8% +%.7>32;27632#"&#"&#"#&767>7>.#"#"&#"#"#"764&54632;27274?0*{sw'U ,M$  # . - 2  ;r?.U-  2. 1  +'% Q$[|Y(+ 5# / &K4iW7a]/ 0 <8' V*/+T8' V5/+1' 4 A /+5]' E /++1' 4 G /+ 1' I /+L#' ' U/+ذ/+1" =S@P;9Fl1GW)GX/GW/H 641/-+"  ==$! +%&#"32676"54>327>7>32327632#"'&O 6UD*T/O:]+'  &L #, /?=tKt0,(&g7j- , 42$t%C, "Vf0HC>@;7Fl_W(GW/G+H%))'*!"+%4&#"#"&5467>76&#"7>#"&547>323#"&'&1; - ^9#T 16*O%= +?\2(Dv 49gG/m"8, - ;&>_C5+3UB,8_,e"2khCN=y M.M_6&! 64@1*FljmW1H53$%))+#"54>7654&#"#"&546327>32^- ;--?/9#5!A(8J 9 1!Bt= [ A*GDKbJxH /"7PmA5"  I'="#: 38@5Fl_W(GW/H'#%+%$!+732674&#"&>3276'.54632#".#"#"&`71a*&6a2/&4/:$ "(A! %oG06r>D++nT G|U:GI. ?L? 3/h$`  |9"  &L;60+%7 t76'&#"&54632326?632*2avW;B^^Bj]+K?ZZ?D\L# (Se%&&3-0Cdcx82B! :-G8&0+!"/\>PhD6$"J !/! &(+1FgFK&PX@loW1G/H@%ljoW1G/HY@;920'%$!!+4#"#"&5463267>2#"54>7>54#"#"&5467>  6!8 $"p&  )&"] *,P' ) 1  2"GMn  2.# ]S.) =462654.#"326%  $ FX aLd/ _5W9#6/xO 6@68+$9D9lX}Bp`7m!0jR0P4l @l1G/H*'"+7#"54?676327>32X& G#L   | j*)4 3IiK-PX@&ljW1GX/H@*lj1GW1GX/HY@ #"*.$!'-+%6&#"&547654#"#"&54632?>7>32327632#"&541 \ I&  6!  */ 9%(, /?'2 a$  "I&~""Gy 86//,3%7, "VH,3;.@.GW/H.,%#+"+%#"&'&'.#"&547>76'&'.'.543232;F 8 ;$!>*#P!' 5#QCrR$ -8;>&, 40*ߚ9OJK PX@' FKPX@ ' F@' FYYK PX@*l1GX/GX/G+HKPX@ l1GX/G+H@*l1GX/GX/G+HYY@ #"'(&,&+%&'&#"'.#"&547>547>27>7>32327632#"& N%G) 4>  (J0P> &L#, /?$"Z8F2BJ,e Rt&OL9)E 42$t%C, "V84)&@#lW1G/H$"$!!+4#"#"&54632767>7>32#"&54>d 6>   !A gm4"G;!'0 )Pw Q dTA@> n`\ (G&G)GW/HSQPNHF!*$!+!( +3263232632#"547>54&#"#"&5476'.5467>&'&5463232632>*K1!Mn 5]#%h<5 !e!+A 1Z5 Q3)*~ ) v?*H*b& Gq( "2([n 9!8f" G G: 8#9 @W1GW/H$$$"+4&#"3267#"&54632;e.e&hG/8CO)3 !(]Z@d_C=@:ljW)G/H970.(&#! CB +"#"&5463!2+"7>32#"54?6&#"#"&54?654&#&E  Y>+$  "   X& >  " ^=  3[    j*,    ,$ j 4xK!PX@'__ W 1GW+H@5ll__ W 1GW+HY@31!"#$!'##" +4&#"327#"'&32632#"5463254#"#"&54>32: .w!0sS" $BB x 7%8Qr2-*2y*Z|4!/%!;p %K'F,et8:s^(K PX@0ddl_\W1HKPX@*dl_\W1HK(PX@1dll_\W1H@2lll_\W1HYYY@ $!#$#!$!! +#"&#"32632#"&546654#"#"&54632^e%u/ 'C4^#&KPX@W1GW/HK!PX@(1GW1GW)GW/HK&PX@.l1GW1GW)GW/H@.nlW1GW)GW/HYYY@ $#!#!!$$+#"&5463232632#"&#"4#"3260 iG/8Et "'P !;n.eE%+]Z@b6PO2 !99/,@)ljW)G/H24'6#&+%7>32#"54?6&+"#"&5463!2+"   X& cO&E  Y>>+$!)  j*+ =  3[]KL)K!PX@lW1GW/HK2PX@"l1GW1GW/H@"nlW1GW/HYY@ %'($!+6&"#"&5463232654&54632#"&54  8#2&#@b  6d9/:1 " H,b/(4PG O,DgQ5P-57.@+ F_W/G+H-&&$*+7>732654&#"%+#"&547>7.54>32>.pKh \E1 0"%t   F[bZ3N-Y^ih@76.5463232>76327=Oi7 &! ZL/ K#4 e: (/]H0C Y^P4*%*<"G/"="fk2 513G_R&"'- ,28YO%8"+<;@8lW1GX/H75,*#! << +".#"#"54>3232654&5463232>54.54632~#."8bIi%(FSF9\< ;'=0&R,, u,vANg'H F$$@Gz;& J.>m 2 &<I ΰ/+L*'U ذ/+#' O /+L' U/+"+'  Y /+7 >@@='F___W'H(&*&$%$!+%4#"327>4#"32767#"'632#"'&54767632X>*/1O4fD*.2_#&1+;IDPH0 $&8f2%8=a84,0!840#!8"*G>,532G!"/:-0`Iq{{:" .=@ #  FKPX@5l   __W(G)GW /H@8  ll   __W(GW /HY@!///=/=<:64&% .. +".#"#"&546323267#"&5432>2654.#"326%  $ FX aLd/ _5W9#6/xO 6@68+$9D9lX}Bp`7m!0jR0P4lT5T' 5 /+T8' V5/+!)5$+19@6FnlW1G/G+H-,&%! +2#"&4>?.5467676>4&' MjPyE Usv A>gHdK0Y[F5!7 qLBh8a ?" -6 mVPor $Qr=ixD": jKPX@/ld  _  _ X'HKPX@4ld  _ S  _ X'HK#PX@>ld  _ S  _ X'G X'H@?ll  _ S  _ X'G X'HYYY@i`\ZRQJH(+&!!'b$% +4'&'&#"32#"&+"#"&#"#"547676323254'&547632327654'&'&'&'&547632;2632;"),0H2>N #:$,U< X]J  &@s %=043X+=*93?45 $ z - &."&\;G$xc  C?<< & &TH02*8Z J,> b$GFK PX@'djW 1GW/HKPX@(ljW 1GW/HKPX@2ljW 1GW 1GW/HKPX@(ljW 1GW/HK!PX@2ljW 1GW 1GW/HK&PX@-djjW 1GW/H@1djjW 1G/GW/HYYYYYY@FD)%##")!#' +67>32#"&#"327632#"/&#"#"&54?>&#"&'&6767208#2  %c ! %# V1# '  O%#  &7 kI|3 N"$d 8 ,M1w+6a  & . !1jQS' Pi}/+!' VY}/+d^ʶ<;FK PX@3l b  o  _G WGHK(PX@4l  j  o  _G WGH@2l  j  o _  _GHYY@USMKFC&!2%"8Q(" +%4&#"#"&#"#"5476764+"#"&5476323!2632#"5746.+"7632#"&547>VE<(*8E=I%M m@, .     1<:820/-)'%#"  GG+"&546323262#"&76'&#"632327632#"&#"327632&#"t$B'*  Dr!*+j#O O#t1TNH 8 5n U  E#z (/0 %Uxt 6, ' Vn{8-tVK#PX@7  dd _ X GWGXH@8  dl _ X GWGXHY@PGED=;9731*'  +"32654&';2#"&#"#"547676&+"#"&54632327676&'&54323!26326  2H^Fa NEbh\B$N ![ (8#9*) #&&! ,6>9%&( C+WU& ^E8O;WGSt <#!G-'-01s""  "rFK-PX@&  T   ` GW H@'  `  ` GW HY@#kh`XQNF>1/.,+)!ro +"32654&"#"5476?4>&#"#"&#"#"547>76&'&5432326323%2?6'&543232632;2#"&6  2H^F<$D:9 >;$$ 37%C:::=,%" 1NEbh]C+WU& ^E8O  < -  %"   ;  :    !WGStdf54FK PX@1l b _GWG HK(PX@2l  j _GWG HK-PX@0l  j_ _G H@4l  j_ _G G HYYY@dbWUTRQOFD9&!2%"8Q%+#"&#"#"5476764+"#"&5476323!2632#"5746.+"7632#"&#"#"547>?654&#"k8E=I%M m@, .     1%$' "D/9%,B B!S  .F  2G;gB %$| '? H'  /+lR' P H' *I5S4@1oGXHLJGA50/-$!SR +"#"547>76&'&543232632;2676&'&543232632#"&#'"#"54>.#9%&( #>H$N "'' #>H$N !D :   ""!  <<#""!  <<# q;./1#$8HI@Fl _WGW H:9DB9H:H41-*%#88 +"&#"#"547676&'&5432;2?2#"&54'&+";2"32654&&MV$Z "Q    5 DEn6&' 2OaB ;#  / .  XV`qc{L# aLCTi%$5MA@>dOXG WHLJEC@=75.,$  +732676&+"'676&'&5432;263232#"54>4&#!"#"54654326&# !S (5  '! ,6>9%&( O   9 #2(##!9 G*s""  "<7@b$./1iC' (j@g6URFdl `GWG  G W H|zwumkd_^\)$&$-(+6&'&543232632327> 7632#"&"332#"&'.'.'&#"#"&#"#"5476?6#"#"&54326767676'&'.#"#"&54632327> !>9%&( 5. :P ,!A6 6P >*&, #@ #>H$NA 8gNQ,$Ha8*4 / ! ( &9  &#  "   & ,d!3232654&#"#"&5463232654&#"% bdWd=45r8i K7Kg6- , !=[784H[T9;M V=br.76&'&54323263276?6&'&543232632v 39$DoG  >;$$ 37%Cl =,%" d$"   <n &  %"   ;`   !lH' *_T@QB_ Fd  l  `GWGG W  H\ZRP&$%(Q& +7#"&#"#"547676&'&543232632327>7632#"&"332#"'.'.'&#" #>H$N !>9%&( 57HU/:O,!G; <P >*B# ! b"!  <#  "]Rd!;H%, * e s.&EzK#PX@*ddXGGXH@+dlXGGXHY@>;3.-+ EE +"&54632327676&'&54323!2632#"&#"#"547676&+"C) #&&! ,6>9%&( #>H$N ![ (8#9-01s""  "<"!  <#!G-'r0~+Y21 u3`&s7 ASKPX@lbGXH@lj\HY@ "$((+%.'.5432326323276&'.543232632#"&546323276+M ' # H;%B  1E$;+.oI+ WO`8'  &#.    ?7F5+q U6&;5O4@1XGWHGBA?63+&%# OO +%2#"54>.#!"#"547>76&'&543232632;2676&'&543232632    19%&( #>H$N "'' #>H$N %+@b$./1 ""!  <<#""!  << _S+@(MF`GH+Q--+6&'&5432326323276?6&'&543232632#"&#"#"547>?6#"&7 %92%  L:?! 5 !>9%&( #>H$'. CAXAT&#"  !W/J#  "<"!  !"b?a6@3GX H`^RMLJA>610.%"aa +)"#"547>76&'&543232632;2676&'&543232632;2676&'&543232632#"&,X9%&( #>H$N "&' #>H$N "'' #>H$N 3 ""!  <<##"!  <<#""!  <<$" 5k=@: XGW Hb]\ZQNFA@>1+%# kj +%2676&'&54323263232#"54>.#!"#"547>76&'&543232632;2676&'&5432326323'' #>H$N %    59%&( #>H$N "&' #>H$N "(""!  << @b$./1 ""!  <<##"!  <<#FzBM@Jl _G WGWH9542.+#BA  +"32654&"#"&547632;2632;2#"&#""547676&#&' 2OaB=/ .9%'* (DEnrMV0$Z "]{L# aLCT Z "XV`q ;#:c9@6 `GWH^YXVIA5-!  +"32654&';2#"&#"#"547676&'&5432326326&'&543232632#"&#"#"54767b&' 2OaB?(DEnrMV$Z ">9%'* !=9%&( #=H$N]{L# aLCTɎXV`q ;#  "#  "<"!  <9:0@-`GWH5-! +"32654&';2#"&#"#"547676&'&543232632c&' 1OaA?(NDdrMV$Z ">9%')]{L# aLDSɎWW`q ;#  !@!FKPX@;ll__ G W GX H@>  lll__ W GX HY@;98621/-(&%# @@ +"&547>323267#"&#".7>32327654&#""547632676M xOg"-*t?  K"k#> cAE%0ba.Ru[^wЃ IE@B^G WGGWHD?><540.(&$#  +"32>54&6&'&5432326327>32#"&547#"&#"#"54767NL\ANKZ !=9%&( :q+sk}?fIh qD #=H$NtcCbf:VN#  "~wePSg21"!  <CQI@F>F _WGGWHEDKIDQEQ530.&$CC +232632#"&#"#"547>?6#"#"&5432676767>'.5462?6&#"/D9%&( #>H$'. D 49gNQ,$Ha8'9)2C 4"4:&M "<"!  !" -e %F. ?/T`/ >*B9D#)5.@+nlWGWH$'&#'+6767>32727>32#"&5464&#"326DG04( -')r L)"=%?a5"=^8v8v[ 7 ;*R%6A5.k^?A5`((L((!w 96@34FlWGWH"!*(!9"9$.%+7>54&#"32654&#""&547>329j+%%; *0A#rN(3)""-z C2 0' )8 '>.+  /+ pPs"#.*AQ1.(@%lWGWH"*&/#+476323276#"&546?654&#"#"V37'6AZ %16 e3*?##_F7 f'.$G(6  ( @($!,8)C!$02@/l_WGWH$(&%$"$+654&#"#"547632#"&54>3264&#"326LV0" --R`@R"=%?a5  8v8v2Ih_mԔA5.k^?\((L((*wHtgH FKPX@c  djjj  j  j G W GW GWGWGHKPX@d  ljjj  j  j G W GW GWGWGH@d  n  ljjj  j  j W GW GWGWGHYY@onigdb`^ZXUSOMGFA?#"%$$&+%"54?6'"#"&54632327654&#"#"54632376767>7>3227>7>32#"'.#32>32#"&5476#&4"3de! ># [%$,$ ! @ CHV3 %\#[( ")9 EsX ' ,Sz%N.^H%+#= >JU;) b( C:'GW<.%3>H@EljjjjWGWH!$#$&&"' +74?654&#"#"&547>32##"&5463232654&#"#"V)R ($  I%#6 LJ5-/;   #/4 &"    N;\ ;1!& BXBY' )/+LK PX@5djW GX GGWH@6ljW GX GGWHY@KI)%##"-!$' +67>32#"&#"327632#"/&#"#"&54?>&#"&'&6767209+ ` # %# N,0 $ '  O%#  &7 kKzM  V 8 /JM^,6a  & . !12vK!PX@(ljbGXH@)ljjGXHY@,*&$  22 +"&54632327>7>3232>7632#"&76#" & p%>- W 4!  [Nh *BI"'!3) *'!  n"6C{}%]@@ = FK!PX@-ljbG GXH@.ljjG GXHY@<:$$$%($"$" +#"&5463232?>32?>3232>7632#"&76#"#"'4QU  X #( W 4!  [NX .Y'$.*1 *'!  n"!C6@3l_WGWH5()#6$$%" +>3232>7632#"&?676#"#"&54?>&#"&'&676723727i$ W 4!  [N0; O%#  &7 , *'!  n"& . !1-R7QS*[F7P\ R@ N: .!FKPX@< dl W G W  GWGWHK#PX@= ll W G W  GWGWH@; ll _ W  GWGWHYY@QOIGCA><97#!#&%%$"+6&#"3267%4&#"3267#"'#"&4623267#"&54>32>32#"&54&"632<8v8  > D8v@%?a5"{2%;6!5**"=%?a55g ""''"=OL((%"((, D.k^? "$1vA5.k^?wy7) 7'JA[:$S<@9OFljWGWH,)$%%()' +%676&#"&?>&#"&547>3227>763232>7632#"547>76767#"&=  qu( Z B "` y  S:  s4!  # 9F  % A=$$ |e2  ;.;V< '!  *6&  +!#$(&?##?=@:Fll_GXH$$%&$(*+74>76'&#"&?>'"&547>32326767>3232>7632#"&5"_)$ B "`#:  P  s4!  [M @l %/0'K ;.;-{1#&F  '!  n:W8@5ljGW HUSJH$%%()% +%6&#"&?>&#"&547>3227>76227>763232>7632#"&7676&#"&7h qu( Z B "` y  S: " t  S:  s4!  [N=  qu( |e2  ;.;V<V< '!  n#$ |e2:$jS@PiF  l  j W G W H^\SQMKFD?>8721+)! jj +"&7676&#"&?6&#"&?>&#"&547>3227>76227>763232>7632#"547>76767 =  qu( > qu( Z B "` y  S: " t  S:  s4!  # 9F  % A#$ |e2 |e2  ;.;V<V< '!  *6&  +!#$(&?}1@{KPX@/l`GGWGWH@2ll`GWGWHY@ %)!!&''&$ +77632#"54676'&#"#"&546763232632327>54#";?"#D/5ll`GXH53.,  &&+"54?>&#"&547>3237632'327>54#"Y1  B "`#I;?"#D/5##$ --EtK  ;.;-8*%/bHQ+/J7R@O' F  ll  _  _WGWH75420.!#"$%%2$ +7654&#"#"#"&547632#"&546323267#"&#"#"463232@+ CL,;>zN4 1P% " 6 -"!3$  @C.R] iK/&2>9@6_WGWGWH$&&"%()# +7"#"&54?>&#"&'&6767237>32#"&54%4&#"326O; O%#  &7 ,O!uI"=%?a5"=8v8v& . !1PlA5.k^?A5,((L(( K@FK-PX@-l _ GWGWH@-l _GW GWHY@JHGE0.(&"    +%2?6&#"7232>7632#"&?6##"&54>76767676'.54632327 <2  V 4!  [N0G7 #"&YE8  f6.  '!  n"27 "1$(AF*w'*R'.-QK PX@3b dS_  \ WGHK-PX@2n dS_  \ WGHK2PX@3n d`_  \ WGH@4n  l`_  \ WGHYYY@HFB@$$&$$*#%% +7#"&547"5463?6'.547>3272#7>32#"&5463232>54#"}   ~E I3N %TVk38bJ ! "nP  XN$ . <  |YXe =/  k'(r5R@O%Fl l   _  _WGWH5320.,!"#$$%2# +7327632362#"&54632#".#"63232632#"&#"v@+ CL,;t1  Y2% " 6 -.>3$  @C.% /&V1&eL1lR&vQ"eM$3@K!PX@:l  lb  `GXGXH@;l  l j  `GXGXHY@@>'&#&"$&" +%76#"#"&54632327>7>3237632#"547327654#"D *BI"< & p%>- 27:%8,95Ni2$$:+C{}%'!3) */,#)L"FT72!5E/#DQH@E7 F  l  `_WG XHQOKI&"$5()#4 +%7676#"#"&54?>&#"&'&67672372?>32727632#"547327654#"; O%#  &7 ,1$ 27:%8,95Ni2$$:+'& . !1 */,#)L"FQ72!5E/.MK PX@4b  lS_ WGW HK-PX@3n  lS_ WGW H@4n  l`_ WGW HYY@IGCA=;860.*($" MM +"#"&547"5463?6'.547>3272#7>3232>7632#"&76D6_  ~E I3N %T]m,S3K3 [Qiu3<3& . <  uZ$   n @'B')Y' )/+B$& X`8p9GK-PX@lGH@lGWHY@ 'Q,*!W+6.'&543232632#"54>76&'&5432326323271  I7%G.F  E- OA %7 6 %   9?..11,   F" pR' ZO'$W<,H' *~e' )[/+H' *xY' )/+ ' VxR'I' *m}/+*Y' )/+ ' V' V~ /+0'I ް/+!8' V/+sR&}l' S /+BB'l' V /+BR'Y' V] /+-R'  =@:F_WGWH   3$"1+&#!#32676&#"3!26>32#"&k PZc@K`]&,}{X~tvh4ȹW0@-]WGWH""+%#32767'36&#"72#"&7>#/@) %-1'%KD]IBEj7&P(@[(&mwR^rWV' V /+WR'!9' V8/+aR&k ' SGB' ' V5 /+R' H' Xd'_' V /+#R'8' V/+-WR'#$i%'(b*~+,{8-:. a/r01Y2 u35s7Z8SN:{ X 0=H@E-FljjSWK53*($# 00 +".#"#"&76?>?6&#"54767>23276'3276?6&% 'R  ! .?,( &y  D )'     |' J  4D@A"Fllj`\<H$!-6! +6#"326""&7676&'&6767323632#"'_K 1  P #4#$'/,e2` !>&-6# r@14O} ?c@`.Fllj  l _ [<H <;9765-+  ? ?  +"326?6&"?#"&7>3232?6'&467>322632#8B4 2*`C   ' N   (.5g"M& C/ANK(  %7 ^ (;@8$Fl__SWK#"#53%1 +;27676&#">;2#"27632#"& #(m\7" #Y  $ .;+.  kBD%!1 3C0d 4@O@ .( FK-PX@3  l  __ _SWK@9d  l  __ _SWKY@65MKEC<:5@6@#! 44 +2;2#"##"'#"&7>7&76767.7>"32676&32676'&'#"8   P*A8 i6-9 J%    O& % %!7$  -D  "2N!$:&  #+4'.'(/^Q?@/&"+"&767676&'&467673232767>'&76;2em &1  Z V <:;  U 8   O#  # & (    ' @  X#lO@LZb^E) Fnlm S WKjha_YWVU<+<&8 ++"&767276?6&#"+"&767>?6&#"+"&7676?6'&467>72432632>7632 a !  !  `   !  !  ^ "     ;1**8 ?    m##k    m##k   q(   *%#&#   0@-_SWK      +2#"&7>"32676&5-0[<0.c , ,  H08PC58P4')@4('A'o <N@K9Fnlo_SXL74+)(&"    +2676&#"6&'&4676732632#"&#"+"&7676C "  eV ". 5.-"j7 !  c ,9).. &9# 'E-5Sh    @;/h@ *FKPX@ b`SWK@n`SWKY@/.''4$& +&6767632;+"3276#"&?46."$>4# 1,  '* p  ! FK-PX@-@=FE@-@=FEYK-PX@ nn`XL@$nnS_XLY@ -)(%I +2;2676##'>7#"&?6'&7636763276?6./.763>  %"089 #4       w %*%"r   (e! ^  %#@ FSWK73 +&76;2"5'&'&76;2?>F  M  V F     f d 2qW1&eL(UBX7YjQ2qWj 1@.Fl_SWK$"$(" +>32&'.#"327632#"&c5/3 "#  D&+'8O 3!+7 $G-d7aFK#PX@ do_W<H@!lo_W<HY@ ##)=22 +;2+"+"&7676?"'&6767>32#".#"A 1 + f 0 HA$ $ =0   AT '  `p5G@D/!Fnlj_SXL%"74&8P +3272;2>7632+"&767676+"#"&767632 "<A " cJ 8  8  aP  ) #' ^$ `/+&Di'' U%=c'\E/+;i' \% /+@&EYi& fM% /+F&E 0/+`R' ' _& /+'&F'' U'&a'G/+;' \' /+@&&3GY' f' /+F&&G 0/+' _' /+&&G /+/& bz' /+&&G 0/+' kk0' Sp( 0/+*' n& j~,H/+,/+' i0' Sp( 0/+*' o"& j~,H/+,/+/& bi( /+w&H 0/+#' e( q/+w&H 0/+4' T' _( /+n'&H '' U)Uk'iI /+b' S*B'J~'' U+.k'tK /+;~' \(+ /+.@'K~ ' V+.X'(K /+~& _+ /+&K=~' c+ {/+.&K 0/+#& e, q/+&e&L 0/+' Ts' V,s/+1l' o{&v {/+:R' .7'h]N]/+;:' \. /+7@&]NY:' f. /+F&N 0/+ ;a' \/ /+@3&O ;a' S' \/ /+@H'&O /+ Ya' f/ /+F3&O 0/+ /a' b/ /+3&O 0/+rR' 07'Pr'' U07e'P;r' \M0 /+7@'P'' U17e'EQ;' \:1 /+7@&VQY' f1 /+F& Q 0/+/' b1 /+&Q 0/+Y' i1' R2 1/+-' oD' rR/+Y' Vw' R2/+-'~' rR~/+Y' kk0' Sp2 0/+-' n' j,R/+,/+Y' i0' Sp2 0/+-' o(' j,R/+,/+ uR' 3'S/+ u'' U3'S/+'' U5(e'U;' \5 /+@&U;' S4' \5 /+@B'&UY' f5 /+F&U 0/+ '' U<6<e'V ;& \q6 /+@&&V  {' U(T' iD6T/+Ͱ/+' g' iV/+ ' UQ}' Y6}/+' g' qV/+ ;'' U<& \q6 /+@<e'&Vs'' U71^',W,/+s;' \7 /+@^&WcY& f^7 /+F^&W 0/+M/& bH7 /+^&W 0/+BZ' ]8 /+@<&6X#Z' e8 q/+&X 0/+/Z' b8 /+'&X 0/+Z' i1' R8 1/+B' o' rX/+Z' V' S8/+B'' j,X/+,/+p4' Rb97d'Y;& \9 /+7@&2YSNR' P:7f'`ZSNR' H:7f'ZSN ' V:7fR';ZSN'' U?:7fe'ZS;N' \: /+7@f'Z&'' U;e'[& ' V;R'[W'' U<e'\/' Q(='];' \= /+@&?]Y' f= /+F&] 0/+.F&5K 0/+1~',W,/+7f'UZ'\'KDK/+Fk'A /+!U`@]MBFljjjW BG;GWCHKC53-,'%"  UU +223#"'&5&67>3232676'&#&?6'&#"#"&+""&7676767>8YX8~* 3+n3   %5]9$V@9hE  /<  .?&& 6|. T<]i ^ .6.`?X) TrF)IL@$  <;#' \$ /+@&MDnQ' $'D1Z' 0' Qw$0/+-' of' pDf/+Z' 0' Qw$0/+' nf' pDf/+q' j ' Qw$ /+'' 8?' pD?/+' R|' Qw$|/+' r' pD/+;/' Qw' \$ /+@'&MD' e' T$e/+' oin' sDn/+' a' T$a/+' n?n' sDn/+' O' T$O/+' @' sD@/+' R' T$/+' r ' sD/+;4' T' \$ /+@n'&MD;' \( /+!@w&HQ' (*'H4' R(*d'HZ' i0' QT(0/+*' onf' pHf/+Z' 0' QT(0/+*' nf' pHf/+q' G ' QT( /+*' ?' pH?/+' R|' QT(|/+*' r' pH/+;/' QT' \( /+!@'&HQ'  ,1^&r /+;& \F, /+1@&e&,LY;' \2 /+-@&BRYQ' 2-'RYZ' i0' QT20/+-' otf' pRf/+YZ' 0' QT20/+-' nf' pRf/+Yq' G ' QT2 /+-' ?' pR?/+Y' R|' QT2|/+-' r' pR/+Y;/' QT' \2 /+-@'&BRY R' C-'DY R' PsC-'DY Q' C-'DY 4' RC-d'DY; ' \C /+-@&BD;Z' \'8 /+B@&nXZQ' 8B'XR' EBc'[FR' PEBc')FQ' EBc'F4' REBcd'F;' \'E /+B@c&nFWR' P;<'\W;' \< /+'\ /+WQ' b<'\W4' RH<d&\1L'A /+1X'0A0/+1G' |0' 0A0/+0/+1Y' w0' 0A0/+0/+1G' |0' 0A0/+0/+1Y' w0' 0A0/+0/+1GD'' 0A/+0/+1YD'' 0A/+0/+#'"#'"#' #& g#"#/+#/+#' #& g#"#/+#/+#' #& g#"#/+#/+#' #& g#"#/+#/+#'I' "/+#'S' "/+5m'E /+5y'0E0/+5g' 0& 0E0/+0/+5z' 0& 0E0/+0/+5g' 0& 0E0/+0/+5z' 0& 0E0/+0/+&&&&& #' x#&#/+#/+& #' x#&#/+#/+& #' x#&#/+#/+& #' x#&#/+#/++1'aG /++1"'v2G2/++1' F2' 2G2/+2/++1#' A2' 2G2/+2/++1' F2' 2G2/+2/++1#' A2' 2G2/+2/++1F'h' 2G/+2/++1#F'm' 2G/+2/+&(&(~& #' h#(#/+#/+~& #' h#(#/+#/+~& #' h#(#/+#/+~& #' h#(#/+#/+'& 3(/+'& )(~/+  &jI /+ +'0I0/+ & P0& 0I0/+0/+ -& J0& 0I0/+0/+ & P0& 0I0/+0/+ -& J0& 0I0/+0/+D'r& 0I/+0/+-D'v& 0I/+0/+&*&*& #' i#*#/+#/+& #' i#*#/+#/+& #' i#*#/+#/+& #' i#*#/+#/+a'& 3*/+W'& )*}/+#l'O /+#x'0O0/+#g' 0& 0O0/+0/+#y' 0& 0O0/+0/+#g' 0& 0O0/+0/+#y' 0& 0O0/+0/+&0 &0& #' e#0#/+#/+& #' e#0#/+#/+& #' e#0#/+#/+& #' e#0#/+#/+L'JU/+L '_:U:/+L' /:' :U:/+:/+L ' *:' :U:/+:/+L' /:' :U:/+:/+L ' *:' :U:/+:/+LN'Q' :U/+:/+L N'V' :U/+:/+T&5T& #' #5#/+#/+T& #' #5#/+#/+'& )5g/+"+'HY /+"+']0Y0/+"+' -0' 0Y0/+0/+"+' (0' 0Y0/+0/+"+' -0' 0Y0/+0/+"+' (0' 0Y0/+0/+"+D'O' 0Y/+0/+"+D'T' 0Y/+0/+=&,95&*9;& 1#& #9#/+#/+;& 1#& #9#/+#/+;& 1#& #9#/+#/+;& 1#& #9#/+#/+Q'& 39</+G'& )92/+1' A/+1g'  A /+5/' E/+5' E /++1' [G/++11'  G /+ & dI/+ ;' I /+#9' O/+#' O /+L' DU/+L' U/+"+' BY/+"+'  Y /+L'&A/+/+X'0&A0/+/+G' |0' 0&A0/+0/+/+Y' w0' 0&A0/+0/+/+G' |0' 0&A0/+0/+/+Y' w0' 0&A0/+0/+/+GD'' 0&A/+0/+/+YD'' 0&A/+0/+/+#'' /+#'( /+#')/+#/+#/+#& TP& CP'Q"P/+P/+/+#' P& lP'Q"P/+P/+/+#' P& CP'Q"P/+P/+/+#& P& lP'Q"P/+P/+/+#& P& CP'Q"P/+P/+/++'2'G2/+İ/++'2'G2/+İ/++' ' 2'G/+2/+İ/++#' ' 2'G/+2/+İ/++o' %' 2'G%/+2/+İ/++' %' 2'G%/+2/+İ/++~p'X ' 2'G /+2/+İ/++p' ' 2'G /+2/+İ/+~&b'S(b/+/+t~'ib'S(b/+/+& b& b'(hb/+b/+/+& b& b'(hb/+b/+/+& b& b'(6b/+b/+/+& b& b'(6b/+b/+/+!&b& 5b'(b/+b/+/+!&b& b'(b/+b/+/+"+'0'Y0/+/+"+'0'Y0/+/+"+' ' 0'Y/+0/+/+"+' ' 0'Y/+0/+/+"V' #' 0'Y#/+0/+/+"' #' 0'Y#/+0/+/+"en'? ' 0'Y /+0/+/+"n'p ' 0'Y /+0/+/+&d'm9d/+/+&d'm9d/+/+>& d& d'9)d/+d/+/+>& d& d'9)d/+d/+/+& d& d'm9d/+d/+/+& d& d'm9d/+d/+/+y&d& 5d'9dd/+d/+/+y&d& d'9dd/+d/+/+1cd'DA /+1^'dA İ/+1' &nA/+/+1g'  &nA /+/+1wV'PA /+1vV'P&nA/+/+*' T" /+' S}" /+#' #"#/+#' #"#/+-qd-1'x -*&E NX'('0 u+' ['G/+İ/++1'  'G /+İ/++1@X'G /++@X''G/+İ/+& #&#/+& #&#/+~& #(#/+~& #(#/+~(<-' '  b<' '  b<'B' e 0 7d&I /+ 2&7I İ/+ 8& z& <I/+ΰ/+ Dv' & <I/+ΰ/+ JV&$I /+ X'1&AI/+/+*' T* /+' S* /+& #*#/+& #*#/+<-' '  g<' '  g<'B' [ +Ln'UL'U ΰ/+L' Z' U/+ذ/+L#' ' U/+ذ/+'Q /+'0Q0/+L*`'U /+L7''!U/+/+T*' T5 /+T' S5 /+T& #5#/+T& #5#/+ u&2"' RL' 0 u' L' 0 u<h' f M"+' B'Y/+/+"+'  &vY /+/+"+V'Y /+"+V''Y/+/+& #0#/+& #0#/+;& 1#9#/+;& 1#9#/+L9<' m i-  '^ P/ @ Fne  +7#"767672X |>y54P/ @ Fne  +7#"767672X |>y54F"'@$FSWK  +7!2#!"&76kY  0j '@$ FSWK    +7!2#!"&76   *j '@$ FSWK    +7!2#!"&76   *jY '@$ FSWK    +7!2#!"&76 C  *d1'__~i İ/+W k k/+G&KPX@ o<H@ neY$% +.54632#"547>54 %!k2,4v +Fm D%x@ne$% +7.54632#"547>54- %!k2,4< +Fm D%'k/+k/+'  x&!y!{AsKPX@"o_ :GW =H@( noS _WKY@;986310.  AA +232632#"&#"#"7>47>76&#"#"&>32327>7>  1  N" C  2# *L  A { a ##,+Jd1/L{L8 + !^!8vl7 FKPX@3o  _   ___ : H@; no  _   _S_WKY@b`_^\ZYWRPJHGEA?>76#"#"76323276&7>?6&5>76&#"#"&7>32327647>3232632"&#"(*L  @   ! + K! @ ' *M  @  * P 0D & , !> M ##-.5.- !"32765#k=7 k+E+3ID..i=Jpp?Fk]&(28@5&FljmW:H10,+%#4 +3+"&7672>?6'.67>732'>2"&    j        @  j&   =  ,8r@4 &FK PX@!ncSWK@ noSWKY@.--8.7C&RV& +?676732;272#"&#""#"?'"#"&72?6'&3%.)  ' V"@8%'  &#L \(o88-,@)FnnSWK-## +#"&763276.'&76767632"N62f1  ' =3 5   ' 7G'\ 8      'bFK&PX@nl[W:H@%nl_SWKY@ *#$"# +>&#"#"767632#"&76767232o   .I[65'VF`$DP 7  "N1W>2[C6 *^=-/,@)FlmSWK&71 +6+"#&>?6;2#"767{  (   . 9M8@5:%Fl_SWK@>-+*$ +32676'&"7#"&7>76'&'&7>32'676&#"'$ % -: W*(.    I&#+   #&  S.1$,)   +9.'    & ''!  8"   .9@6#"Fo_SWK*( .. +2#"767>7>76&#"327>7#"&7>-)^$d R  *   " \F4TG494 &1'!  , ,K2&2&2l w* +M X<;@837" FnS_WK'"9)6 ++"&7676?6&#"+"&7676?6'"&636732632n  d   c $ ." ?/ Dfd u% (&"L 0@-_SWK     +72#"&47>"32765#k=%( l*E+3JC..i=Jp5N,FkU)JK-PX@nSWK@nlSWKY!.! +7632#"&"#"767>?6'&67>     "%  .+ &$"&I 5     W>0@-l_SWK.Q$Q% +7&7>32263232762#"4#&#"54?>76&#"= W+#!  82  .& #/C01& "HB6& -&2 7% ( "$$M72(FK PX@d_\>HK PX@d_\CHK/PX@d_\>H@l_\>HYYY@-+%" 77 +"&7>3232>76&#".7>76&+'&7631  "  %   "( 8>R ?n&   HE&%8GM(4r@ 0FK PX@!ncSWK@ noSWKY@*))4*3&! (( +"&#"#"?6&#"#"&767676732;272'2?6'&3' VKa: !`";>HL \JZ2 Kt")o4<H-,@)FnnSWK-## +#"&763276.'&76767632"M62f1  ' =3 6   ' /H&\ 8      J'ȵFK PX@n[W;GCHK PX@n[WCG>HK PX@n[WCGCHK!PX@n[WCG>H@nl[WCHYYYY@ *#$"# +>&#"#"767632#"&76767232   .I[65'VF`$DP 6N  "N1W>2[C6 *^=+1B2,@)FlmSWK&71 +76+"#&>?6;2#"767{  (_   .JAUO@ B&FK PX@_[CH@_[>HY@ GF53*%% +32676'&#"7#"&7>76'.>7>32'676&"n % -; W*(/       I&#+   $(%  2$,)   +9.'       ''!  7!    > .#"FK PX@o_W>HK PX@o_WCHK#PX@o_W>H@o_SWKYYY@*( .. +72#"767>7>76&#"327>7#"&7>-*_$d S  *   # \F4SH493 &1'!  , ,K2&2&2l w* +M OO0=G@D.FljjSWK53)'#" 00 +".#"#"&76?>?6&#"&767>23276'3276?6&& (R  ! .?,) %y  C)'     |' J MN '#FK PX@"l_[WCHK PX@"l_[W>HK PX@"l_[WCHK!PX@"l_[W>H@(l__SWKYYYY@ #"#53$1 +7;27676#">;2#"27632#"&H " #&p]7! #X  $.;*. mBF$!4 3EKK +@(_SWK    +72#"&7>"32676-1[<0.b><, . KH08PC58P!3&)>3''p[ p/+Rduy@ X FK PX@:  l b W:G W=G;G;GW >HK PX@:  l b W:G W=G;G;GW CHKPX@:  l b W:G W=G;G;GW >HK-PX@;  l j W:G W=G;G;GW >H@<  l j [:G W:G W=G;G;HYYYY@rpjg\ZVTPNEC532-dd +"'.'&'&'&"&#"#"&767>7>&'.76323263232676&'&7>32#"&76&#"32767>&#"MU  ' 5: 6.K  &+  0@fP /<)F $% EW?4 "* ?Fi:37.1# ; 0-3   J   "# &  VRA. z %"&E9-E8&)$5.1T@ OF EK PX@Z  ll  S _:G:G WBG  W =G W=G;GWCHK PX@]  l  ll  S _:G WBG  W =G W=G;GWCHKPX@Z  ll  S _:G:G WBG  W =G W=G;GWCHKPX@]  l  ll  S _:G WBG  W =G W=G;GWCHKPX@X  l  llS  S _:G WBG  W =G;GWCHK(PX@Z  l  lldS  S _:G WBG  W =GWCHK-PX@X  l  lld  S  _  S _:G WBGWCHK2PX@Z  l  lld  _ _  __:G WBGWCH@[  l  lll  _ _  __:G WBGWCHYYYYYYYY@)SQKIGE@>;97520.,'% TT +"&="5463767"54637>323262#"&76'&#"%2#%2#327632&#"tP E I  @.݋$B'*  Dd*0  ( TNH 8 5n  # | U  E#f  !!  Uxt)'7&=ݰ/+/+)'T'7ݰ/+/+)&\7{'/7 /+)'}&\7{7{/+/+uD,,+32#".465.#"3232654&5<>3#"&'&#"#"&546767>546Xe +2::?," \=.A1(  <$quR%0{B<!  9T" 2 Ho23Oa'|1| 'FL/+/+ L&MF/+/+L9}ZT,+6/&+"#"7>763232326332676&'&763232632632#".'.+"#"&7> $M$  # . . 2  JrD9Z"$3 . 1 +'.<,%s{u'9+ 5# //`?qNoR&1 < '\|X:.sL,',A,]',',@,J'9N, /+p9pe',9p',',9p', ',',9';[,&;',;',',; a/`&'r01&eL1 e'LL1e'L'LL1ze'YL7Y7e'LY7e'L'LY7e'Lu'L'LY1e'[L[e'L[e'Le'L[23O*[F&G7P2p ,+%'&'&'&547676!2#!! nQ Qn  C  +@{  r**r  KG  B'L,+&'&576767>32PB  GK  r**r @f  C nQ  Qn  2p ,+&'&767!"&763!& nQ Qn  C  @  r**r  KG  B'M,+7476676#"'&'&762PB  GK  r**r <@  TC nQ  Qn  2p),+'&'&'&547676!&'&'&767@ nQ Qn  Cd@ nQ Qn  C BP  r**r  KGBP  r**r  KG'M+ ,+676#"'&'&7676767>32'&'GK  r**r  PBGK  r**r  PB#C nQ  Qn  @(C nQ  Qn  @2g1,+"''&56'&676RM]B  !  V " O`K V  .s+,+&''&47&'&76376" O`K V   M]  O!  V 2i3,+67&762676'&'&M]  O!  V d"A `K V  2s+,+76#&&76'&76e"A `K V  M]B  !  V 2' /+2' /+2' /+2&,+7"&4>3!2#@       2&c.A5/*,+%4&+"&7>;2=4632;2+"#"&52#!"&7>3  "  $     1       D    z ,+#"'&632z  /  hyd_d& /+d&_x_&Ѥ /+2~a& /+2i&9 а/+#70",+7+&#%&5467%2172 +&#%&5467%2172g| S)  ,| S)      %     % #71$,+%>'%&'&6323""&546?>'%&'&6323""&5467  )S T  )S  %     %    5|,S&] /+"|S&! /+hyhr'y'yy3[Aw*' u'# w*' '# w*' {'# w*R' '# w*' }'# w*' '# w*' '# w*' '# w*' '# w*z' -'u'# w*' 'u'# w*j' 'u'# w*' 'u'# w*' W'u'# w*' 'u'# w*G' 'u'# w*p' #'u'# w*f' 'u'# w*1' 'u'# w*' ''# 'R/'>'X!Ki'>'Z `'F5'+M'/'o' 'R+''R''R>1''RK'4'R>3''R^`''RF''R}M''R/H''R'`'w*3' 'D# w*4' 'E# w*' a'F# w*q' $'G# w*' 'H# w'&'  w' 'J# w*h' 'K# w*' 5'L# to' "'M# w*E' 'N# w*l' 'O# w*c' 'P# w*l' 'Q# w*' 'R# w-' 'S# wA' 'T# w*' 'U# w*' 7'V# w*' @'W# w*b' 'X# w*' 'Y# w*' 'Z# w*&' '[# w' '\X w*' ']# d ,+2"&67"32>&T)PT)o67@\@@\,>,,>,, a#Afp+,+#"&#"#"&#"#"&+"##"'.'&6'.'&6'.6'.'&7>7>'&'&#"#"#"'&'.7>762;>72632;>763227>&7>76'.'.#"&#"#"'.'.'&#"#"'.'&+"#"&+"'.'&#"32676;27>76326;'.#"#2367>7>7>32632"#"&#.'&'.'#"326323;267>767>76;27654&'&654$4."&#"767>#"327676473227>&'.#"#"&#"232>7>&'&#"32>7>76'<.   0d#  " #      4 !  "B - '  ,M?2\$k!'l   H  G /#  &;@5 ( ';9#   6 .(#3   %   /  % %      *4               !:U 2' +4'    %  9    G     ' 6`!% -$$6+ !    "           ,      D`          X M     -!a#Aka,+>7632332>7>7632332632#"&#"&#"#"'"&+"+.'&#"#"'.'&#"#"'.'.4656&67&#"2>767676'&4.326;26736323276&54>&7>76'&+"#"&#&54632327>7>7>326762767>&'./.'.'"&#"'&76767372;>76;2;67>'&'&#"&+"+&'.+"#"&#"#"&#"$6'.'&'&#"""26;326'.'.#3263676'&#"#"'.#"3276'.'.#@   l'!k$\?M,  ' - A"  ! 4      # "  #d0  U  ; # % /   %   3(. 6   $:;' ( 5@;&  #/ e 4*              &        G    9  %    '4+ '2 U:+6$$- %!`6 '`D     ,          "    !           X  N     5<' 'JJJ/+J/+2tl' X 2l' ' X Q"eMp90+o|up,+32654654#"#".'&#"'&47632326746."'.546232632#"547623254'.#"32632"'&54.'.54654&#"32632"3263232632#".'&'&54654&#"#"'&7>54&54656&32632#"&5465&"&#"#"&#"#"&54763267>7654.'.#"#"&54632#"54654"326323254&54>54#"'&6763232654&54"#"&54767"32654.E"*         ! 6"5N    "#   6 !     1  !   3'*  #3    %$  > '  A+hR4" $\1K2R -!! -(_   . U    $   "#)#  '^        : #&  $  .$ 2*9+';/80 A      #(pK  Z31 4 .!3* $ ' !! d,!A@0+kwqlU,+%26&54#"."3254&54654&54632#"32654&5463232654&"#"&54632#"&546'&#"32?6#".'&#"#"&#"".#"&54323254&'&'&#"&4>54'&#"#"&5432326323254&546323254&'&64#""'&=4>4.546323254&'&#3262#"&546323262"32>7632&#"#"&#"'"32654&   _(- !!- R2K1\$ "4Rh+A  ' >  $%    3#  *'3   !  1   ! 6   #"   (N5"6 !         *"q.   !! ' $ *3!. 4 13Z  Kp(#      A 08/;'+9*2 $.  $  &# :        ^'  #)#"   $    U(%@A!,QBL_o)FKPX@T d d_W32654&#3727632776#EDW A 9( fPP59B/342[!&aB OBLE:1*$4%"P&!n%a>7)-/OD&  =^3! =2Qm~  Gj7:+BA \^E B"W KPX@Ol   l  j dW32#"&54&#3727632>7632#"54?6tP#x3[!&aB OGPH3M$#&Z<* g 7 %* am  2Qm~  Oy?%& Xw.% 3N#)4I[WKPX@H  l  j d W<64-+'%  II +#"54632326776#"546?27>3276323267>32#"&5476?654&#372XP#x3[!&aB OCKE) =" T+ (#$8 m 2Qm~  Oy@  +  (Q&2 ?,4SB")1FKPX@v  l  l jd_ W 327632#"&54&#"327>3232>7632#"54?6*$4%"P&!n%aP59B/342[!&aB OBLE:CA3M) 6! e-1g 7 %* aD+BA \^E   =^3! =2Qm~  Gj7<%& !,H.$% 3N#0B"z0FKPX@d  l jd_ W  32763276323267>32#"&5476#72?654#3*$4%"P&!n%aqP59B/342[!&aB OBLE:EC) =" V ( C7' D+BA \^E   =^3! =2Qm~  Gj7>  +  (Q&!* ).KD%($W> FK#PX@A  l  lW3232#"32>76#"5476#'&54>;26?6&K+C!"|2%;6.Q58?e 9 08R    #Z!Z( $ 9jM7]p"$1MiMI Ex  !1% +    &v@L Y 4 FKPX@Y  lbj W3232#"32>76#"5476#'&54>;26?#"&#"#"&#"#"&546322676'&546 gA(B* "3B 08R    #Z!Z( $ D!(I"+A)! yA&2 J$)9S   !1% +    ,&N4 ! ;358Q ##1/;.L& $Y& 2Z T * ,+2#"&54632#"&546#".76'&543232632326767>'&543232632""""_1HfA/P?^' & : % $WTQes)'  3 %."$"$ >[L'9Y?E=  #hlI)?   4,+#"54632#".5&#"& bB!2  :(256& )FhO,+654#"32676767276323267>32#"&547654'&##"&'#"&54623267677>327>@N-AN#!%R R% =" $N9C'25=,. ;'&J6&S:7D@&7D)`w) REa/Ea  +  (Q&  X,=^4  E$16e @t"FNr n\7,+654&#"32>77672#"&54&#"&'#"&546232677>327>76#"&54767632>7632#"54"(?+E! Q5%3M!#1B+E;C6. ;'&J6(Q57D:&9SH1 OT g 7 %*D4,\py{% A5Ma%& H?\xuLj0 E$1=yMt"08/ % 3N#FA$HD2,+7>32#"&54&#"&462326%76#"&54767632>7632#"54&W09H3M!#1B+F"|2%;6.8H1 OT g 7 %*:X}%& H?\g"$1M08/ % 3N#FJ5,+654&#"32>776"&'#"&546232677>327632#"&54&#"(?+E! Q5%. ;'&J6(Q57D:ED&2 "@:aH;C6D4,\py{% A5Ma  E$1=yMt>) Lj0F&D(,+654&##"&4623267>7>3276323267>32#"&547 "<7 "|2%;6.8+>sW* =" / *OW;a)o"$1Mi*  +  (Q&s`-,+27>327632#"&5463232654&#"#"&5476&+"#"&#"#"5476764+"#"&54763237!n832327>767+&#""76?676&#" EA1 H%'873*#  W$[ Ջ'()`%d`I#f"$   tw6J>)v;8',+3>2327>76&#"&767>76&#"#&67>322#"&)$1/02$  #8+ $#9% )s<+9t' <.R- ':-9e $/*> # 9G@2Y=I.D{AEA',+7;2?6763233272#"&#"#"&#"#"7676?6&#""&?6;2  9 1*  C  >J  \  &12k   %Z3 ,Y /{s:1,+%>.'&7>7676732#"&7>326Y  %,.4[p   2U1&V3#x4  W "7Q ! @ g%Dd" lMO.,+"&7676732327676&#"56767>32Y;1b/c *%.$0  >13p\zz( 8f1GC,%E.H F5Tx6fm& ,+6'+"#"7>7632332732#"&767 F4   T 6     ( 'T v3D D8) ,+32676'&#"7#"&7>76'&'.67>32'676&#"), .)KU e1$GCF &;$ ~A;B>-B "%H  5.5YB-IQ /,G7LiXC4*'!-:HJ:6, .e'>2$! %  u0,+2+*&5632>76&#"32>76#"&7>CDn]A5 *~J)2*F $$  3-29uVYP8> VzxJHF).O !J4I~ev,+2#"&67>"3267>.<9R|A<9Q|'4`&& ;4e&"vcMQibNQg|pģ{9lW4F'VAd'V>V*{1,+#".#"32>7632#"&74>7&5.54632327>3232#"32>76#"5476#'&54>;26?#"&#"[ .\)( $M+"/7\8 gA)B* "3B 08R    #Z!Z( $ D!'J"+A)w VH -./4.jeG$)9S   !1% +    ,&N4sZm e]8,+32776#>32#"&#"372#"#"'#"54632326776#"546?27>324&#3727>76"P&!n%aA&""H+fPP59B/342[!&aB O?IC7$&#%E%  (j^E #  =^3! =2Qm~  Gj7) LV+&fYnS ,+6763;2+"3276#"&?6&+"3276#"&?46&"&#.76763;2  eX B &! H&( MqC &! I%& M 12  - . "8) . "8)6 -1iG+,+*32>36#"&?46&"&#.76763367232?2"'&6;232767>.#"#"'767>76'#  C     :! M )5 ?"^K 6)<1!.    /` 3o" `. !:': -  (l` ]BG89h82  ') +uB),+32#"&>76&#"3232676&763#"&'.#"#"&7>767>7>W& ,^%_7^&'i5(0 $ D!:"uR%/{B<!  9T!  2 Hp9G@:&,+!"&547>323232654&5432#"%.#"#"547676'4"32>54& G1ʐW`eDWC  n$v{z$.ubã8!C+!\@fEB6b5R,1sjsH0*McN$& N1V3Z4"0-vxaTiSImrh(0-),+67676'.'&6323263"&"2"&6OQ  ;9 / Q  =*D('( 2    l . .U=2,+32>32#"#"54632326776#"546?27>32#"&#""* PP#x3[!&aB OH7 /#E   2Qm~  q- $&S ,+2"&67"32676& O6O6@k9;9p1}}}IYH@[Q;Gid3' ,+764.#&763226322#"&#"#"7676Q  6$6  3   ;C  OD      m  '5# ,+'&7>32;2676+&#""76767676&#" #+<+ 4o  (p9 ) :k]<3 D)  !L/21V" @2 )nP$-1A=#,+6&#"'&7>;"&7>3267>76'.#"&767>Z   # _)-' C9)/j8W  J#, $ $  "f$& #?8/ P>Ek)  =6/BK,83- ,+?6;23272#"&##"?6&#"#"&%2?6'&39}A !-7 7 &1 =b 4m??  3Qv 3C*,+32#"&767676&'&767676 ,)) F" $iW !)4'(*L4 -3D*s5  -_A= R[3 ,+".7>7>732327676&#"56767>32;B3A$6Ub-b +$3$0 >1.5[<5_M&0\ 8f/GH'%!B.H F5Uw?& ,+6&'&+"#&676763233272#"&767 lR '    If 9 3!  ( 'eM3C C8) ,+32676'&#"7#"&7>7>&'.67>32'676&#"   +'D O[-B=@ >1%v=6>9- ?  #C  $*1J6(BK0(B4GcS>&A# *6DF62)  +Y$9-" 'F.,+2#"&767>7676&#"32>76#"&7>kD;)60++e')3*D  $  3-10tX}+Y  p+e~?XE*/N !I5J}V}',+632#"&#"#"76767676'&'&7676 (  IQ  /" |  Q|*@!   "  v8&,+#"&7>3227>7672+&#""76?676&#" EA2 I%'p3*#   W$[ Ջ'()_%d`I#e#$   tw6J>2v<9(,+3>32327>76&#"&767>76&#"#&67>32#"&2 $1/02$  #8+ $#9% )s<+9t"" <.R- ':-9e $/*> # 9G@2Y= K.D{AEA',+7;2?6763233272#"&#"#"&#"#"7676?6&#""&?6;2  9 1*  C  >J  \  &12k   %Z3 ,Y /{0s=2,+%>.'&7>7676732#*.7>326k !%. !1[p   3U1&U3#y4  V  "8N  ! @ g%Dd" r\]/,+"&7676732327676&#"56767>32Y;1]!,A +$/$0 >13p\zz( <]!4tFB-%D.H F5TxDum& ,+6'+"#&67>763233272#"&767 E4   T $6     * ']v3D D8) ,+32676'&#"7#"&7>76'&'.67>32'676&#"), .)KU e1$GCF &;$ ~A;B>-B "%G "5.5YB-IQ /,G7LiXC4*'!-:HJ:6, .e'>2$! 'u0,+2+*&563267676&#"32>76#"&7>CCn\A6 *?v+)2*F $$  3-2:uVYP8> V=sHF).O !J4I~bv,+2#"&67>"3267>&<9R|A<9R|'4a&& ;4e& vcMQibNQg|pģ{N[R[vO,+"&7#"&7>376767#"&7>;>322#"5.#"72#'72#'3267>32W>+   3`&&  )Dr& -%I Pm h <3/vY  3# 5 4n@,+7654&#3726##"54632326776#"546?27>3276327632#"&5463232654&#"#"&54p+ '#$8 cT P#x3[!&aB OCKE)n832327632#"/&#"#"&5476##"54632326776#"546?27>3276324#"326y+ )#%@ y4x&F< . %# V)&  L P#x3[!&aB OCKE)`'&y <~#A*4SiDT+3s m8 ,M1j, c . 2Qm~  Oy@ g4 i N*,+7654&#372"3267>546##"54632326776#"546?27>327632767632#"&54>7y+ )#%@ 1p)5H $3 P#x3[!&aB OCKE)K2 Q#XM#) #A*4S $T;:*0j? 2Qm~  Oy@ 2*:v.$5-B1n[=,+626?>3232#"32>76#"5476#&"#"54632326776#"546?27>32#"54&#1\ &  08R    #Z![3LP#x3[!&aB OCKEW *#$8 );  !1% +   2Qm~  Oy@7)?,4SB"T* ,+6.#"#"54632326776#"546?27>32#"&54&#37276#"&54632327}P#x3[!&aB OGPH3M$#&Z<* u7"( +/=  2Qm~  Oy?%& Xw.(Kj ")b'"$C71,+7>32#"&54&#"&4623266#"&547676#"&54632327W09H3M!#1B+F"|2%;6.1 OT u7"( +/:X}%& H?\g"$1M08/  "(Kj ")b'YU>,+"3267>54767632#"&54>7654&##"&4623267>7>327632?f,)5H $3[Q2 Q#XM"' h"<7 "|2%;6.8+>sW*sT5$T;:*0j?/2*:v-%  K%*OW;a)o"$1Mi* 'YU>,+7632#"&5463232654&#"#"&547654&##"&4623267>7>327632n832327632#"/&#"#"&547654&##"&4623267>7>3276324#"326y4x&F< . %# V)&  "$G "|2%;6.8+=}Y^'&y <~iDT+3s m8 ,M1j, c .(V.*OW;a)o"$1Mi* g(,+#"&46232677>32#"&#"7>7672#"&#"#"&'#"&546232677>327>R- ! '! %5 "6[D;C6. ;'&J6(Q5LL>*)(D`<0B&HOV{% A5DSa- M+Lj0 E$1=yMJl5%BX1&eLp9-!a#Aka,+>7632332>7>7632332632#"&#"&#"#"'"&+"+.'&#"#"'.'&#"#"'.'.4656&67&#"2>767676'&4.326;26736323276&54>&7>76'&+"#"&#&54632327>7>7>326762767>&'./.'.'"&#"'&76767372;>76;2;67>'&'&#"&+"+&'.+"#"&#"#"&#"$6'.'&'&#"""26;326'.'.#3263676'&#"#"'.#"3276'.'.#@   l'!k$\?M,  ' - A"  ! 4      # "  #d0  U  ; # % /   %   3(. 6   $:;' ( 5@;&  #/ e 4*              &        G    9  %    '4+ '2 U:+6$$- %!`6 '`D     ,          "    !           X  N     0+o|up,+32654654#"#".'&#"'&47632326746."'.546232632#"547623254'.#"32632"'&54.'.54654&#"32632"3263232632#".'&'&54654&#"#"'&7>54&54656&32632#"&5465&"&#"#"&#"#"&54763267>7654.'.#"#"&54632#"54654"326323254&54>54#"'&6763232654&54"#"&54767"32654.E"*         ! 6"5N    "#   6 !     1  !   3'*  #3    %$  > '  A+hR4" $\1K2R -!! -(_   . U    $   "#)#  '^        : #&  $  .$ 2*9+';/80 A      #(pK  Z31 4 .!3* $ ' !! d,!A@, a#Aip+,+#"&#"#"&#"#"&+"##"'.'&6'.'&6'.6'.'&7>7>'&'&#"#"#"'&'.7>762;>72632;>763227>&7>76'.'.#"&#"#"'.'.'&#"#"'.'&+"#"&+"'.'&#"32676;27>76326323'.#"#2367>7>7>32632"#"&#.'&'.'#"326323;267>767>76;27654&'&654$4."&#"767>#"327676473227>&'.#"#"&#"232>7>&'&#"32>7>76'<.   0d#  " #      4 !  "B - '  ,M?2\$k!'l   H  G /#  &;@5 ( ';9#   6 .(#3   %  /  % %      *4               !:U 2' +4'    %  9    G     ' 6`!% -$$6+ !    "           ,      D`          X M     UI;,+32#"767>2"&76 E !b+|   ,+67>3#"'67>3#" $ & I $ $ &5  (5&5  ,1"dC ,+?#"?"76?"76?632?63272#72##"?F-FA<<' (.' *97E:9$ ".& $:9Svl jSg fh gS i h6l Vc aY=,+32576#"#"?6#.'&5&67632?6'&7>76?632#"&56'&3>76&'&/ !6! U>   E> K4 &!;!?$,  x( {  +G. 0  8 ", 77 >  - /;$). O !-7@ 3.'" ,+632#"&2#"&7>"26762#"&7>"2676Oq #B)% E-") &% #C)% F,"( &%  z A&.DC)*C9E;"YA&.DC)*C9 D;", g m P1 ,+?676&#"32?'.'%32>#"&/+.76?'.47>7327676'&43232632 %  )6>*($[      " )1 u ;!"@ ( L  $ . 4)$ & %1 . )J+ )  +$W/   $"; 8 > |   ,+67>3#"| $ $ &5  ,1=,+7>7632##"'.Iq2 1e  F&&FN"$,+7#"'&7>76&'&632. .s H$#HQ$Idm 8,,+'.67667672676'&'"&>5'&7)  K       H~'  ,+7;2+"#"?6+"76;2?>32{  o%'z  r y ~g pF ,+7.7>32#"'&763676&;  L<  *9 62f ,+7#"767>726 Y hf +m:,+62"&76I :  [ ,+632#" 3   _ 2AO  ,+2#"&47>"32765"i=%( l*E+3JC..Oi=Jp5N,Fk8V',+632#"&"#"767>?6'&67>    "&  .. ,'T,G&A   $Q4",+7&7>32;27632+&#"54?676&#"qW+#! 95 /.& %N&90 $B7&  0+2 :! (m7(22Q7),+"&7>3232>76&#"'&7>7>76&+'&7>322e  "  +2  B! % +n& $ 1%"* &8G$0O'3.(,+%"&#"#"?6&#"#"&767676732;272'2?6'&3' VKa: &g$>B\L \JZ2 Av6A51L/,+%#"&763276.'&76767632" N62g   '=3 6   ' |G'\ 8      7RT',+7>&#"#"767632#"&76767232   .J\65'VF`$DP 6`  "N1W>2[C6 *^=+1DhN,+6+"#&>?6;2#"767" |  (   .<BT :M M?, ,+732676'&#"7#"&7>76'&'&7>32'676&"$ % -; W*(.    I&#+   $(&  .2$,)   +9.'    & ''!  7!    ER-,+2#"767>7>76&#"327>7#"&7>-*_$d S  *   # \RF4SH493 &1'!  , ,K2 ,+62"&62"&6      ,+7.7>32#"'&763676&62"&6;  L<2   *9 6 6,+7+'&5>7%32h - hx xi8P" ,+7!2#!"76!2#!"76p     le,+%'&476;#"&767%63  ixxh= ",(# ,+2#"567>7>76&'"#"&7>2"&76$  " $'  UE$ % (  % 7xCoALFB,+"&7>32#"&7676'0#"&7>32?>3232676&#"3276"32676&^k#qZeY # ) h j >oXOd URnV 5lj ]reRM[ ** gb  S;I]iMrF  )-gU2 ,+;26=4"#"&#"#"&7676767>7>?67>32#"&+"#"&767>7674+"FV  ( (%Tj  *  % k E k  #v   !*# 1oCR MG; ,+%6'&#"326'6&'.76232632#"&+"#"&7676?327676#""!  "Db    %?1    $*6! +/ f % Jq7 ^ 5)0'  , %)O KU0*,+2'&76'.#"32767>36#"&7>_*  &:j/?"*HLD* bDIx " xSVv40* ,+%6&#"326326"#"&767>76&'.762;2632#".?A+$Q  ?q "S    JnJQ&5Fc  rf\Ux[@*,+7;27632#"56'&#";26767632#"&#"#"&767676&'.76322326;2#"54'&+":   #9$ &w &+ R  $T  K  + H/ - &   U?*,+"326327632#"56#"&"#""&#"#"&7676?6&'.76322326;2#"54'&#    .  "  +( M  "T o $ '  * JP'5 V?;5,+"54'.#"327676'.#"&763232632#"&7>32 (#Av4?#" "  (    P>RPS6,v'  nJHi0   $(yWUq 7g;,+%#"&#"#"&76767>76#&#""#"&#"#"&767>76&'.76322632332727676'.76232632 #( `P#$ %S  ( #^N  "  % <$ Yr #u+I# ,(,+6&'.76232632#"&#"#"&76767   $ "S *$ ,- J %%(*,+6&'.76232632+".767632767   % #* C% & K #Z 1  8 @d ,+.7632;2632#"&+"#"&7676/&"#"&#"#"&767>76&'.7623263232?6g 7*>LT  +   J  +R   $ "t  -B `. q X1#,+;276762#"&#"&767676&'.76232632W Q  (}M/ U  " *T3  #  CMJ,+&+"&7>76'&'.76;2?6;2+"&767>?#.G "g&O W  S WK  * !      &   g #S8,+2632#"'&'&#"#"&"#"&76767676'&'.763232327676&'.761S U(   ?   +L>     JP XV&'-4 += + V  ,+7>732#"&"3267>&VYLMXMO :]';8a .UwnWV{t aDMufB/U<8,+7"#"&7676?6&'.76232632#"'&?327676&#"#"&j-+ M    ,AA*,4 (.%"X#';;:H.1.Vk$0*% ,+.'.7>323276#"'&"32676&($3WP[3@* %   (C-H;k8C32#"&76&#"#"'&5&7632{#,   I6, 0   P:/   $+  (: " %%    +G6 =I>,+7+"&767676'&+"#"?67632;27632'"&6/&4.#" *- P  $    , E'  ''  4 f <,+#".?6'.7632326323267676'.763232632'l=47)  #  .(64N   H'vFZ5Y;$>\UI,S:v6 ,+#"'&'.76323263:2?6&'.763232632 + *  + ')8-+2 )% mq~G,+27>76&763232627676'.76322632#"'.'&#"5&'.76323263:376/.'.7632263:`      /\ "F0  &  N c'   + I'-* )zeLE  zrsUi],+%#"&+"#"&767>/&#"&+"#"&7676?6/.'.7632;26:?>'.7632;262w *  &k  ! * 4-a+  .  #V     #DX-Z h *^z%M U !>R*VL? ,+?6/&'.76323263:32767>'.763232632#"&#"#"&7676+ 5     &2B )$ -.AYs5 c7 5MY+@) ,+%67632#"&#"+"47567676'&#"#"76762323272324'%"q -0Z@-& $A+N  a)(8 C/_'-  i !E&,+32#"&#"32#'"&7>7>3d   #'1 )c   e4  %   ,+#"'4632 4  (,+32#"&7676326767676#"#"'&543 d+ ,&    # U   R~g RGj,++&'.'&#"&6761 ;3 Yjx; 3: ;3` ,+!2#!"76   O  ,+.7>32#" / P%2?=5#,+".#"#"&7>?>?6&#"?67>323276'3276?6&$L   -<& $o   ='    u% H+31. ,+76&#"326"&7676&'&6767323632#"' % 0  S "1%##,'b.q!> !F$09#7 xB/2Q,,+7>32&'.#"327632#"&,\1, . " ?$)#n5L  0)2 #C%h <* ,+7"326?6&"?#"&7>3232?6'&67>322633<0 /'[>  % O  %+2aI# @->JP+ %7 * (% ,+7;27676&#">;2#"27632#"&v! $gV3 !R " ,7(* e?A#- 1@a3(,+;2+""+"&7676?"'&6767>32#".#" ; - (  ` - i/! " 8  dZ (n&,7E A92-& ,+&76767.7>323"#"'#"&7>7"3276&32676'&'#"4#     G)&! J'97 _4*7 Cy# , B 0!%   ),*= 0A 3&;!,%(<-,+%+"&7676?6&#"+"&767676'&676732632  ]    \X / 1) 1 h e !&(i$  m .-,+>32#"#"&"#*.7676767676'&463676   (     2B3O 8('o *(# ,+76'&67>?23#"&7676767>32#"c !!*< W  % \0"0EK 9O(,+3#"&7>/&"+"&767676&'&67673232767>'&76;2d#,  T X ;<" N3   J   #(    " =  *" ,+73+"&7672>76&'476732g  ` X  =/  # &aM,+%3+"&7676?6&#"+"&7676?6&#"+"&7676?>&'47>724326327>32  Z    Y     X" 8-(5 -  e! d  e! d   q   *% % -;.,+%+"&7676?6&#"+"&7676?6'&4636732632  ]  \$ +" <+ 2 _ ^ u% (%7  ,+72#"&7>"3276&+-W8-*\( 3 E.5L?35M1%';V%=s2 91,+72676&#"6&'>56732632#"&#"+"&7676> " ZO .  2+* d4  ] 6&++ )5y#'B+3NS  1rNE=-,+7"327>76&>?6'"+"&7>32>7632#"&"#"& 7$ i(,//`? R   //3.    U;2=J 3   ,,+7+"&7676?6'4676732767632#"&#"  c# 7 % *\ q& %  5(,+7"#"&'&76232676'.7>;2#"&76&     <0 $ 9"   &     '  -*/&,+7&676763;+""3276#"&?6&#"D$ 90  .)!,4  h  69B,+232676##'>7#"&?6'&7636763276?6./.763>1 "  .55 !4   p&&*# l  %d X  IF&,+7&76;2#"5'&'&76;2?> H   S C     f d OC,+%#"5'4#"5'4'&76;2?6'.76;232?6'&76;2d   X 7 W  <  C    h S%    ^ V  +P3,+7&'&6;2632>?65&7>;22+"&7>/&+"&7>?>7i  .!  @5   Y $2  == !  9U  1 2  9 pL1 ,+7&76;237>'&76;2#"&7672327676/&X  Y  =   H /   aW     F  74,+73272;2>7632+"&767676+"#"47676328<   WM 4   3  [V  , BM1! ,+732#"&7>76'&74767>7>32#"i $! 1= 3@  U1!7  6/B ('D10D')B)  ,+>32#"7| 0#,+76#.7>76&#"&76321#"763267>7> $  0? 3?  V1 !6  = )B )'D11D'( B/~ ,+>323267632#"&#"'&[T!H_]G"D0J0! (LZ  ,+72#"7>7"&7>32l- o)]' c)jW1 l5[UB,+2#"'&#"#"&7676327>.'&7>7>. 54 67676&%$ *D( **HM   '1:8+_C      )"%8\6l@3E2U)   R  %aS=S(1N  ,6O0  ,6Oc!.:82,+32?6#"&54>32#"&#"#"&54632#"&"6&#"32.;Ff7^mK' Pr /+*'7 7/+d&__{A,+232632#"&#"#"7>47>76&#"#"&>32327>7>  1  N" C  2# *L  A { a ##,+Jd1/L{L8 + !^!8vlP,+%32632#"&#"#"7>76#"#"76323276&7>?6&5>76&#"#"&7>32327647>3232632"&#"(*L  @   ! + K! @ ' *M  @  * P 0D & , !> M ##-.5.- !#/+/+P'm^m/+/+VMV /+SV /+f=N /+NO /+EP /+raQ /+fAR /+S /+NNT /+8_U /+}8[^V /+xGW /+X /+`Y /+HQZ /+[ /+G\ /+] /+^ /+ _ /+ ` /+a /+b /+ c /+d /+ e /+ f /+-g /+`#h /+ i /+j /+k /+El /+0'm /+ Nn /+Bo /+IFp /+[Cq /+@r /+@s /+WFt /+@u /+@v /+S]@w /+vAx /+@y /+Az /+C{ /+^F| /+ B} /+#wE~ /+B /+D /+PX /+@ /+v@ /+@ /+B /+S@ /+DI /+>] /+cG /+|>] /+b" /+hKi /+_F /+} /+c /+ /+a /+ /+a /+j& /+c /+M% /+]'Z9 /+c /+ca /+8 /+ /+ /+a+ /+* /+ /+d /+c /+ /+ /+R /+ /+q( /+ /+\e /+L^G /+\e /+ 6 /+Q /+$`8 /+|h /+' Pð/+/+'  /+/++{&C~3 /+B. /+\e S@zp A w* +M mz 2&x2e -ll>D!K>K`FM/nmu52l 5!Fp"O]*#O&'8 (X)*+8 ,-.Pv/01w23845(678B;9}:z;z<x=]t>  ?35>A ?5@3[AJ|BWCO KF ,+?6?6#"#"&"#"547>?6&"#"&#"#"54767>327>32ۉ O(EK #>(>$%"  o >  5O%6Q4   j v!!  "R B   K&   7C @:&,+72654&#"2632#"&#"#"5476?6&'&543232654&#"<\E- (73TCH% &+1PT-2I$NN "8  ;X1#. 83)44-)8 ?)&9  ;#  .0!&8 /*,+"&5463232632#"76'&#"327632&#" U2"  /b_;62#$ bN 6,/g:ML ^X+'!,+"&#"#"5476?6&'&54322632'32654&#"BH$NN ". 1n 7ddH  ;# WUf,^HK&_*,+72>7632'&"#"5476?6&'&5432;2>32#"5<.+"3767>32#"54'&#"&" M"4  ( IH$NN "=    , i  L T > ;#  "    AW",+7#"&#"#"5476?6&'&5432;2>32#"5<.+"3767>32#"54'&#"&" $>H$NN "=    , i  L a!!  ;#  "    A8 ?+%,+"326?6&'&543232632#"&5463232632#"76'&naS;,!8 #     i$Sy2"  c;U!:  "G  kOy 6,/V2,+#"&#"#"547>?#"&#"#"5476?6&'&543232632%76&'&543232632nN #><$$" #! !4H$NN "=/%$ " ! 39%&']!!  #pk#  ;#  %oj#  ',+#"&#"#"5476?6&'&54322632N #>H$NN "=&9%&']!!  ;#  Pv),+76&'&543232632#"&5463232>Ui "=.%# ND0?(#   T#  %L. '4"Z.,+%#"&+"547>/&#"#"&#"#"5476?6&'&54323263232?6&'&543232632;H$ Z!><H$NN "=*%  2 + %<' d   k<   ;#   #X'u    n )0 ,+%2>7632'$#"#"5476?6&'&54322632W(%  H$NN "=&9%&( P. ! D ;#  "5waU,+7#"&#"#"547>?6&'&543232327>32632#"&#"#"5476?6#"#"74>.#"-+ 4 ;% () }/    I%&' N #>H$NEsN        "!!  ;< RO@,+232?6&'&54322632+".'&#"#"&#"#"5476?6'&'&5432 B !--%&' N : G.K ;%C^ 1 T #  ""  G   J 8  ,+2#"&546"32>54&cJmJlsAc-@.1R2@XAbHy$]E.B;\j3)64!,+#"&#"#"5476?6&'&543232632#"547>54&#"#W #>H$NN "+? BeW!@\5(!!  ;# C9LX B8+@ + :,,+"32654&6'.5463232762#".#"#"5476[_rR1Fp<CZzIhoe14!,-. J-#XFX#F ik1Bb.CW ]BwdG]~3 y (,4- F.,+%2654&#"#"&#"#"5476?6&'&54327263232"/&#"1b."/  #>H$NN "2 > AXDD (3/%C3#2 )W!!  ;# --:<  U2 Cd!F2,+72654.'.5463232632#"54&#"#".#"#"54>7632&7 )$%_?.  9'!1$nI5 A0% 4$9C &9'*1>E 2"(3B;G*,+#"&#"#"547676&+"#"&7>76323!2632"5<.+"hZ #>H$NZ O+  Z   U!!  ;# "   K P   }6,+#"&?6&'&54323263232?6&'&543226326=YGY7 ' 2%188y7+  ,+%"rVagN#   GZ-  z<,+6'&543232632##"54>76&'&543232632327!. ' D %? 072 #6*%-,s)   #)!# !   3zh*,+26323276'&543232632#"54>76&##"54>76&'&5432326323276'&5432.%-,!. ' D %? 8,072 6*%-,!. > 3  )   $!# )!# !   3 )  xZ ,+76'&54;2632#"&+"5476/&#"&#"#"&7676?6/.'&543232632uY=0 %?s+,;H$ 9 5O !EDb)!$;3% .Z  !t  !]9!    Dc~  'P]tG7%,+.'&5432326322?>&'&543232632#"&#"#"5476?6' 6 #%& ^   3 D %J ^5 $>H$N a   4W ^   %^5c!!  ;T  A1,+732>7632#"&#"#"54>76'#"#"&7>7632;2632)#  1@  B- #< %  D  @7   K"' gf^d_f`2~a?6&"#"&#"#"&767676/&5432;2>32#"5<.+"3767>32#"54'&#"&"2>7632'& O(B?$%"  o > 5O !6Q4 $X    , i  L " M"4  ( Yj v "R B    K&   "    Ap > 8 &m(' 3*/+' e*/+' */+ ' */+' ./+' ./+' ./+' ./+X& )'3/+8' /4/+8' a4/+8' 4/+8'4/+8'  4/+2E6& 4}' Y:/+}' :/+}' -:/+}' 4:/+]t' v>/+<,+7#"&#"#"5476?6&'&54322632632#"547>54&#" #>H$NN "=&9%B $ =\}Q!/+`/+`' &/+/+' &/+OO'&8 /+8 ' m(/+8 /+8 ' (/+8 /+8 ' b(/+8 _/+8' N( _/+X' X _/+X _/+XX`/+`' */+/+' */+/+' Z*/+/+'*/+ _/+' F* _/+8 /+8 ' ,/+8 /+8 ' ,/+8 /+8 ' V,/+8 ' 8 /+' Q-/+& -/+'./+`/+`' ./+/+' ./+&.'  /+.P'GP'/G.Pv/+Pv' //+'00/+' 1/+'1 /+' t(1 /+gWC9:1& 1/+' 3/+'3 _/+' x3 _/+338`/+8`' 4/+8/+8' 4/+8484' .488Yhb[UO,+32>32#"5<.+"3767>32#"54'&#"&"2>7632'&"#"&54632&#"326?6    , i  L " M"4  ( I!##Jl{,Ac-@.$6 N  "    Ap >bHy3]E.B($%/+' [7/+'7 _/+' <7 _/+/+' 18/+/+' 8/+&68 _/+' 8 _/+B;B;&:9B;' . _/+B; _/+B; B;& 9} /+}':/+}` /+}`' *:/+} /+}'  :/+} /+}' N:/+} }' X:} }':z /+z' </+]t /+]t' >/+]t/+   /+  ' J?/+   /+  ' ??/+    _/+  ' +? _/+8U"3C@ V;42)! ,+654&#3727632776#%2?654#3"3267>5476#"#"'#"54632326776#"546?27>3276327632?632#"&54>*$4%"P&!n%a ( C7' nf,)5H $3& P59B/342[!&aB OBLE:EC)Q2 Q#XM"'D+BA \^E 2 ).KD%%T5$T;:*0j?  =^3! =2Qm~  Gj7> 2*:v-%(;U"3 @ q2)! ,+654&#3727632776#%2?654#37632#"&5463232654&#"#"&5476#"#"'#"54632326776#"546?27>327>327632*$4%"P&!n%a + C:)1 w8&#"#"'#"54632326776#"546?27>327632#"&54&#"327>32#"&54632327*$4%"P&!n%a P59B/342[!&aB OBLE:CA3M) 6! e-1u7"( +/D+BA \^E _ !   =^3! =2Qm~  Gj7<%& !,H.$(Kj ")bU"@ \2! ,+654&#3727632776#%"#"'#"54632326776#"546?27>327632763267>32327632#"/&#"#"&5476?654#3724#"326*$4%"P&!n%aP59B/342[!&aB OBLE:EC)y4x&F< . %# V)&  T( C;)'&y <~D+BA \^E   =^3! =2Qm~  Gj7> iDT+3s m8 ,M1j, c . 1%)/IH"DgU" S/ ,+654&#37276"32776#"#"'#"54632326776#"546?27>327632#"54#3626?>3232#"32>76#"5476#*$4%"P&!n%aq$P59B/342[!&aB OBLE:EDW A 9( f &  08R    #Z![D+BA\^E =^3! =2Qm~  Gj7>7)-/OD& );  !1% + F&z vW,+654#"3267676"3267>54?632#"&54>7654##"&'#"&54623267677>327>327632@N-AN#!%R R%f,)5H $3[Q2 Q#XM"' h<$N9C'25=,. ;'&J6&S:7D@&7(D)`w) REa/EaT5$T;:*0j?/2*:v-%  K21X,=^4  E$16e @t" F{wX,+654#"3267676%7632#"&5463232654&#"#"&547654&##"&'#"&54623267677>327>327632@N-AN#!%R R%^n877672#"&54&#"&'#"&546232677>327>6#"&547676#"&54632327"(?+E! Q5%3M!#1B+E;C6. ;'&J6(Q57D:&9 1 OT u7"( +/D4,\py{% A5Ma%& H?\xuLj0 E$1=yMt"N08/  "(Kj ")bF} yZ,+654#"3267676%67>32327632#"/&#"#"&547654##"&'#"&54623267677>327>3276324#"326@N-AN#!%R R%\y4x&F< . %# V)&  >$N9C'25=,. ;'&J6&S:7D@&7(`'&y <~D)`w) REa/EaiDT+3s m8 ,M1j, c .31X,=^4  E$16e @t" gFj,+654&#"32>7767232#"32>76#"5476#'&54>;26?654.##"&'#"&546232677>3276"(?+E! Q5%e 9 08R    #Z!Z( $ 9#K+C!;C6. ;'&J6(Q57D:ED4,\py{% A5MaI Ex  !1% +    &%N6]pLj0 E$1=yMt>7Y7YBXH ,+27>32#"&546328# G1(?  5-4("H,+46323267632#"&$&5  X>*@$  (% 6=35(3KD4 ,+7>327>3232#"54>4&#!"#"54654326!2>7>&#"    <9 $1U y !p l  @b$./1iC' ~  !l #,PK,+"32654&';2#"&'#"&767>7>&#"#"&#"#"&76767>327>326  2H^FaNEbhcr !2y !p ;M !F: C+WU& ^E8O;WGSt  +~  !l#  9  >,+27632654.'&7>32#"&4676.'&#"#"&5467632 /Y)D! zQQ'119 ,"Z "&"#m  "5 ,Q ! &!}^=bdS+ Ik0,+73>54"#"547632#"&7>54#"#"547632 l 12,$O  "+<" -. 1 "GN9+]!?K 9I)6w^,+32654.'&7>32#"&'&#"&4676&'&#"#"&5467632327632676767632& )'D! zQQ- GI'119 5Z "&"y /Y)>M b J#Q ! &!}^'" J=bdS + I  "5 ,_GC2 R\WSI,+%#"&4676.'&#"#"&54676323276327&5&63232654.'&7>32#"7654&#"eX1'119 ,"Z "&"#m /Y)*8m20,B/D! zQQNd ?1?=bdS+ I  "5 ,%f9ESN.Q ! &!}^_Yp*&&R),+%#"&7>54#"#"5476323>54"#"47623>54#"#"547632#"&7676'&2#>Q  "+<" l! 1 g 1253Q 4H`"=K 9I)6w-. 1I)6w-, 1 ,iF=`2% H9 ,+?6?>&#"26767632#"&#"#"7>7>?6&"#"&54632 j 6XWrtYL *' uf &93:zGY\&$ b   Ew`O'/8    $, C=oV-&%.dBP HC$ ,+"326542#"&#"#"547>76&'&#"#"&5462654&#" " &Ot}u7C'l~<G$'.  /fJB#".϶Cw.8/ WF#ULDJT)='Wn "")!<#9 @(alZ725%P0,+"&546323262#"&76'&#"327632&#"pt$B'*  DƊTNH 8 5n U  E#Uxtd 9 ,+4&#"3262#"&#"#"547>76.'&#"#"&5461` 2SRxE+=$,! J#".^*B7632#"&#"#"547676&'.76Q    :'   f3:!9  N(L$Z #  / .  $ 7D S D ;#  T%,+7#"&#"#"547>76&'&54323!2?2#"&54'&+"3767632#"54&'&#"9H$%$ #Q     :'   fq  %#  . .  $ 7D oR>,+"4>323262#"&76'&#"326?6.#"543276#"&54632326?6#"m}k$B'*  D9yb?hO/J'Ny  (5%D&?E*5 K (2 W ir U  E#?gKZ- l 2!7%>6K  +c:,+%#"&#"#"&7676?6#!"#"&#"#"&767>76&'.76226323!2?6'.763232632  49  D:9  >;  $  63"8  C:Y:: =,  " d$"   < -  %"   ; :   !&,,+6&'.763232632#"&#"#"&767674 ! =9  &( # =H  N&#  "<"!  <8* ,+276&'.763232632#"&7>32=1 ! </ # }5?G+-  '#  $gbwB# od,+32654&5462#"&'."#""&#"#"&767>76&'.7632326322?>'.76;2632 &(L2J7632#"$#"#"5476 " ;F  :!9  S'L$Zc$   :S D u`D,+#"&#"#"547>7>"#"76#"#"&#"#"547>76&'.5463232327>32632 ! XF#,1 C( F,#045%   )X#LG#,  $#o 53/p)  &2$1   ) 8R;$,+2632+"&'&#"#"&"#"547>76/&'.54332327676'&543GM%') I  m-=&;2# ! J_& ZY !"32>54&aarcdk_DaDHxI)a]wЃcs{$hDaXM>Rd<+,+"#"&54!2#"547>54&#"#"&#"#"547>76&n "'4f*TzN;;.J$&+  tI9 D+Tb_{ \I?`#K   "#C'" \Y",+&#"3232654632#".'#"&54>32>54&#"32654&54632#"&54>32Q]9YN"EKrYA i>T$ ]B,i)l(,HUz@sbOvDNE>vM/Y6D'"w1D;X[VL'2+CyfSS9&F'!< %:T4i9C,(0K$11m}@Y\@[]s"4'4mWW5"R`M3fdSa\V,+232654&5462#".'.#"#"&#"#"547>76&#"#"&5432654&#"2HS4#m6Ewp3-d K   "#C'I9 D+ `L8T Q>,+72654.'.546323632#".<54&#"#"&#"#"54>7632/N $33wQJ    =.+?63ZS (  K@( !( 9P'Mg# #44P5(A': 7 ;NZ+H"'9T6A$,+%#"&#"#"&767676'&+"#"?676323!27>3#"76&#"|E =I !M G,9 % 6w$)  +]"f@  @''& 2=   L ))i;,+#".?6'.7632326323267676'.763232632_'dW\E(  :2 !&NCYV%'" * 3 !.# uXc<    (gyIb     fG&,+23263232>54&54632#"&547>76'&#"&#"#".4>o$N K?  J;jf30 BwiQp8): - u!)A8  54&#"&54>3232>54&54632#"'#"&547>76'&#"&#"#".4>323263232sCL .E.?wHcT&2^?.0 0]aI1ZgJd8): - u!)A8  a4!fT0|dp .D(iƧe</&#"&#"#"&767>?6/.'.76323263232?>'.7632N !*r L3  `C "% 3   :S " ]% I - ]A !-   2 hE  * "  4#" "3   ? 9  PC ,+%76/.'.76323263227676&'.763232632#"&#"#"&7676- :+  I2 "4 #B6 1E  I- ! >H  Ml#'D   &&HC6   7 !?"+  C@!,+"+"&?6776'&#"#"&>7676323327232767632#"&KHMFBEG;)  90WphQۨ+=:KPB = 8MK!"  B-Qں^ p"a< ,+6.'&763232632#"&676'.763232632327  I\ ![4(* B8  ^M !5* y !%   38(+ Y     )  !ae ,+6.'&763232632#"&67#"&676'.763232632327654&'.6322632327  I\ ![48!B* B8  ^M !5* y !l SR,&1 y%   38!+(+ Y     )  !t  $#  !"\R\WSH,+32>54&5432#"'&'#"&54>32654&"32654&54632#"&54>32"3267&Pf=tL.$.~V¼r",He7XQZ;)2='"xj2^9V[+NH*G|Ye0RD7)- T,[8E9j=J,()L*\lfO:7 '4Zn]3#Q`L4'J3Mo ]&C0&R,+"'&'&54632 U- , *# @&   =:(/ ,+"54?632#"&'&|" H >  RR (74,+"&#"#"5463232632 b )> _ ' 8'6&7" ,+32+"&546   4,+632#"&54632326 bB!2  :(256& )i' ,+2#"&546C%$'%&,  ,+2#"&54632#"&546?#""" "$"$ L  ,+32654&#"72#"&54648*:(+:('>&6&49R'  (7 ,+2#"/&543276|! H > 6 RR (7.R' P P% Pl l/+;i U /+B, V /+  W` `/+ ,+4673#"&5463232654&@L-U;V!&  ! ;dNC& H!=1 =,+&54733267>4)CI'  >.zp.[<   T/( Yw w/+/( Q /+= T{ {/+9 w w/+# Rq q/+Y" S /+`R ,+2#"&546>! R"$ f  ,+32654&#"72#"&5462 ! !IA+B  <)6(3l ,+#"547>7632) t"H & :/ ,+32+"546W    b,+&'&54632#""q &  >  ^ ,+#"54?632#"/&o o. * 13 G O ..^ ,+7632#"'&5432o j. * 13 G O .Tv ,+.54632#"8 4$(7;  v ,+"4767632)* X"  ^ ,+#"54767632#"'.'&~".  F    ,  &F5$, e,+67632#"'.5432TP :5   < A+ 8' 1) ,+"5463232632#"&#"G R #D X ( <! ? I)I ,+3267>32#"&54632p"4   [82/ .7!bg ,+67>32#"54h(  $K#F& 2bdN[TO-%,+263232654&#"327632#".54>32#"&5467>&#"#"&54>32"32>54&;_fn^ȇh -L|Ddtu|l^*8L>x, "tWg+ -czpt .<+]f{لV?[ 0>J&*r}BHWc\XN ,+27654&5467632654'&#"#"&546323264&5432#"'.#".'&>"327654&(1j&E-OdN^O#""g;4 ( $@"4 ^g$FA*Km-H v #  , !p9eoAKK& 4+["! " &9 hl.T7K_>r:v ,1&eL &61,+%3>54"#"547632#"&7654&#"#"54&467>32_l 12,$Q3TO9#h/Tf -. 1 "GN9+Ezj ,r`7Y*6D=7",+.547>323267632#".#""&54>7676"32>54&=]1ʐW`eml"='I.)w @.N/V7** f@fEB6b5wQ,1sjsHM$ A%D xaTiSImTb [U& ,+654#"#"&5476"#"&5467>3276323267&54632#"&546323276/%"32>54&,W* ]l3 Z9   g Cb#[l?&(r[ !|`. rO$WgO LA & p="6U +] 359P #<1/h& y *W7BL KE<8 ,+%#"&54>2#"3267&54632#"&546322676'5'"32>544&#"6Y0!4>{@ 2!JX!Tv@%2&cDE  )R|;5?n?6P $;MtD$6U .Y 358Q ##1/k5$ (!01e JV PK ,+654&#""54?6#"&5476763267&54632#"&546322676/&52#"&546( * H1 OT g CX!Uv@%2T! . #08/ q?&6U .X 358Q ##1/Ns"%: f) ,+654&#""&7676&#"&?>&#"&547>3227>76323267&54632#"&546322676'&4'( =  qu( Z B "` y  S:  sCX!Uv@%2X. #$ |e2  ;.;V< 'm>&6U -X 358Q ##1/PiE,+#"&#"#"&#"#"&546322676'&5467&'.54632327>3232>32#"/"#"547>76#"&'&767674&#"32>!(I"+A)! yA&2 J' gA(B* "38 ',BXx1 : +ZN $5 .;"%= 68(g,&N4 ! ;358Q ##1/;.L $)9S G=DV!  6   w'< )*Dev}xbB,+#"&#"#"&#"#"&546322676'&5467&'.54632327>3267>32327632#"/&#"#"&5474#"3265 M)9,! yA&2 J' ^@H * "3l4x&F< . %# V)&  L'&y <~g,&H? ! ;358Q ##1/;.L $):R DT+3s m8 ,M1j, c .g'gt @ {vnhO),+27654&#""#"#"&54>767>'&54>7>'.5&632727>2765432#"."32>'&&32'&'&+b4&!- C/#$ ]Z8Fv;1($  ,J% 16/H"V k;V&!30!@#o@tj= (-<#)=1,   "   7H  Kn\MPi"$r'6Wi"3-*6 .H*9   @ N' ,+"326'&&32'&'&%&5467>'.5&6323>32#"&#"#"#"'&'##"&54>767>'&54>7>'.5&6323>32+"#"32>5."32>'&.0Uo@tj/+ ,J%6 .C/#$  A4e9 5Fv;1($  ,K%A W@/#$ ]#xE")ND0!@#s"%h&6837*6 .H*9 '   7H .-'& !|3;=1,   "   7G .+o<'= <%"$r'6Wi"3e'Wcr~@ xsje^XQ(,+2676#"#"#"".54>767>'&54>7>'.5&63272>76"326'&&3254.'&2#"&546-G LcC/#$ ]T+;1($  ,K% h,Q4 B.0U}Bb((! 9)0 +s<!& 0,&,   "   7G   "(Nn"&c&683;*6/H)"%Q_XR@(,+267654.#"#"546322765432#".#""547676'.547>32"32>54&UKj $ D#' "V p~i9^{6&&!_0Fx1ʐW`eDWC !dW{J@fEB6b5*5U4#--P!!n\/:/ &/~R,1sjsH0*.1)`xaTiSIm( Qc c/+- <4 ,+4'&#"326'.5467>367632#"&54676F 8v8v>$7'89HI#e , !)%?a5"=wY0$ L((+)@  6(2D&.k^?A5Z2_/#/)$ ,+?6#"&54767632>7632#"542#'"546=H1 OT g 7 %*c  L08/  % 3N#   9,$,+73267654#"76&#"&5467>3232?632#"&54323267^%w+9%u` tu$T?&_%!  !d);#<#LQ"='`9JX.o #=C)0  +bn4#""]]:.@LFA,+%676&#"&?>&#"&547>3227>763232>7632#"&32+"546=  qu( Z B "` y  S:  s4!  [N  $$ |e2  ;.;V< '!  n#  :.Wc]X,+%6&#"&?>&#"&547>3227>76227>763232>7632#"&7676&#"&7!2#!"546h qu( Z B "` y  S: " t  S:  s4!  [N=  qu( ~   |e2  ;.;V<V< '!  n#$ |e2  :]Wc]X,+%6&#"&?>&#"&547>3227>76227>763232>7632#"&7676&#"&7!2#!"546h qu( Z B "` y  S: " t  S:  s4!  [N=  qu( ~   |e2  ;.;V<V< '!  n#$ |e2  2j 1= 72-,+"476763276#"&54767632>7632#"542#'"546. YH1 OT g 7 %*c  ?;U m08/  % 3N#    p  ,+2#"&54632#"&546B! ! p"$"$G ,+.7>32#"767>76& #' ]&. 8 8).K )!_ ,+""&7>32'(&/ K#8!) I2)8  }G ,+.7>32#"767>76& #' ]&. 8 8).K )!_ ,+""&7>32'(&/ K#8!) I2)8  T ,+&54632#"8. (H5   ,+"4767632). Y;U m T ,+&54632#"8. (H5   ,+"4767632). Y;U mN!,+632#"&547654#"#"&54c*)!H "!  /%     Q,+"547632#"&54654&#" &+/  0      * *,+4767632#".(  )3? + * ,+#"'&'&54632 ?3)  (. +6,+"&#"#"&5463232632 ` # < \ %8 ) ? '=  p  ,+2#"&54632#"&546B! ! p"$"$P6/ ,+#"767672X |>y654P6/ P6/ FA"} ,+!2#!"&76kY}  0jE{ ,+!2#!"&76 {  *jE{ ,+!2#!"&76 {  * T ,+&54632#"8. (H5   ,+"4767632). Y;U m  ,+#"54767632#"'&'&(5 4-$   :)3  J4*l <B ,+32+"546"  B  Nn ,+327632#"&54632uB Q8.Y= 5I)) de ,+2#"&546B! e"%O! ,+632#"&767676&#"#"'&76b*)" :     %     !  ,+32654&#"72#"&546F'"IJ&I0-,H1?!*C &o _ _/+ },+#"54632#"'&#"? Z/#%-H ;E-")F,+463232#"&o2'<!!32#"767>76& #' ]&. 8 8).K )!_ ,+""&7>32'(&/ K#8!) I2)8 G ,+.7>32#"767>76& #' ]&. 8 8).K )!R,+"54767632 #* , -U:=   &@O! ,+632#"&767676&#"#"'&76b*)" :     %     *W' } 5 (3;C @ @<840+,+"5436=4'"&63632"#"'&#"#74&#"326&2"&46"264k      + O  Z?X??X+3H33H6dy/+72 ,+'4632#"&***((#yU||/+1Q,+4632#"547654 A-"?;/   ,+&54632#"5467>4D, !h$0G%,bg ,+67>32#"54h,/1$K#T8uN1,+%76.#"#"&#"#"5476?>3232#".#"#"54>763232654&#"&$D{2 (H$N."i[f-6kG+ 4$ 7C9g>"!  ;mi j >,?K 2"%69 3D 6$/)% ,+%4'&54632#".54632#"32>%"32>54# ܐAum@dJ@:df<8~^L&cDE$ !4*R9W?6P3G#+Uk5$ .K7N.f' lv /+7\' m| |/+.\' m| |/+.k' /+.X' /+7r' i /+V D:#,+"32654&3232654&54632#".#"#"547676'.54632[_rR1Fp<  LL} NN!C+!dmCZzIhoe/4k1Bb.C/;F;8"" +#HZ;F;. ]BwdG]~3[7,+6&'&543232632#"5476&'&543232632327  ' J %8 7 V #6*%(Ms   % 5!!  3[_(,+26323276&'&543232632#"54?6&#"5476&'&54323263232?654'&5432 $J %E M  ' J %8 7 :  7 V #6*%'M)#  )    % 5   % 5!!  3 V [ [ 8 8.& ,+#"&5463232654&54632#"'"32>54& Jl{*+:1)1G) Ac-@.1R2@jbHy  &,@1]E.B;\j3)6}A }AB9,+#"&?6&'&54323263232?6&'&543232>54&546326=YGY7 ' 2%188y7+  , ")1D,rVagN#   GZ-   &*: ,+4673"&543232654&GG+U4I>!   4dNC& H!=0  Bd,+&54733267>)CI'  >.zp.[<   T=a ,+!2#!"&7>a   Td; ,+32+"7>n ;  6,+&54733267>u)CI'  >.zp.[<   T,+&54733267>)CI'  >.zp.[<   T ,+&54733267>J)CI'  >.zp.[<   T,+&54733267>>)CI'  >.zp.[<   TW,+>232>7632#"547+W 7 %+  * % 3N#$U$,+7#"547>7>76J+ 8W2/  "2<Bd  ,+2#"&546!2#"&546|""$"""$"$d  ,+2#"&546!2#"&546""#""$"$dc ,+732+"46   6 ,+#"&547632l     d3Y ,+!2#!"46D  Y Ng2 ,+7#"54?632]   e w ,+7!2#!"46   κf_< hh"OY{B"Yd l!M\Syl#^$SmN22r -RX!ZoN5N2N5<FpOPn`m bsO{k 3Y:  {spSSW|W0,AU1=>*m*)Um.1Q7277-(1:7\7}YgdY28}YA?dr+KeX2P+"N2KhK2SkkRkGM%n`mmmmssss3YYYYYXmYSWfX>m*m*m*m*1111-7-----N2-BBBBn`>*n`>*n`>*n`>*mm*mm*mm*mmmm*bmbmbmbm..s1s1s1ss11O{Q7k 2k k 2k 2k 237363773Y-Y-Y-Y\((    {j{s1{s1BBBBBBS\7SWSW|}|}|}F Y-:[$c  2r7s1Y-BBBBB%bm7YY}Qcbm37%Y-mm*mm*s1s1Y-Y-((BB {s.mmY-Y-Y-Y-SWQ\F)R*S15J0W8}4\]1|3 s pnZlXL N O!   " ! N ,i  (", 9hms; P=m|s3RY5: 0{sULs21G5+ L21 :G5++ 3;Z% \#_~Q:#99LA-|>*-" L\#L-"i7V!t"~mmd=n` ssO{db )UP=m!Y5: n`{sb UV_FVU!#!Jm*GBBi-7>*7f:#::i--r0m*m*.Jr(11QLK.BBpp=SWs%mm*!G}BBY-WW!rb b b V_#Vi-%PmbsO{k 3Y: {sS{("}0.^X*'. |1(B7~|-d`}P=PPn`>mm*mm*mmmmmm )Ubm....ss177k k k k 777373733Y-Y-Y-Y-: : (     {s1{s{c{M@'BBp77S\7S\7S\7S\7S\7SW|}|}|}.1\7F!mm!mm*mm*mm*mm*mm*mm*mm!s1s1Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-BBBBBBBSWSWSWSW2121212121212121G5G5G5G5G5G5mmmmmm++++++++ xussss\#\#\#\#\#\#LLLLLLLL-"-"-"-"-"-"-"-"=5;;;;>42121G5G5++ \#\#LL-"-"22222222++++++++t||JJ-"-"-"-"-"-"-"-"++ff212121212121Hl++++mm ssssLLLL~~LL: -9-"-"-"-";;Li/[ //PPFjqjBjdyy8Ifi\\\7)F=F<\ ]N2X2N2#w$4XN2X2N2#w$ wn8)))^))2)R|Lspp1pvp Ok n`111177u7Z7e1eJ2>*72'2'2'2*.2*2222X2X2r rhd|d|2N2DDN5N"hvh3www)wwwwwwQwwAww{wwwGw=www)/!1\{F{ 7 w wwHwwww?wYwFtwCw:wCwwwww[wdw9wwwwww@,@- 522Qp00QBB4BB"(*YFFFFFsW/H/O)AM6T eF_*^sY1,USd'13ReV2A0\D]bR444BB''''Z(#(B1p@-0@,3U;|"6O,s|=RmiH2+ 282$57D< 2H6i8H=(7{AwU@ V|G  V:V &QIftvmYV[!-R.%+, %*  7:1 -6IO B(rc@*d8P0) #~PA,,,,,, , ,,,b  bS q)qF*{I*j*0IJSA*\E*E`?9LFL5 AhE # 0WJ7q8s 0x)~LQ`,,,o,,{,,,,,vQbblSWq\hq^Fcri"i{cI[bjhh0|SUhyKEE7{?9{f9L^b,Fa]ZL[5A0h_mE Z0@bsR~kJq^0)~},,,,,,,,,,bbSqqFS{Ij0S|EEh?9jL]FL5AahE 0q Jq&\5Sz;w<TmN22 -!t!wN5N2N5cFOY8K8GN1{ 8)BC}z@z5] u3Ar3Y8K8GN1{ 8)BC}z@z5] ugdu2<YEkd+KeX2PQ+"N2~Jh5K2cRYYYYYY' 8GGGG\{ 8 8 8 8 8Xq 63}3}3}3}]/>YYYYYY' 8GGGG\{ 8 8 8 8 8N2 6C}C}C}C}]]+Y+YY88888888KKi88888888]]AGAGAGAGGA]] N {{w{w{w{www]8 8]8 8]8 8]88#)#)#)uuuuBBBBBB3}C}=}C}3}C}3}C}3}C}3}C}z@z]]]      UUUUUFFFFF77BR *doPldXo +&; P8nd"Rd H$ aga"   : . IbQ2Bs1 7V*1:-2:::2 N PPPFjqj N O! O\*Q51Qb`-6.7.7...74[S[4[S[ 8 8S}S}T6 UBd6dNw0000d X ( ,  L \TLXp\t "<#%&'\( )*h,../\013,4x5<6p8 9`:X;\;<@==h=>?@@ABBEFH@HXHpJKMNOPRSTUVWXZ4[H]L^,^p_L__`Xa@e egh@iik llm$mpoho|opqss(t@u8u|uvtw8wdy|t4Ld|4L ,D\< $<Tl,D\t(@Xp0H`x,D\t(@X| $H`x,Ph,D\tx D\t $<Tl D\t(@d|,(@Xp0H`x`x 8Pt(Lp Lx(T(@Xp0H`x 8Ph(@Xp0H`x,D\H`x¤àƠx<ɘʸTϔЀ<,Ԝh <Xh|֐ִ֠׀dو lڴۘ(ܐT,ޜ޴$ߘ߰4(< ,\(Hh0@P\l| @`(8tTdXpX| 0dhh8\   @ t dH0(|D Dh,Pt H"x$$%%(&')),)<)T)d*,..// 0<0L1d1t122467p78:$:4:D:T:d:t::;;;<=?0@ABCE(F<GpGHLI,IJJMLN<NLNpOPRSS(S8SHSXShSxULU\VWXZ@[p[\d]L^<___aabbbbbd8ehgg,gDghgghhhhhhhhii4iXipiiiiiijj,jPjtjjjjjkk8kPkllllmm m8m\mtmmmmnnnn,n<nLn\nln|nnnnnnnno oo,o<oLpTq<r\stuwlw|xyz{t||$|4|D|T|d|t|}},~0$H`x Ll,PtDt0Ph4Lp<h,Pt,Pt(@d| 8dH| $H` $H`Dd|$Hl8d D\t@Xp<Tx8\\\ $P|,X(T0\|Dp Lx$<`x,X4Tl8Pt4Ld| 0H`x @t(@p,X|0`x Pt4h0`8\L| <l8h(X4h8P T$XpHp(Lp Dh8|HHP@ P8x@t0t@t(h(Lp0Tx TT @`p°LÀä @`ĀĠ4hŌŰ,PpƐƨ44hnj @PhȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ|4ʐʨLˠ,@PhψψϘϰи(pшѠѸX,Hp׌Xhx؈ؘبٜ($$4DTdt|\xLP|t ,<Tt 0Hhx0Px|H<8l,<`xl4Tt<d,T|,D\t$Dd$Dd$Dd$Dd$D $4DDDD `$ 't) ,,,,0-(-t./012p3|3340456l7$78<99: :8:P;<=??@AHABPBCDXEEF@FGH8HIpJ,JKLXLMNTNOPRTSTUVxW|XxYZZ[ [[,`djj,jjklmno8oopqqhqqrr\rst4tupuvTw@wx xxy\yzP{8|<}8}~DtT@@Tp0Tt4h@ \8Dd x0@(8l|(LpL$Dd$Dd$Dd$Dd$Dd$Dd$Dd$Dd$Dd$Dd$Dd$Dd0Pp0Pp0Pp0Pp0Pp0Pp0Pp0Pp0Pp0Pp0Pp°0PpÐð0PpĜ<\|Ŝż<\|ƜƼ<\|ǜǼ<\|Ȝȼ<\|ɜɼ<\|ʜʼ<\|˜˼<\|̜̼<\|͜ͼ<\|Μμ<\|Ϝϼ<\|Мм<hєѨ(8HXhx҈ҘҨҸ(8HXhxӈӘӨӸ(8HXhxԈԘԨԸ(8HXhxՈ՘ըոה$جٸڬh`\XHh,T\(8HXhx(8HXhx0Lh0Lh <Xhx,Pt8\(Lp(Lp@d (Lh 0L\l,Hl,Hl<X|0Hd(Dhx $@dt$<Lt8\x,Pl|0Tp$@d@P  X D X$xp\  " "#@$%,&H'<'(P)L*`+8,,-./012d3445(5p556(6|66747L7l7778$8t88889949h9::0:t:; ;H;;<<<<=>?(?8?H??@ABCDFGIhKdLMNNO`P PRS@STPTTU UdUUV0VlVVWWtWWXHXXXXY<YxYYZ,ZZZ[0[[\\0\t\]]d]]^p^^_`_|____`,`t`abb(b8b\bbbbccdeeeeef`fpg0gghhLhhi<iij4jjk kLk|kk .=r >EES@YI 7 A [ fo    0 < *  &x "n 47  7@ 7V *7h  7Created by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)EB Garamond 12ItalicSorts Mill Tools 2.1.0_alpha1 : EB Garamond 12 Italic : 8-4-2014EB Garamond 12 ItalicVersion 0.016 ; ttfautohint (v0.97) -l 8 -r 50 -G 200 -x 0 -f dflt -w gGDEBGaramond12-ItalicCopyright (c) 2010-2013, Georg A. Duffner (). This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.http://scripts.sil.org/OFLEB Garamond12 ItalicEB Garamond 12 ItalicItalicCreated by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)EB Garamond 12ItalicSorts Mill Tools 2.1.0_alpha1 : EB Garamond 12 Italic : 8-4-2014EB Garamond 12 ItalicVersion 0.016 ; ttfautohint (v0.97) -l 8 -r 50 -G 200 -x 0 -f dflt -w gGDEBGaramond12-ItalicCopyright (c) 2010-2013, Georg A. Duffner (<http://www.georgduffner.at/ebgaramond|g.duffner@gmail.com>). This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.http://scripts.sil.org/OFLEB Garamond12 ItalicEB Garamond 12 ItalicItalic2   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  uni00A0uni00ADuni00B2uni00B3uni00B9AmacronamacronAbreveabreveAogonekaogonek Ccircumflex ccircumflex Cdotaccent cdotaccentDcarondcaronDcroatEmacronemacronEbreveebreve Edotaccent edotaccentEogonekeogonekEcaronecaron Gcircumflex gcircumflex Gdotaccent gdotaccentuni0122uni0123 Hcircumflex hcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonekIJij Jcircumflex jcircumflexuni0136uni0137 kgreenlandicLacutelacuteuni013Buni013CLcaronlcaronLdotldotNacutenacuteuni0145uni0146Ncaronncaron napostropheEngengOmacronomacronObreveobreve Ohungarumlaut ohungarumlautRacuteracuteuni0156uni0157RcaronrcaronSacutesacute Scircumflex scircumflexuni0162uni0163TcarontcaronTbartbarUtildeutildeUmacronumacronUbreveubreveUringuring Uhungarumlaut uhungarumlautUogonekuogonek Wcircumflex wcircumflex Ycircumflex ycircumflexZacutezacute Zdotaccent zdotaccentlongsuni0191OhornohornUhornuhornuni01B7uni01C0uni01C1uni01C4uni01C5uni01C6uni01C7uni01C8uni01C9uni01CAuni01CBuni01CCuni01CDuni01CEuni01CFuni01D0uni01D1uni01D2uni01D3uni01D4uni01D5uni01D6uni01D7uni01D8uni01D9uni01DAuni01DBuni01DCuni01DEuni01DFuni01E0uni01E1uni01E2uni01E3Gcarongcaronuni01E8uni01E9uni01EAuni01EBuni01ECuni01EDuni01EEuni01EFuni01F0uni01F1uni01F2uni01F3uni01F4uni01F5uni01F8uni01F9 Aringacute aringacuteAEacuteaeacute Oslashacute oslashacuteuni0200uni0201uni0202uni0203uni0204uni0205uni0206uni0207uni0208uni0209uni020Auni020Buni020Cuni020Duni020Euni020Funi0210uni0211uni0212uni0213uni0214uni0215uni0216uni0217uni0218uni0219uni021Auni021Buni021Euni021Funi0226uni0227uni0228uni0229uni022Auni022Buni022Cuni022Duni022Euni022Funi0230uni0231uni0232uni0233uni0237uni0245uni0250uni0254uni0258uni0259uni025Buni025Cuni0275uni0276uni028Auni0292uni02B0uni02B2uni02B3uni02B7uni02B8uni02B9uni02BAuni02BBuni02BCuni02BEuni02BFuni02C4uni02C9uni02CAuni02CBuni02CDuni02CEuni02CFuni02E1uni02E2uni02E3uni02F7 gravecomb acutecombuni0302 tildecombuni0304uni0305uni0306uni0307uni0308 hookabovecombuni030Auni030Buni030Cuni030Duni030Euni030Funi0310uni0311uni0312uni0313uni0314uni0315uni0316uni0317uni0318uni0319uni031Auni031Cuni031Duni031Euni031Funi0320 dotbelowcombuni0324uni0325uni0326uni0327uni0328uni0329uni032Auni032Buni032Cuni032Duni032Euni032Funi0330uni0331uni0332uni0333uni0339uni033Auni033Buni033Cuni033Euni0340uni0341uni0342uni0343uni0344uni0345uni0351uni0357uni0374uni037Etonos dieresistonos Alphatonos anoteleia EpsilontonosEtatonos Iotatonos Omicrontonos Upsilontonos OmegatonosiotadieresistonosAlphaBetaGammauni0394EpsilonZetaEtaThetaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonPhiChiPsiuni03A9 IotadieresisUpsilondieresis alphatonos epsilontonosetatonos iotatonosupsilondieresistonosalphabetagammadeltaepsilonzetaetathetaiotakappalambdauni03BCnuxiomicronrhosigma1sigmatauupsilonphichipsiomega iotadieresisupsilondieresis omicrontonos upsilontonos omegatonosuni03D0theta1Upsilon1uni03D3uni03D4phi1omega1uni03F0uni03F1uni0400uni0401uni0402uni0403uni0404uni0405uni0406uni0407uni0408uni0409uni040Auni040Buni040Cuni040Duni040Euni040Funi0410uni0411uni0412uni0413uni0414uni0415uni0416uni0417uni0418uni0419uni041Auni041Buni041Cuni041Duni041Euni041Funi0420uni0421uni0422uni0423uni0424uni0425uni0426uni0427uni0428uni0429uni042Auni042Buni042Cuni042Duni042Euni042Funi0430uni0431uni0432uni0433uni0434uni0435uni0436uni0437uni0438uni0439uni043Auni043Buni043Cuni043Duni043Euni043Funi0440uni0441uni0442uni0443uni0444uni0445uni0446uni0447uni0448uni0449uni044Auni044Buni044Cuni044Duni044Euni044Funi0450uni0451uni0452uni0453uni0454uni0455uni0456uni0457uni0458uni0459uni045Auni045Buni045Cuni045Duni045Euni045Funi0470uni0474uni0475uni0476uni0477uni0490uni04AEuni04C0uni04C1uni04C2uni04D0uni04D1uni04D2uni04D3uni04D4uni04D5uni04D6uni04D7uni04D8uni04DAuni04DCuni04DDuni04DEuni04DFuni04E1uni04E2uni04E3uni04E4uni04E5uni04E6uni04E7uni04E8uni04E9uni04EAuni04EBuni04ECuni04EDuni04EEuni04EFuni04F0uni04F1uni04F2uni04F3uni04F4uni04F5uni04F8uni04F9uni1D02uni1D2Cuni1D2Duni1D2Euni1D30uni1D31uni1D33uni1D34uni1D35uni1D36uni1D37uni1D38uni1D39uni1D3Auni1D3Cuni1D3Euni1D3Funi1D40uni1D41uni1D42uni1D43uni1D47uni1D48uni1D49uni1D4Duni1D4Funi1D50uni1D51uni1D52uni1D56uni1D57uni1D58uni1D5Buni1D61uni1D62uni1D63uni1D64uni1D65uni1D68uni1D6Auni1D9Cuni1D9Euni1DA0uni1DBBuni1DBEuni1E00uni1E01uni1E02uni1E03uni1E04uni1E05uni1E06uni1E07uni1E08uni1E09uni1E0Auni1E0Buni1E0Cuni1E0Duni1E0Euni1E0Funi1E10uni1E11uni1E12uni1E13uni1E14uni1E15uni1E16uni1E17uni1E18uni1E19uni1E1Auni1E1Buni1E1Cuni1E1Duni1E1Euni1E1Funi1E20uni1E21uni1E22uni1E23uni1E24uni1E25uni1E26uni1E27uni1E28uni1E29uni1E2Auni1E2Buni1E2Cuni1E2Duni1E2Euni1E2Funi1E30uni1E31uni1E32uni1E33uni1E34uni1E35uni1E36uni1E37uni1E38uni1E39uni1E3Auni1E3Buni1E3Cuni1E3Duni1E3Euni1E3Funi1E40uni1E41uni1E42uni1E43uni1E44uni1E45uni1E46uni1E47uni1E48uni1E49uni1E4Auni1E4Buni1E4Cuni1E4Duni1E4Euni1E4Funi1E50uni1E51uni1E52uni1E53uni1E54uni1E55uni1E56uni1E57uni1E58uni1E59uni1E5Auni1E5Buni1E5Cuni1E5Duni1E5Euni1E5Funi1E60uni1E61uni1E62uni1E63uni1E64uni1E65uni1E66uni1E67uni1E68uni1E69uni1E6Auni1E6Buni1E6Cuni1E6Duni1E6Euni1E6Funi1E70uni1E71uni1E72uni1E73uni1E74uni1E75uni1E76uni1E77uni1E78uni1E79uni1E7Auni1E7Buni1E7Cuni1E7Duni1E7Euni1E7FWgravewgraveWacutewacute Wdieresis wdieresisuni1E86uni1E87uni1E88uni1E89uni1E8Auni1E8Buni1E8Cuni1E8Duni1E8Euni1E8Funi1E90uni1E91uni1E92uni1E93uni1E94uni1E95uni1E96uni1E97uni1E98uni1E99uni1E9Auni1E9Buni1E9Cuni1E9Duni1E9Euni1E9Funi1EA0uni1EA1uni1EA2uni1EA3uni1EA4uni1EA5uni1EA6uni1EA7uni1EA8uni1EA9uni1EAAuni1EABuni1EACuni1EADuni1EAEuni1EAFuni1EB0uni1EB1uni1EB2uni1EB3uni1EB4uni1EB5uni1EB6uni1EB7uni1EB8uni1EB9uni1EBAuni1EBBuni1EBCuni1EBDuni1EBEuni1EBFuni1EC0uni1EC1uni1EC2uni1EC3uni1EC4uni1EC5uni1EC6uni1EC7uni1EC8uni1EC9uni1ECAuni1ECBuni1ECCuni1ECDuni1ECEuni1ECFuni1ED0uni1ED1uni1ED2uni1ED3uni1ED4uni1ED5uni1ED6uni1ED7uni1ED8uni1ED9uni1EDAuni1EDBuni1EDCuni1EDDuni1EDEuni1EDFuni1EE0uni1EE1uni1EE2uni1EE3uni1EE4uni1EE5uni1EE6uni1EE7uni1EE8uni1EE9uni1EEAuni1EEBuni1EECuni1EEDuni1EEEuni1EEFuni1EF0uni1EF1Ygraveygraveuni1EF4uni1EF5uni1EF6uni1EF7uni1EF8uni1EF9uni1EFBuni1F00uni1F01uni1F02uni1F03uni1F04uni1F05uni1F06uni1F07uni1F08uni1F09uni1F0Auni1F0Buni1F0Cuni1F0Duni1F0Euni1F0Funi1F10uni1F11uni1F12uni1F13uni1F14uni1F15uni1F18uni1F19uni1F1Auni1F1Buni1F1Cuni1F1Duni1F20uni1F21uni1F22uni1F23uni1F24uni1F25uni1F26uni1F27uni1F28uni1F29uni1F2Auni1F2Buni1F2Cuni1F2Duni1F2Euni1F2Funi1F30uni1F31uni1F32uni1F33uni1F34uni1F35uni1F36uni1F37uni1F38uni1F39uni1F3Auni1F3Buni1F3Cuni1F3Duni1F3Euni1F3Funi1F40uni1F41uni1F42uni1F43uni1F44uni1F45uni1F48uni1F49uni1F4Auni1F4Buni1F4Cuni1F4Duni1F50uni1F51uni1F52uni1F53uni1F54uni1F55uni1F56uni1F57uni1F59uni1F5Buni1F5Duni1F5Funi1F60uni1F61uni1F62uni1F63uni1F64uni1F65uni1F66uni1F67uni1F68uni1F69uni1F6Auni1F6Buni1F6Cuni1F6Duni1F6Euni1F6Funi1F70uni1F71uni1F72uni1F73uni1F74uni1F75uni1F76uni1F77uni1F78uni1F79uni1F7Auni1F7Buni1F7Cuni1F7Duni1F80uni1F81uni1F82uni1F83uni1F84uni1F85uni1F86uni1F87uni1F88uni1F89uni1F8Auni1F8Buni1F8Cuni1F8Duni1F8Euni1F8Funi1F90uni1F91uni1F92uni1F93uni1F94uni1F95uni1F96uni1F97uni1F98uni1F99uni1F9Auni1F9Buni1F9Cuni1F9Duni1F9Euni1F9Funi1FA0uni1FA1uni1FA2uni1FA3uni1FA4uni1FA5uni1FA6uni1FA7uni1FA8uni1FA9uni1FAAuni1FABuni1FACuni1FADuni1FAEuni1FAFuni1FB0uni1FB1uni1FB2uni1FB3uni1FB4uni1FB6uni1FB7uni1FB8uni1FB9uni1FBAuni1FBBuni1FBCuni1FBDuni1FBFuni1FC0uni1FC1uni1FC2uni1FC3uni1FC4uni1FC6uni1FC7uni1FC8uni1FC9uni1FCAuni1FCBuni1FCCuni1FCDuni1FCEuni1FCFuni1FD0uni1FD1uni1FD2uni1FD3uni1FD6uni1FD7uni1FD8uni1FD9uni1FDAuni1FDBuni1FDDuni1FDEuni1FDFuni1FE0uni1FE1uni1FE2uni1FE3uni1FE4uni1FE5uni1FE6uni1FE7uni1FE8uni1FE9uni1FEAuni1FEBuni1FECuni1FEDuni1FEEuni1FEFuni1FF2uni1FF3uni1FF4uni1FF6uni1FF7uni1FF8uni1FF9uni1FFAuni1FFBuni1FFCuni1FFDuni1FFEuni2000uni2001uni2002uni2003uni2004uni2005uni2006uni2007uni2008uni2009uni200Auni200Buni200Cuni200Duni200Euni200Funi2010uni2011 figuredashuni2015uni2016 underscoredblonedotenleadertwodotenleaderuni202Aminuteseconduni2034uni2035uni2036uni2037 exclamdbluni203Duni203Euni2047uni2048uni2049uni2057uni2060uni2070uni2071uni2074uni2075uni2076uni2077uni2078uni2079uni207Auni207Buni207Cuni207Duni207Euni207Funi2080uni2081uni2082uni2083uni2084uni2085uni2086uni2087uni2088uni2089uni208Auni208Buni208Cuni208Duni208Euni2090uni2091uni2092uni2093uni20A8Eurouni2100uni2101uni2105uni2106uni2112uni2113uni2116uni2120uni2127uni212Auni212Buni2160uni2161uni2162uni2163uni2164uni2165uni2166uni2167uni2168uni2169uni216Auni216Buni216Cuni216Duni216Euni216Funi2170uni2171uni2172uni2173uni2174uni2175uni2176uni2177uni2178uni2179uni217Auni217Buni217Cuni217Duni217Euni217F arrowleftarrowup arrowright arrowdown arrowboth arrowupdnuni2196uni2197uni2198uni2199uni219Auni219Buni21AEuni2213uni2215uni2216uni2219uni2223uni2224uni2225uni2226uni2236similaruni2241uni226Auni226Buni226Euni226Fdotmathuni22EFuni2303uni2474uni2475uni2476uni2477uni2478uni2479uni247Auni247Buni247Cuni247Duni247Euni247Funi2480uni2481uni2482uni2483uni2484uni2485uni2486uni2487uni2488uni2489uni248Auni248Buni248Cuni248Duni248Euni248Funi2490uni2491uni2492uni2493uni2494uni2495uni2496uni2497uni2498uni2499uni249Auni249Buni249Cuni249Duni249Euni249Funi24A0uni24A1uni24A2uni24A3uni24A4uni24A5uni24A6uni24A7uni24A8uni24A9uni24AAuni24ABuni24ACuni24ADuni24AEuni24AFuni24B0uni24B1uni24B2uni24B3uni24B4uni24B5 openbulletuni261Cuni261Euni2A74uni2A75uni2A76uni2C7Cuni2C7DuniA726uniA727uniA731uniE001uniE002uniF6BEf_funiFB01uniFB02uniFB03uniFB04uniFB05uniFB06uniFEFF Adieresis.deu Odieresis.deu Udieresis.deu uni0311.cap longs_longs_l longs_longs_ilongs_i longs_longslongs_lT_hc_hc_kone.lnumtwo.lnum three.lnum four.lnum five.lnumsix.lnum seven.lnum eight.lnum nine.lnum zero.lnumlongs_ss_sc_t f_f.shortt_tt_z.altL.scriptQ.longi.TRKscf.shortzero.taboldstyleone.taboldstyletwo.taboldstylethree.taboldstylefour.taboldstylefive.taboldstylesix.taboldstyleseven.taboldstyleeight.taboldstylenine.taboldstyle one.tablining two.tabliningthree.tabliningfour.tabliningfive.tablining six.tabliningseven.tabliningeight.tabliningnine.tabliningzero.tabliningEuro.tabliningf_hf_kf_bf_tf_jlongs_jlongs_blongs_hlongs_k longs.shortlongs_longs.short u.LATmedii.TRKU.LAT bullet.01 bullet.03 bullet.02f.DEU exclam.subs quotedbl.subsnumbersign.subs dollar.subs percent.subsampersand.subsquotesingle.subsparenleft.subsparenright.subs asterisk.subs plus.subs comma.subs hyphen.subs period.subs slash.subs zero.subsone.substwo.subs three.subs four.subs five.subssix.subs seven.subs eight.subs nine.subs colon.subssemicolon.subs less.subs equal.subs greater.subs question.subsat.subsA.subsB.subsC.subsD.subsE.subsF.subsG.subsH.subsI.subsJ.subsK.subsL.subsM.subsN.subsO.subsP.subsQ.subsR.subsS.subsT.subsU.subsV.subsW.subsX.subsY.subsZ.subsbracketleft.subsbackslash.subsbracketright.subsasciicircum.subsunderscore.subs grave.subsa.subsb.subsc.subsd.subse.subsf.subsg.subsh.subsi.subsj.subsk.subsl.subsm.subsn.subso.subsp.subsq.subsr.subss.subst.subsu.subsv.subsw.subsx.subsy.subsz.subsbraceleft.subsbar.subsbraceright.subsasciitilde.subsbrokenbar.subs section.subsparagraph.subs Egrave.subs egrave.subs uni2016.subs dagger.subsdaggerdbl.subs exclam.sinf quotedbl.sinfnumbersign.sinf dollar.sinf percent.sinfampersand.sinfquotesingle.sinfparenleft.sinfparenright.sinf asterisk.sinf plus.sinf comma.sinf hyphen.sinf period.sinf slash.sinf zero.sinfone.sinftwo.sinf three.sinf four.sinf five.sinfsix.sinf seven.sinf eight.sinf nine.sinf colon.sinfsemicolon.sinf less.sinf equal.sinf greater.sinf question.sinfat.sinfA.sinfB.sinfC.sinfD.sinfE.sinfF.sinfG.sinfH.sinfI.sinfJ.sinfK.sinfL.sinfM.sinfN.sinfO.sinfP.sinfQ.sinfR.sinfS.sinfT.sinfU.sinfV.sinfW.sinfX.sinfY.sinfZ.sinfbracketleft.sinfbackslash.sinfbracketright.sinfasciicircum.sinfunderscore.sinf grave.sinfa.sinfb.sinfc.sinfd.sinfe.sinff.sinfg.sinfh.sinfi.sinfj.sinfk.sinfl.sinfm.sinfn.sinfo.sinfp.sinfq.sinfr.sinfs.sinft.sinfu.sinfv.sinfw.sinfx.sinfy.sinfz.sinfbraceleft.sinfbar.sinfbraceright.sinfasciitilde.sinfbrokenbar.sinf section.sinfparagraph.sinf Egrave.sinf egrave.sinf uni2016.sinf dagger.sinfdaggerdbl.sinf exclam.ordn quotedbl.ordnnumbersign.ordn dollar.ordn percent.ordnampersand.ordnquotesingle.ordnparenleft.ordnparenright.ordn asterisk.ordn plus.ordn comma.ordn hyphen.ordn period.ordn slash.ordn zero.ordnone.ordntwo.ordn three.ordn four.ordn five.ordnsix.ordn seven.ordn eight.ordn nine.ordn colon.ordnsemicolon.ordn less.ordn equal.ordn greater.ordn question.ordnat.ordnA.ordnB.ordnC.ordnD.ordnE.ordnF.ordnG.ordnH.ordnI.ordnJ.ordnK.ordnL.ordnM.ordnN.ordnO.ordnP.ordnQ.ordnR.ordnS.ordnT.ordnU.ordnV.ordnW.ordnX.ordnY.ordnZ.ordnbracketleft.ordnbackslash.ordnbracketright.ordnasciicircum.ordnunderscore.ordn grave.ordna.ordnb.ordnc.ordnd.ordne.ordnf.ordng.ordnh.ordni.ordnj.ordnk.ordnl.ordnm.ordnn.ordno.ordnp.ordnq.ordnr.ordns.ordnt.ordnu.ordnv.ordnw.ordnx.ordny.ordnz.ordnbraceleft.ordnbar.ordnbraceright.ordnasciitilde.ordnbrokenbar.ordn section.ordnparagraph.ordn Egrave.ordn egrave.ordn uni2016.ordn dagger.ordndaggerdbl.ordn exclam.sups quotedbl.supsnumbersign.sups dollar.sups percent.supsampersand.supsquotesingle.supsparenleft.supsparenright.sups asterisk.sups plus.sups comma.sups hyphen.sups period.sups slash.sups zero.supsone.supstwo.sups three.sups four.sups five.supssix.sups seven.sups eight.sups nine.sups colon.supssemicolon.sups less.sups equal.sups greater.sups question.supsat.supsA.supsB.supsC.supsD.supsE.supsF.supsG.supsH.supsI.supsJ.supsK.supsL.supsM.supsN.supsO.supsP.supsQ.supsR.supsS.supsT.supsU.supsV.supsW.supsX.supsY.supsZ.supsbracketleft.supsbackslash.supsbracketright.supsasciicircum.supsunderscore.sups grave.supsa.supsb.supsc.supsd.supse.supsf.supsg.supsh.supsi.supsj.supsk.supsl.supsm.supsn.supso.supsp.supsq.supsr.supss.supst.supsu.supsv.supsw.supsx.supsy.supsz.supsbraceleft.supsbar.supsbraceright.supsasciitilde.supsbrokenbar.sups section.supsparagraph.sups Egrave.sups egrave.sups uni2016.sups dagger.supsdaggerdbl.sups exclam.sc quotedbl.sc numbersign.sc dollar.sc percent.sc ampersand.scquotesingle.sc parenleft.sc parenright.sc asterisk.scplus.sccomma.sc hyphen.sc period.scslash.sczero.scone.sctwo.scthree.scfour.scfive.scsix.scseven.sceight.scnine.sccolon.sc semicolon.scless.scequal.sc greater.sc question.scat.scA.scB.scC.scD.scE.scF.scG.scH.scI.scJ.scK.scL.scM.scN.scO.scP.scQ.scR.scS.scT.scU.scV.scW.scX.scY.scZ.scbracketleft.sc backslash.scbracketright.scasciicircum.sc underscore.scgrave.sca.scb.scc.scd.sce.scf.scg.sch.sci.scj.sck.scl.scm.scn.sco.scp.scq.scr.scs.sct.scu.scv.scw.scx.scy.scz.sc braceleft.scbar.sc braceright.sc asciitilde.sc exclamdown.sccent.sc sterling.sc currency.scyen.sc brokenbar.sc section.sc dieresis.sc copyright.scordfeminine.scguillemotleft.sc logicalnot.sc uni00AD.sc registered.sc macron.sc degree.sc plusminus.scacute.sc paragraph.scperiodcentered.sc cedilla.scordmasculine.scguillemotright.scquestiondown.sc Agrave.sc Aacute.scAcircumflex.sc Atilde.sc Adieresis.scAring.scAE.sc Ccedilla.sc Egrave.sc Eacute.scEcircumflex.sc Edieresis.sc Igrave.sc Iacute.scIcircumflex.sc Idieresis.scEth.sc Ntilde.sc Ograve.sc Oacute.scOcircumflex.sc Otilde.sc Odieresis.sc multiply.sc Oslash.sc Ugrave.sc Uacute.scUcircumflex.sc Udieresis.sc Yacute.scThorn.sc germandbls.sc agrave.sc aacute.scacircumflex.sc atilde.sc adieresis.scaring.scae.sc ccedilla.sc egrave.sc eacute.scecircumflex.sc edieresis.sc igrave.sc iacute.scicircumflex.sc idieresis.sceth.sc ntilde.sc ograve.sc oacute.scocircumflex.sc otilde.sc odieresis.sc divide.sc oslash.sc ugrave.sc uacute.scucircumflex.sc udieresis.sc yacute.scthorn.sc ydieresis.sc Amacron.sc amacron.sc Abreve.sc abreve.sc Aogonek.sc aogonek.sc Cacute.sc cacute.scCcircumflex.scccircumflex.sc Cdotaccent.sc cdotaccent.sc Ccaron.sc ccaron.sc Dcaron.sc dcaron.sc Dcroat.sc dcroat.sc Emacron.sc emacron.sc Ebreve.sc ebreve.sc Edotaccent.sc edotaccent.sc Eogonek.sc eogonek.sc Ecaron.sc ecaron.scGcircumflex.scgcircumflex.sc Gbreve.sc gbreve.sc Gdotaccent.sc gdotaccent.sc uni0122.sc uni0123.scHcircumflex.schcircumflex.scHbar.schbar.sc Itilde.sc itilde.sc Imacron.sc imacron.sc Ibreve.sc ibreve.sc Iogonek.sc iogonek.sc Idotaccent.sc dotlessi.scIJ.scij.scJcircumflex.scjcircumflex.sc uni0136.sc uni0137.sckgreenlandic.sc Lacute.sc lacute.sc uni013B.sc uni013C.sc Lcaron.sc lcaron.scLdot.scldot.sc Lslash.sc lslash.sc Nacute.sc nacute.sc uni0145.sc uni0146.sc Ncaron.sc ncaron.scnapostrophe.scEng.sceng.sc Omacron.sc omacron.sc Obreve.sc obreve.scOhungarumlaut.scohungarumlaut.scOE.scoe.sc Racute.sc racute.sc uni0156.sc uni0157.sc Rcaron.sc rcaron.sc Sacute.sc sacute.scScircumflex.scscircumflex.sc Scedilla.sc scedilla.sc Scaron.sc scaron.sc uni0162.sc uni0163.sc Tcaron.sc tcaron.scTbar.sctbar.sc Utilde.sc utilde.sc Umacron.sc umacron.sc Ubreve.sc ubreve.scUring.scuring.scUhungarumlaut.scuhungarumlaut.sc Uogonek.sc uogonek.scWcircumflex.scwcircumflex.scYcircumflex.scycircumflex.sc Ydieresis.sc Zacute.sc zacute.sc Zdotaccent.sc zdotaccent.sc Zcaron.sc zcaron.sclongs.scf_f_bf_f_hf_f_jf_f_kf_f_t longs_longs_b longs_longs_h longs_longs_j longs_longs_k longs_longs_tv.LATu.LAT v.LATmedi uni0306.cyruni0306.cyrcap uni0414.alt uni041B.alt uni0409.altv.initv.altw.init1w.initw.altA.swB.swC.swD.swE.swF.swG.swH.swI.swJ.swK.swL.swM.swN.swO.swP.swQ.swR.swS.swT.swU.swV.swW.swX.swY.swZ.swV.01W.01Q.swlong gravecomb.cap uni0302.cap tildecomb.cap uni0304.cap uni0306.cap uni0307.cap uni0308.cap uni030A.cap uni030B.cap uni030C.cap uni030F.cap uni0316.capdotbelowcomb.cap uni0324.cap uni0325.cap uni0327.cap uni0328.cap uni032C.cap uni032D.cap uni032E.cap uni032F.cap uni0330.cap uni0331.cap uni0307.stack uni030A.stackacutecomb.flat uni0304.stackgravecomb.flat uni0302.flat uni030C.flatgravecomb.stackacutecomb.stack uni0302.stack uni030C.stacktildecomb.stack uni0306.stack uni030C.altat.01 ampersand.01J.histj.hist v.initalt u.LATinitQ.shorta_se_si_su_ss_ps_kg_yg_gg_jQ_y uni0317.cap uni0431.SRB uni0433.SRB uni0434.SRB uni043F.SRB uni0442.SRB uni0448.SRB uni0453.SRBuni0308.grkstack uni0313.grk uni0314.grk uni0342.altuni0313.grkstackuni0314.grkstack gravecomb.grk acutecomb.grkgravecomb.grkstackacutecomb.grkstack space.stackhookabovecomb.stackhookabovecomb.capacutecomb.capstackgravecomb.capstacktildecomb.capstack uni0308.sc hyphen.cap uni2010.cap uni2011.capfiguredash.cap endash.cap emdash.cap gravecomb.sc acutecomb.sc uni0302.sc uni0304.sc uni0306.sc uni0307.schookabovecomb.sc uni030A.sc uni030B.sc uni030C.sc uni0311.sc uni0312.sc uni0313.sc uni0314.sc uni0315.sc acutecomb.caphookabovecomb.stacksceacute_sg.01registered.supsperiodcentered.CATperiodcentered.CATscperiodcentered.CATuc i.dotless j.dotless uni030C.alt1uni030C.altcap1uni030C.altcapgermandbls.sc1e.finah.01k.01hcircumflex.01 uni01E9.01 uni021F.01 uni1E23.01 uni1E27.01 uni1E31.01q.longscv.01scw.01scQ.longscV.01scW.01scOhorn.scohorn.scUhorn.scuhorn.sc uni0327.sc Aogonek.ref1 Dcroat.ref1 dcroat.ref1 Eogonek.ref1 Iogonek.ref1 Uogonek.ref1 uni01EA.ref1 uni044B.ref1 uni045F.ref1Adieresis.deu.ref1Odieresis.deu.ref1 eth.sc.ref1oslash.sc.ref1 hbar.sc.ref1lslash.sc.ref1 tbar.sc.ref1@@&&RR@@ް, UXEY (`f UX%aEc#b!!YC#DC`B-, `f-, d P&Z( CEER[X!#!X PPX!@Y 8PX!8YY CEEad(PX! CEE 0PX!0Y PX f a PX` PX! ` 6PX!6``YYY+YY#PXeYY-, E %ad CPX#B#B!!Y`-,#!#! dbB #B CE CE`E*! C +0%QX`PaRYX#Y! @SX+!@Y#PXeY-,C+C`B-,#B# #Babfc`*-, E Ccb PX@`Yfc`D`-, CEB*!C`B- ,C#DC`B- , E +#C%` E#a d PX!0PX @YY#PXeY%#aDD`- , #B *!- ,EaD- ,` CJPX #BY CJRX #BY-, bfc c#a C` ` #B#-,KTXDY$ e#x-,KQXKSXDY!Y$e#x-,CUXCaB+YC%B %B %B# %PXC`%B #a *!#a #a *!C`%B%a *!Y CG CG`b PX@`Yfc Ccb PX@`Yfc`#DC>C`B-,ETX#B E #B #E`B `a BB`+q+"Y-,+-,+-,+-,+-,+-,+-,+-,+-,+-, +-, +ETX#B E #B #E`B `a BB`+q+"Y-,+-,+- ,+-!,+-",+-#,+-$,+-%,+-&,+-', +-(, <`-), `` C#`C%a`(*!-*,)+)*-+, G Ccb PX@`Yfc`#a8# UX G Ccb PX@`Yfc`#a8!Y-,,ETX+*0"Y--, +ETX+*0"Y-., 5`-/,Ecb PX@`Yfc+ Ccb PX@`Yfc+D>#8.*-0, < G Ccb PX@`Yfc`Ca8-1,.<-2, < G Ccb PX@`Yfc`CaCc8-3,% . G#B%IG#G#a Xb!Y#B2*-4,%%G#G#aE+e.# <8-5,%% .G#G#a #BE+ `PX @QX  &YBB# C #G#G#a#F`Cb PX@`Yfc` + a C`d#CadPXCaC`Y%b PX@`Yfca# &#Fa8#CF%CG#G#a` Cb PX@`Yfc`# +#C`+%a%b PX@`Yfc&a %`d#%`dPX!#!Y# &#Fa8Y-6, & .G#G#a#<8-7, #B F#G+#a8-8,%%G#G#aTX. <#!%%G#G#a %%G#G#a%%I%aEc# Xb!Ycb PX@`Yfc`#.# <8#!Y-9, C .G#G#a ` `fb PX@`Yfc# <8-:,# .F%FRX ,5+ <#B8# .F%FRX +-^,>+-_,>+-`,>+-a,6+.*+-b,6+:+-c,6+;+-d,6+<+-e,7+.*+-f,7+:+-g,7+;+-h,7+<+-i,8+.*+-j,8+:+-k,8+;+-l,8+<+-m,9+.*+-n,9+:+-o,9+;+-p,9+<+-q,+e$Px0-KRXYc #D#pDBE1*B8$*BB.* B9% * B *:& *D$QX@XD&QX@cTXDYYYYDPK!$mdc/resources/ebgaramond-regular.ttf FFTM#Y,GDEF *H2GPOSyB| GSUBJ ]OS/2Lq@`cmaplpJcvt *dfpgm]Y gasp\glyfgheadx6hhea ky$hmtxy40Hloca$M|0Xmaxp? name%b9postD{prepnQ|%hڹt*; !"                 " # # $ ' ( \ ] ^ _ ` a p q q r       |"HPXft| (08@HP^lt  >  y4,    &M      X ^ DFLTcyrl2grekVlatnnMKD SRB (AZE (CAT (CRT (DEU (LAT (TRK (kern,lfbd8mark>mkmkDrtbdJsizePxtexT"ywxz {x_^fnv~&.6>FPX`&.6>FNV^fnv~&.6>FNV^fnv~&.6>FNV^fnv~ 08@HPH`<=>>>>?.?r??@"@j@@AAbAAAAB.BZBBC"CjCCDD:DZDBDHDNDTDbDnDvD~DDDDDDDDDDDDDDDDEEEEEE*EFtFTFFFG6G^GHFHI$IIJPJKKdKKLBLLMMtMNFNNO8O|OPPHPPQQ0QvQQR RLRRSSHSSTT@TnTTUUNUUUVHVVVW8WlWWXBXXYNYZZjZ["[\\^\]]t]^:^^_.^^^^^^_ __._@_R_d_v_______```*`<`N```r````````aaaa"a,a6a@aJaTa^ahara|aaaaaaaaaaaaabbbb$b,b4b<bDbTbdbtb|bbbbbbbbbbb bcHe f,gjwց.Ƌjr0\–2Xjt~ MJ6$*-'`(y(2#A<(2##(AjF~2((7A<(tFFFxFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFK<<}_Zns~~PP7PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPz#$$''(())// 00 2233 55 779:<<DDEFGGHHIIKKOOPQRSVV"YZ$\\$   $$&&((AAHHQQSSTTVVaannppttuuvv$$$ %%$357799EE%&"" ##!$$%% &&!''                        + 0 ; ; K N      X X      l"  82;:$#*""4$$%%&&')**+122334455779: << @@DDEEFHJJKKLM(NOPQRRSSTTUUVVWW9XXY[Q\\C]]``dihlnoj+s,.3/v<>?Z\be!f g&k'Bqpm((r    )    1-0t7u!!##$$&&''9((++W--A//=11Y33@5577Q99[<<^>>_@@AAVV bbccrruu vvCxx||DE%FGHIJK     C !!""##%%C+,1677L%%''))7799??AACCMEEGGIIKKMMOOQQSSUUWWYY[[]]__aacceeggiikkmmqqsswwyy{{NOwPQQQQQRxSTUyczccbbbbb{V|}.~..,s}3    <  vW]X""5##6$$%%5&&6''88"994<=4>>"[[( `             a `             a  + 0 K N | | $'()/023579:<DEFGHIKOPQRSVYZ\$&(AHQSTVanptuv %34579E"#$%&'     + , - . / 0 ; K L M N    X F\ ~t~y~TTccqqstuuvvwwxxyy{{||}~ Tc H  ru ww!'))++  rstu $ % &   o p ~        " h r    '   o p ~   '       " h r     $   o p ~    $       " h r     %   o p ~    %       " h r     &   o p ~   &       " h r   $ % &   o p ~        " h r     o p ~        " h r          " h r     '       " h r     $       " h r     %       " h r     &       " h r    $  %  &" ( . ? @ F W &T; OO  OO  O  O . O T;   TT  yy  yy  yA  y  y  T ; ; ( . ? @ F W(b  rstu    " " h h o p r r ~     " " h h o p r r ~ w!"#$%&')+&`! rstu    " " h h o p r r ~ w!"#$%&')+ rstu rstu"#3  i j m"$3  c l"%3   a d e f h"&3 &`'7$&(npDFGHJV!  "&@(7$&(np RTc #7&h)7$&(npPQSUX] 5rx|123456aceikm&.*7$&(npW'&<+7$&(np YZ[7&`,7$&(npDFGHJV!  " &@-7$&(np RTc #7 &h.7$&(npPQSUX] 5rx|123456aceikm &./7$&(npW' &<07$&(np YZ[7 &617$&(np!+,  b&627$&(np!+,  g k n o p&637$&(np!+,  i j m&647$&(np!+,  c l&657$&(np!+,   a d e f h&667$&(np!+, &Z77$&(np  c l&Z87$&(np   a d e f h&Z97$&(np &>:7$&(np  i j m&>;7$&(np  c l&><7$&(np   a d e f h&>=7$&(np &0>7$&(np | b&0?7$&(np | g k n o p&0@7$&(np | i j m&0A7$&(np | c l&0B7$&(np |  a d e f h&0C7$&(np |&D9:V  b&E9:V  g k n o p&F9:V  i j m&G9:V  c l&H9:V   a d e f h&I9:V 6J9:V  c l6K9:V   a d e f h6L9:V (M9:V | b(N9:V | g k n o p(O9:V | i j m(P9:V | c l(Q9:V |  a d e f h(R9:V |&S<u  b&T<u  g k n o p&U<u  i j m&V<u  c l&W<u   a d e f h&X<u 6Y<u  c l6Z<u   a d e f h6[<u (\<u | b(]<u | g k n o p(^<u | i j m(_<u | c l(`<u |  a d e f h(a<u |Pb  a p Pc  a p Pd  a p Pe  a p Pf  a p#&$Xg  ; a p $Xh  ; a p $Xi  ; a p Pj  a p $>kIT X RTc #7$^lIT XDFGHJV!  "$4mIT X!+, $^nIT XDFGHJV!  " $4oIT X!+,  4pE RTc #7TqEDFGHJV!  "*rE!+, 4sE RTc #7 TtEDFGHJV!  " *uE!+,  *v !+, (3A3K3K37$&(np7$&(npx7$&(npd7$&(npd7$&(nps7$&(nps7$&(npd7$&(npP7$&(npP7$&(np<7$&(npZ7$&(npn7$&(np}7$&(np7$&(np7$&(np 7$&(np7$&(np<7$&(np7$&(np(7$&(np<7$&(np_7$&(np27$&(npP7$&(npd7$&(nps7$&(np7$&(np7$&(np9:V-9:VA9:VP9:Vd9:V9:V9:V9:V<9:V9:V-9:VA9:VP9:Vd9:V9:V<u-<uA<uP<ud<u<u<u<u<<u<u-<uA<uP<ud<u<u       ;  ;  ; IT X_IT X_IT XKIT XPIT XdEsEEE-EKE ( &aQ $ &,28>DJPV\bhntzu)))w<w  2       o p r ~  Z`flrx~RTMvMvvvMvRTMvvvMv 06<BHNTZ`flrx~""!"T"""e">"e"%z-h%z-h 2 ( , . 0 6 ; ? @ D F H N S W $ % &"""4> <BHNTZ`flrx~Trr mmhmnmmmmr mm>mm,mmJm mm>mm,mmJm !'+2 ( , . 0 6 ; ? @ D F H N S W ' sLiLiLiF 28>DJPV\bhntznNN>NN,N$NJNNN>NN,N$NJN!#'+= # ( , . 0 6 ; ? @ D F H N S W          e f h o p r ~   $*06<;0;0B0L&&p7&A&;0;0L&&p7&A&  *  $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|k}VWUC}@;&&& &w&&&&&&&&&&V&&&&}+&&&&ks&&&U &&&d&&&&%&&&&&&&&&m<&&&&&%%k<w7nXkz&z&&&&&&&&&m}kk?&&&H&&&&&&&&&&1&&f&6&+&Y&&;&:&x&&&g&&    gBgggDgJgggggYgCg4gg4gggg9g#gg!g gggBgggDgJgggggYgCg4gg4gggg9g#gg!g ggzgzggDD%%&&&&d&s&kk& 4  k@&&  4 :$%&'()*+,-./0123456789:;<=DFHIJKNOPQRSTUVWXYZ[\]  (ASabcqry !"#$%&'()*+,-./012345678LT2?QTVY[_dqtvwxy{~LMTdeostuvxyz  1 |     #  !$) , . :  ;  !< a p@ r rP t }Q [\rx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|&.&&&o&&o&m&2&Z&&k&;&;&d&fYcd&,g^<}H&4&t&)o&&o&t&&Y&,Z&.&&o&&o&m&k&;&;&H&4&t&)o&&o&t&j z "(.4:@FLRX^djpv| $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|Nrc:rvNr).2sx ]rN:sNrrGppp ppr|ppUNcrH1r:2xJVA@8+<J4A.V@8+< rxu$%&'(*+,./012356789:;<=DEFGHIKLNOPQRUVWXYZ[]  (AHabcqr !"#$%&')*+,-./012345678L?QTV[_qtvwxy{~LMTdexyz| |     ( &,28>DJPV\bhntzjejddYdddd2oj}c}UabQ<a 3hntz "(.4:@FLRX^djpv|cU$QQQ$QQ$p|p|Q3$(,28<DHLRXHQRYabcqr*7QTVvM |   [ $*06<BHNTZ`flrx~ &,28>DJPV\bhntz|B d8/v,b|<#d,:),|BB8nm 1^"R nm 1^"R ,[$&'(+,/02678;=DFGHKLOPRVWX](AHQRYab*7?QTV_vMTz |  rr "(.4:@FLRX^djpvp@Xr|r|X/GOW  $####6 %LRX^djpv| $|xR>4S93^i<>tXNioovu{{b'7A|xtXNioovu{'7A%    d h r v w x y z | } !    h r v w x y z } ~ ! "(.4:@F4<tou]V p $ touV p $   &,28>DJPV\bhnt:Y+Z0.N:6xD:.N:6xD h v w x y }  u    &,28>DJPV\bhnt:='. .N:6rD: .N:6rD h v w x y }  t\\N>X  &,U64545 v y ! {*:.N          " ~ "(.4:@FLFFFF[[BBXXXXFFtt$&*-2479:;<TYZ[m}$&678:Vaeu Z ?IQ_bcf"*Bnprt"#$%&'67DGI w_F[BX.XF$')./2479:;<NSUWYZ[\m}$%&')6789:KVZ[au%@Z 9MQ[_cf",.024@RSTUVWXZ\^nprtwy{}!"#$%&'67>?DGIpq  ;7| ;/}&~ ; /7 ; 7; ~L  ~L8 L    LL  ;7 ;/& ; /7 ; 7; ~L  ~L8 L    LL  DFLTcyrlvgrek8latn)  !"#$%&'()*+,-MKD hSRB h)  !"#$%&'()*+,-*  !"#$%&'()*+,-)  !"#$%&'()*+,-(AZE CAT CRT DEU 4LAT TRK )  !"#$%&'()*+,-*  !"#$%&'()*+,-*  !"#$%&'()*+,-*  !"#$%&'()*+,-*  !"#$%&'()*+,-.c2sccaltcase,ccmp2cv01@cv02Fcv03Lcv06Rcv11Xcv21^cv27fcv47ncv80tcv81|cv82cv83cv90cv91dligdnomfrachligligalnumloclloclloclloclloclnumronumordnpnumsaltsinfsmcp ss01ss02ss05ss06$ss07*ss200subs6sups]EF[\!"$:@B<%&/?1 #qw "*2:BNV^fnv~&.>FNV^fnv~ (08nv~&6>FNV^px*.Pnrvz0  ( 2 6 H   !!`!!""""$"."H"R#R$R%R&Z&^&&&&&'<'r'')|)+^+|+++++,$,(,,,6,,,,,,,,--(-@-J-N-Z-d-h-z03333344:4X4v444455L55556$6L6l67J78(899999999999:::::(:,:::>:H:R:h:l:::>@BBCD D$D(D,D0D:FGHlK`LMM.M@MRMhM~MMMOOQQQRR6RXRRRRRILyOO y//O 0y 1yhr  8XY HHDRJ"    ' "  $*06<BHNTZ`flrx~ &,28>DJPV\bhntz "(.4:@FLRX^djpv|     $ * 0 6 < B H N T Z ` f l r x ~     & . 6 > D J P V \ b h n v ~     $ * 0 6 < B H N T Z ` f l r x ~     $ * 0 6 < B H P V \ b h n t z     " ( . 6 > D J P V \ b h n t z  $*06<BHNTZbjrz&.4:@FLRX^djpv| &,28>DJPV\bhntz  &,28>FNV^fnv~ &,28>DJPV\bhntz &.6>FLRZbjrx~"*2:BJRX^fnv~ "(08@FLT\dlt| &0:DNX`hr| (2<DLV`jt~ "(.6>DLRZ`flrx  &,28>FNT\bjpx~$$$$$$&((((,,,,1222228888<DDDDDDFHHHH    QRRRRRXXXX\\$D$D$D&F&F&F&F'G (H(H(H(H(H*J*J*J*J+K, , , ,L,- .N/O /O/ O 1Q1Q1QQ 2R2R2R5U5U5U6V6V6V6V7W7W 8X8X8X8X8X8X:Z<\<=]=]=]$D,L2R8X8X 8 X 8X 8 X $D $D *J.N2R2RyT *J1Q$ D $ D$D( H(H, L,L2 R2R5 U5U8 X8X6V7W+K$D(H2R 2R 2R2R <\   #               '  '! ' +  $ D%E% E% E&F'G' G' G'G' G( H ( H ( H( H(H)I*J+K+ K+K+K+ K, L,  .N. N. N/ O/ O/ O/ O0P0P0 P1Q1 Q1 Q1 Q2 R 2R 2 R 2 R 3S3S5U5 U5 U5 U6V6 V6 V 6V 6 V7W7 W7 W7 W8 X8 X8 X8 X 8X 9Y9 Y:Z:Z:Z:Z: Z;[;[<\=]= ]= ]KWZ\DA$ D$ !D$ D $ D $ !D $D $ D$ D $ D $ !D $D $ D( H( !H(H( H ( H ( !H (H ( H, ! , L2 R2 !R2 R 2 R 2 !R 2R 2 Rbcbcb !cbcb c8 X8 !Xqrqrq !rqrq r<\< \< !\<\      "  "        "  "        "  "      "  "      "  "        "  "        "  "        "  "  !!!  !  !  "!  "      "  "'''  '  '  "'  "' '     " +++  +  +  "+  "+ +         "  "          ! ! ' ' + +       "  "   ' ' '   '   '  " '  " '  '       "  "   ' ' '   '   '  " '  " '  ' +++  +  +  "+  "+ +  ' ' '   '   '  " '  " '  '      ' # # #       ' #   #  " #        #   #  " # '''  '  ##''   #   #   # + ++ ++     ' #  #" )/4EYbf ls'y*@ ,0 34""  LM!!  GOW EGIKNO  LM  * !!   *    : !'+< !'+< !'+  !'+whm        "g      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdeIFahi^xx`a!!b()cefg                           ! " # $ % & ' ( ) * + , - . /  ahi^xx`a!!b()cefgfghijklmnopqrstuvwxyz{|}~ahi^xx`a!!b()cefh 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  x u ahi^pp`xxab!!c()dfg);;   ;;  . 0  . . JU\u|X$%&'()*+,-./0123456789:;<=DEFGHIJKLMNOPQRSTUVWXYZ[\]   "$&(*+,.02468:;=?A# X Y Z [ \ ] ^X'(Y$%&'()*+,-./0123456789:;<=DEFGHIJKLMNOPQRSTUVWXYZ[\]   "$&(*+,.02468:;=?A# X Y Z [ \ ] ^8)*  ~X ~Y8   ,V;DEFGHIJKLMNOPQRSTUVWXYZ[\]+A V #  -M0#$DFHJPQRSTUVXYZ[] !5 # KNEIS    m}67    D  J & G / O W '       )  a7< $ % '    + x  ) " * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~ a b c d e f g h i j k l m n o p q r s ( ) * + , - . / 0 1 2 3 4 5 6 7 8 ` 9 : ; < = > ?  t u v w x y z { | } ~  & _ DEFGHIJKLMNOPQRSTUVWXYZ[\]  !#%')+-/13579<>@A !"#$%&'()*+,-./0          " $ ~                   ! # $ % & ' ( ) K M O Q S U W Y [ ] _ a c e g i k m o q s u w y { }  @ A B C D E F G H I J K L M N O P Q R S T U V W  ! ' l c b a d f h k e m j g  & & s $%&'()*+,-./0123456789:;<=   "$&(*,.02468:;=?      $ % ' C  D n   l l S n W ^WFVI IA AIAWGIIHWIIIALJIAM$*0KMRUG$*0LMHOOOMNLM OIAEKNO$,2PD.NND QEKNO AARhSI .69:!!;< > ?IfTW .69:!!;< > ?IjUIA .69:!!;< > ?LMfV .69:!!;< > ?OhWLM .69:!!;< > ? hXIA .69:!!;< > ?EKNO"nYEKNO .69:!!;< > ? fZA .69:!!;< > ?A  I hW  IA  IA  LM  IA EKNO A  I hW  IA  LM  IA EKNO A4   \ w AW ]W4TAB$.8     K7_4C$,.3 5=DIKKNNPR U[#]]*+2APT[`dvyz{  "#&368:Abcqr     X ^C$,.3 5=DIKKNNPR U[#]]*+2APT[`dvyz{  "#&368:Abcqr     X ^*`4C$,.3 5=DIKKNNPR U[#]]*+2APT[`dvyz{  "#&368:Abcqr     X ^>$,.3 5=DIKLNR U[%]],-4CRafj|  "#&368:Abcqr"#    $ & ( X ^):$,.3 5=DIKLNR T[%]]-.5DSbgk}  "#&368:Abcqr   ) + X ^,a4JMS\b4 -@`c ~ " * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~ _ 44 4 4    eIA Xk "">@ EE KO ^`pp!"#$%&'()*+,-./0123456789##:@A;=>?@%%A''B))C77D99E??FAAGEEHGGIIIJKKKMMLOOMQQNSSOUUPWWQYYR[[S]]T__UqqVssWXYZ[\]_cdejklmnopqrstuvwxyz  {  |}~"#%&0289<>  &fIA XrEKLMNO#@A%')79?AEGIKMOQSUWY[]_qs   RgIA XDFHJQUVY[] ! !!  hAx "">@ EE KO ^`pp+23456789:;<=>?@ABCDEFGHIJKL  MNOPQRST##U++V--W//X11Y33Z77[99\<<]>>^@@_%%`''a))b77c99d??eAAfEEgGGhIIiKKjMMkOOlQQmSSnUUoWWpYYq[[r]]s__tqqussvwxyz{|~    "#%&0289<> "(iAEKLMNO #+-/1379<>@%')79?AEGIKMOQSUWY[]_qs  "TjADFHJQUVY[] ! !!    IA X   IA X   IA X  A  A  A &lIA X     IA Xn $%&'()*+,-./0123456789:;<=DEFGHIJKLMNOPQRSTUVWXYZ[\]   "$&(*+,.02468:;=?A X Y Z [ \ ] ^   $ p|$%&'()*+,-./0123456789:;<=   "$&(*,.02468:;=?|$%&'()*+,-./0123456789:;<=   "$&(*,.02468:;=? H;7H;rH;/D7H;sD/7H;tH7;u".4:@FvH; 7 / H H D H H+1R PfEd@ D ,@, dd~>EQSW]adtz~_cpw "*.1:<CJMRX[eEMWY[]}    " ' * 7 : > D I K N W ` q !!!! !!!! !#!'!+!9!K!P!!!!!"""""""&"6"<"A"`"e"k"o""##*$%&&&~' 'S'W'g'*v+F,..%.)...;00 1CIQSWYk @QSW]adtz~bpr  &,03<>GMOV[b HPY[]_   $ * 2 9 < D G K N W ` p t !!!! !!!!!"!&!*!9!K!P!`!!!!"""""""#"6"<"A"`"d"j"n""##)$t%&&&~' 'S'W'f'*t+E,`..".(...:00&BIQSWYkrmjedcb`^]ZLFEA?32~d\N"  srqokhf_^\ZM<8)qnjhi9Dܼ=42.#\X`>`.`)`"`!``` ___'  t ~b>@EQQSSWW]]aaddttzz~~178;<?@_Abcpprw   "&*,.013:<<>CGJ MMORVX[[be !"8 E>HMdPWjYYr[[s]]t_}u   "  % "( $ '+ * */ 2 70 9 :6 < >8 D D; G I< K K? N N@ W WA ` `B p qC t E ` m n o q r!!s!!u!!v! ! x!!y!!z!!|!! }!"!#!&!'!*!+!9!9!K!K!P!P!`!!!!!!!!!"""""""""""""#"&"6"6"<"<"A"A"`"`"d"e"j"k"n"o""""###)#*$t$%%&& &&!&~&~$' ' %'S'S('W'W)'f'g*'',*t*v0+E+F3,`,5..U.".%V.(.)Z....\.:.;]00_00 `&1dBCpIIrQQsSStWWuYYvkkwxz{LM   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`a(rdei*xpkvjsgw"l| cnTm}-b%&"#:;p67)y$'qz!*,+3!'3#! f!Xd @W:GWCH +462"'&2"&4r(2##2#VH''#2##2> %5%FK(PX@ oBH@ neY$+$# +47632#"=4&4&'747632#"=4.45>/ / l Ej9  Ej9  @@ *  ? FK!PX@Il  ^^ _  ]]_ BG:G>H@Hlm  ^^ _  ]]_ BG:HY@@@=;985321-+&$""!"## +?#"=7"54?"54?632?6327272#"=7r!q1, ,?C"@E*)q+*; 8"= :+ + Ƴ  / /   $# 5 er@QLF  b  qf<;, # FgE   l  j  jl[ 74#.5.'463223254'.5467657632#"&'.#"3>54&'&*9G% # hf  9  3 ! >E^T A 1:4AsB(46 $GwL 5 ^ :J  +U74i  O (?h ;EX1&2=KPX@3  ` _:G W :G WCGCHK(PX@1  _  ` _:G WCGCH@1o  _  ` _:G WCHYY@%43(':83=4=.,'2(2#!&&&" +632#"&542#"&546"3264&2#"&546"3264&  d  ;;BLC=BP6%% %];BLC=BP6%% % wfEMriKFpZ2=n^pifEMriKFpZ2=n^pi%W zK-PX@ idRC( F@ idRC(  FYK(PX@3l_ =G =GWCGXCHK-PX@5 lj_ =GWCGXCH@;  l  jj_ =GWCGXCHYY@ ywvt^\MK@>:8/-z z-% +7654&#"326?'.'%232>7632#"&/#"&54?'.546327>54&'.5432326 7(*9!,D/3L' (J ) &(     %<4;+ '"""Gh R71J3. _ $J  < ExV1!1G; '1)->'* /M[ !' 1C, ! K?M  2<9./G a"'d  >-FK(PX@ oBH@ neY$# +47632#"5654.'>/ l Ej$ (* @W<H(" +#"'&5467632 ;yq?  =[]7 ;*wu? =v|7$+ @W<H- +"&547654&'&5432 |; 9gb< @ow;  9yv< @"t352@/2)"F__WBH%')%'! +432&'43267632#"'.'#"/#"54?&'&":  4 I/# :  4 I/# A+2\ : +2\ :2&&!@n_;H$44$31 +;2+"#"&=4+"&546;2=4632J  " $     mu&@#oSWK  +"547>54&'.54632$'9!$/c 50 7*Eb @ne +7"5467672# @#3<`@WCH +62"&4\. . ` . .|@ FoBH&" +632#"574) /I ( -@*W=GWCH      +2#"&546"32654&Y~}XY}}^=PG:AMF{WZZWz)_IEmWZCf4uEK-PX@W=GW>HK2PX@W=G>GW>H@_>GW>HYY@ 1/-+*('%) +74.#"43232632#"&#"#"543>m !11  := D      7A@>3FljW=GW>H0.+)77 +'&#""54767654&#"#"54>323267632kAB(O($I+ $:!.:)[  3 ! (oR#+0 I212W" ] $B?5J@Gljjj[W=H20-+! 55 +2"546327>54.#"#"546767654&#"#"5461;*4?<*6 0-- )" & (#) ^9/!OC(Q  ?B&$ $F% PK,7,@)oS_=H.--7.6T&Se# +>3233272#"&#"#"=4&#""54?2=4&37 , " 1  )5  y ;;  04C5%@o=H%% +"547654&'&54767>32V"!E42 j )Q L<& /Y;B 1  *<I$[s)0QK#PX@_:GWCH@n_WCHY@,*"  00 +"&547>732327654&#"&767>32_`s*U GY":(+7'3  ;4Ilq^0\9eE*%!B/G  F5Uw?(%@"lmW=H'Q&"C +6&'&+"#"5476543233272#"&547X uY *  N  92" # %=M1A(@%l_WCH86)'&%& +32654'&#"7#"&54>76&'.54632'654&#";.*7n Q=8nGA`,#'"hB:Y0"  60"%:3 *1J6(BK0(B4GcS>1& (B%6DF62) ,X$9.! ')F,3@0#Fo_W=H(& ,, +2#"547>7654&#"32>76#"&546If~,1 *!LJ6-3;'  -/5LptX|+Y  p+e~?XE*/N  !I5J}Fu@_WCH +2"&42"&4f. . . . u!,!!, . .mu0@-o_SWK   +2"&4"547>54&'.54632T,!!,!'9!$/cu!,!!, 50 7*Eb5@FW;H& +7+&#%&5467%2172| S)      "2l"=@:F_SWK""  +!2#!"&546!2#!"&546J  C   C l    5@FW;H! +-.546323""5467%6 ) K u    "dU#+5@2lWBGWCH)(%$ ## +2#"&'&5467>54&'"#"&5462"&4:2)4*1%05%41  2##2#2)p(=< 8' '3?$#2##22}O@ %(FK-PX@Ell   l  __ ` S W K@L  lll   l  __ ` S W KY@'KIEC@>;953/-#"! OO +"3276?654&"."#"&5463226332654&#"3267632#"&54632.H1"'B  53C}V) 7Oi{y0y& Nz2Ԙq{EQE1- $g:3Xo%+ LHKPX@#nl`:G>H@ nnn`>HYY@BA<;1/.)!KK%4 +;254/&#""&#"#"547654'&+"#"&#"#"5476767>4367>2MZOI fJ !=& (!!?R!<`[ Jh.$!  # t  ;  7'  =Kx/FK-PX@! _W:GX>H@% _:GW:GX>HY@?>GE>K?K&$#=:  +%2654'&#""#"547>54&'&54232632#"&27>54&#"<`J-;&DK!(&$!:8? qm"%&1%D\B5?0" %<)':& "s 0&6N%.l.4@1  FlWBGWCH%.$)$ +%>32#"&54632'&'&'&#"32J  -@hؔFH( 3`k54&'&542;2632// un ) /;!&&!:8 y'   $#  YK PX@2d l  _W:G=GW>H@3l l  _W:G=GW>HY@WT)#54$!Z2 +7;27676#"&#"#"547>54&'&543232>32#"'&'&+";27>32#"'&+"#h5  D/B!'#&!&i"(jJ+  `,   ]f%0  (? !##  Q / ' * 6- RFK PX@2dl_ W :G=G>G;H@3ll_ W :G=G>G;HY@PJ!!b'#W4! +#"'&'&+"326327>32#"'&#"&#""&#"#"547>54&'&5432372  + S ,    " !*$!:4J!&$!%e"  $ ' #,'|B"%  !$0.  -G6@3l_WBGWCHFD@>!S*$%$ +#"'&'.#"327654654'.#"&463232632#"&54632m  S>qjU% BJ6 Fl8ٗ*pM# #z%/)    $'  " %WRK-PX@` :G;H@` :G>G;HY@QJ7m!!(7! +%"&"#"5476=4#!"#"&#"#"547>54&'&54232623!2=4'&54323262$!:8&<!D,#!C>!$#!:8::!DsB!C.:!"d'   < -  %%   ; :   !B)@:G;HQ- +4&'&543232632#"&#"#"547>5&!C=!' '(!CL!(&&#  "<"!  !"8,'HKPX@d\:H@l\:HY@%# '' +254&'&54323262#"&54632@B%!C1:!$ .M.9 !'"  $gKb=B#\YK-PX@`:G>H@`:G>G>HY@MG><4- \\ +"&#"#"47654/&#""&#"#"547>54&'&5432326232?654'&54;2632R .=!:4J!&&!?3:!# 6"!^:`` #")! ;K   !%"   !  1Qj ' ?6)@&Fl:GX>Hg%3 +;26767632#"&#"547>54&'&543232632/&   G.)('!?J! 7)! +V)  #   aeqK-PX@"  l  j :G;H@.  l  j :G :G>G;GCHY@_\[XSQLG#)!* +#"&#""547>544#"#"'&&"&""5476754&54'.'&543232327>;26;2 $&!C9:!   8{  B:1 .:!3 )  $P 8S)!   $b>0   E3  !4o  .  FkK-PX@!lW:G;GCH@%lW:G>G;GCHY@;94/#"!  FE +2632#"&'&&#""&""54767654&'&433232765.'&543h= !% 0  @!:1 .:!312S( ] '! 0!%D   D10 I@W" -&@#WBGWCH&# +4>32#"&"32654&-Ml,SOJjlnt@]bD}b:o5iK-PX@$_:GW:G>G;H@+l_:GW:G>G;HY@ "$!M!!" +4&#""&#"#"547>54&'&54232632#"&546332ZM@C!:4N!'"$!:2N qvn yXT*#K   !$0. `Pb -x+87@4lj[WBH-,31,8-8(&" * +.'.54632327632#"&'&"32>54&vX GD-˚Zl%7JA!/I2V;(  9GW;GWCH@*:GW:G>GW;GWCHY@MKEC><;7*('%$##( +32#"'.'&'&'&"&#"#"547>54&'&54232632'4&#"326-#O,2)5^,,#!$+C!:4N!'"$!:2B Z9N&CSE D3_( 6502  J   !$0. l\FPap X)6@@=lWBGW:GWCH31*( 66 +72654'.5463232#"'.#"#"'&'&546327<=BrW7! >+0C3hhS3  F>5Tf)S7Dc )+0;1+*ctEk &MB++Dm6FK-PX@'lj54'&+"#"547676323!27>2#"'&+"xO!CL!''7/.    ;}&  T_&f@  $#(  .A  B! ).5!@F:GXCH)$ +#"&54'&54323263232654'&'&43232632 o.!?6 !r`dc'!.6 !/# tv3<  )tty=b   7'@$l:GCH-+!75 +2632#"'&'&543232632327654'&432*R !"3  0!SI!'   C!  18G;   ^ }6@3l :GCHf^WUJHA9" }} +2326322767654&54323263276654'&43232632#"'.'&#"'&'&543232632?64/.'&54&<4 )% $ !!g&T! . > !5 R 8:  0!9@!MW N9 6!  =4 -D   #X  e#   L$FF 4   , g1@.l:G:G>H[YME2*gd +2632#"&#"#"47>4/&#"&#"#"547>?654/.'&54323263232?654'&5432)Q !*Xs/W!T}+!fF! ![  k-! 6 h E  "   4# !(  .  mM@:GX;HIDCA) +%54/&'&54323263232767654'.543232632#"&#"#"5476u7"! O6 ! \ %/) .H 5!;4)&!CM!Nl-X   &&8S   $0[Y"+  LDP@M,FljBGW:GX;H<:74*$" DA +"+"&'5477654'&#"#"547676323327232767632#"&PM:kHJM4   >4]xo =z 0A?NT(  <NA!" E*Qݽ^ pp8M!@oW<H +2"+"&546l p ' K {@ FoBH&$ +1#"''54632z / $8!@oW<H  +2+"54?>54&#'&43 p l  0[@De-% ++&'.'&#"547>4  .$4  [Y  >5M  +J|&@#FSWK  +!2#!"&546  9   (@oBH%" +4632#"'.( !G "G!| $ /M!#3AJ@GljjW=G WCH?=86/-(& 33 +%276".#"#"&54?>?6&#"#"547>32'3276?6#"V 72!7$7If"&9 (T$#0   d  *2<* @&     "#-4%M7 1"<{8FKPX@&G>GWCH@)lGWCHY@5320/-)' +%2654&#"'4'&547>7372>32#"&#"#"&=>8CJB<R/'+ #RMgrk%l eMBp?y3@X?  1 sR`#t!KPX@$djW=GWCHKPX@%ljW=GWCHKPX@$djW=GWCH@%ljW=GWCHYYY@ !! +"'.#"326762#"&54632M  #4:YF%i=JayZQ'? ZGWCHK PX@7llGWCHK-PX@7ll32326##"546=#"&54632%(!2-)6D684A D-Rg|e5{"F/5M$4%.N & >(=USMKDB=H>H75310.+)." +#"'#"&546767.547>7.5463232632#"'"32654&32654&'&'#h`C!,`*(?# NKm7"8AhFC! ( (17)%36E:H@G>HY@DB98!*(!% +%#"&"#"5476=4&#"#"&"#"547>54'&5476?2632)("(';"7 %&"+ -[UB1AD    $6     @  ">/ ?N:h&/+g&/+]K-PX5F5FYK#PX@HK-PX@H@GX>HYY@]XFDC@-,+* +74654/&#"&"#"547>54&'&5476737276767654'&54;2632#"&#",~#!") XZ 1H )i $]$.|!   -/    #! !  =% O"   \ +e" %8K-PX@H@G>HY@  +7"&""54767654'&54767372 (,",(!.[>     ?  ">(~qFKPX@(l =G W=G >HK-PX@(  nl W=G >H@,  nl W=G >G >HYY@|ztrkjTRQPOMA?!#(!( +%#"&"#"54727676=4&#"3#"&"#"547676=4&#"#"&"#"547676=4&'&547>7263267632 )"-!0 5"  ,"-!0 5" +"+!  HVC =S.6>    %:3    %:4     $  2 C< 8S8R1 FKPX@#  l=G W=G>HK-PX@#n  l W=G>H@'n  l W=G>G>HYY@JIFDCBA?42+* RR +"#"&"#"547676=4&'&547>72632#"&"#"54727676=4&<  +"+!  F[0A *",!1n4     $  2 CP;    +2# -@*W=GWCH      +2#"&546"327654&VxwkUrI9 P:KPwR^rWV((]Mu7'OKwOܵ*FKPX@'=GW=G>G WCG?HK(PX@'W=GW=G WCG?HK-PX@%_W=G WCG?H@)_W=G WCG?G?HYYY@IGFEDB7642.,$"  +%2>54.#"4&'&5476?32>32#"&'"#"&"#"547676)+/(0&{*Je*JZ\@ 9"+!&I/6L! 6+ 0*53   . /rK\ 3    #  DKPX@8  l  l=G=G  W =G W CG?HK-PX@8  l  l=G  W =G W CGW?H@<  l  l=G  W =G W CGW?G?HYY@B@<:86/.+)(&%$!   +"27654'.72676323"&#"#"54727676=4#"#"&54632:RcpEh  (4+!'XSun=~_RZ[nO-> Q"    "gYj I:%FK!PX@&dj=GX=G>HK-PX@&ndjX=G>H@*ndjX=G>G>HYY@97640.*($"! !& +#"&"#"547>=4'&547>7243232>7632#"&#"51"+ ) $  0,* )   ?   0 +$&%0;@8ljW=GWCH,*&$ 00 +"#"&'&'43232654&'.54632#"&5.""(%@ :##$(-3BD4&$(9x & .& ' 9!1E9$#2*^ FK#PX@nW=GXCH@n_XCHY@#!** +"&=4&#"&547>32;2+"327617 1 r c &2 9;< ,& ,03+ AL@ )FK PX@)l=GW=G>GWCHK PX@,ll=GW=GWCHKPX@)l=GW=G>GWCHKPX@,ll=GW=GWCHK-PX@*ll_=GWCH@.ll_=GWCGCHYYYYY@ #&)&#& +32326##"546=#"&=4'&5476763276=4&'"5463> 4A H]3?+ #D4 :-*$  9E3 G>9( .$7!*0OK-PX@l=GCH@lj=GCHY@ )!# +&54322632#"'&'&5422622?654&0( $ N% z($"&(JHz  &d-'8(   # (RDK(PX@=GCH@nCHY@NLKIHF310.-+W&" +#"'&#"'&'&543632?654&'&543232632?654&'&543232632fhm%ILLB /7 "KL * 8Y&   " '       ]S7FK2PX@=G >H@W >HY@]XWUGEDBA?.,+)(& +74654/&#"&#"#"5476?6/&'&543232632?654'&543232632#"&#"#"86C' '(U Q#  ' (1 % $0Aa' 2   \b   1j ~#   > K   !\# B\K-PX@d=GX?H@"lb=GX?HY@A?310.-+!-!! +43232767654'&'&54322632?654'&43232632#"&  .-t#"&OC+ " ./  Ow  %)     &Jp*)tB@ <$FK-PX@+lj=GW=GW>H@)lj_=GW>HY@:310*( BA +%26?>32"&#"#"&547676+"#"&76546232632723' A: %Jpu    $_[ #&'Z  2j   (2   fR1[@ FK2PX@l[W<H@ l_SWKY"("( +32#"&54654'&54627654&54632#"ZK K6Pz _ _ zP6K E'P,n#32 DA$pQ##Qp$AD 23#n-Fd @] t, `j#1!~W0  Z0AL+@(_SWK  +"&54>32"&462~  2##2#* (#":**#2##2#5P@M-5FnlloW=GXCH""%&-! +7#".546?632#"'&'327632#"&7#9J5'A^sXG$"" W5i 5Ke=@XR tIV2 1,  ) +X3uRJ FK PX@Gd  lj  j _  _W:G CGWCHK PX@Ed  lj  j_ _  _ CGWCHK PX@Fl  lj  j_ _  _ CGWCHKPX@Hl  lj  j _  _W:G CGWCHKPX@Fl  lj  j_ _  _ CGWCH@Cl  lj  j_ _  _[ C HYYYYY@RQLKA?<:%!%$"&## +4>32#"5465.#"72#3232654&5<>3#"&'&#"#"&54676767"&546?-fFe +1: u5?." \=.A1(  <$T  KUGZR%0y =|=!  9T" 2 0&C8D@A85 ,)FS__WK#-##' +"264%&546326327632#"/"'#"&54?&47,vSSvS -6AD2. -''/ .22/ /''UxUUxh -)). -33/ .)). /32jksK PX@(d  `  `:G;H@)l  `  `:G;HY@igca^\XVQ&#!#() +.'&54323263232767654'&4323263232+32+#"&#"#"547657#"&546;54'#"&546;&''! O6 ! ]8!.B !(&'&'&67654&1  &!h<-0G$$*4  "^!! L&X +/X + ("%7]6fF3F1S+  R #`T>S'1NZ& *2R1Z& *2R)>@SWK +2"&462"&43&&&&>&&&&+v'/:FKPX@1lj_ _  [W:H@7lj__ _  S W KY@75$#$%! +%632#"&54632'"'.#"322"&4$"32654 SFesM,!2??7Bښmn $jDH^+ M8;Xmnom  3?Nf@cF Fljl_  _  T  X LB@JG@NBN86.-*($# 33 +".#"#"&546?>=4&#""5467>2326?2'3276=432+"&546 $'O # (  <.&  A    )   |' Jd@7U@ 1#FKPX@ =G>HK#PX@ W=H@SWKYY-+-* +%&'.54767632#"7&'.54767632#"C^o P c:6e ^o P c:6e %^3WM l-*p ^3WM l-*p 2+&~&@#oSWK  +"&54>3!2#"&=4#@  "B   +vR]K PX@>   l   d ___[W:HKPX@?   l   l ___[W:H@E   l   l_ ___SWKYY@#\ZWUNMLK=;:986,*'%! RQ$ +2"&4$"32654'23262#"/&#"#"&"#"&547>=4&4&4&"&#&5434&#"326ښmn*>B (:$  $    %&,vmnom<*%)o a L      SA!,   @[W:H +2654&"62"&4H+<++<+`HI^I ,,++[E`NN`2&c,=w@ 9FK&PX@"nl\W=H@(nl_SXLY@.-52-=.<$44$82 +;2+"#"&=4+"&546;2=4632"&5463!2#@              ?5@2$Fl_SWK><-' & +&54632;26762+&#"&54?>54&#"*G.&5  -* E)  3!H3'"B7& -& 8# ("$$.5@ 'FK PX@4ljbb_SXLK.PX@5ljjb_SXL@6ljjj_SXLYY@1/*(%#! 55 +"5463232>54&#".7>7>54&#"#"&763232pB ! &   *%BX;(]!"  HG%,7=<@o:H  +2#"54676#E" D K/ !JR@OFl XCGW=GWCG?HDB;931%# JJ +%2>32#"&'&'#".'.#"#"'.54654&54632327>54632! >$ 9'   + '0H&'0!@ 4?%&4< "$F"P73@C$2K;H#I33!2?"@.)2K PX@8ljbjjW:GX?H@9ljjjjW:GX?HY@ !$$%"%%$" +32654#"&54>32#".#"#"&54632#"&#"", iY_-  2 @1$4)! "/#tS|;  'R.#&-@SWK +2"&4N,!!,! . .o j:'VK-PX@nSWK@nlSWKY@'' +2#"&"#"543>=4'&547> " %' 6 5"Z 7     &H@EF__SWK "&&    +2#"&546"32654&32+"&5461KH@3HP, *  )    H08PC58P!3&*=3')=d@7R( FKPX@ =G>HK#PX@ W=H@SWKYY-+-! +%#"5467>4&'.5432#"5467>4&'.5432a e6:c P o e6:c P o% p*-l MW3^ p*-l MW3)w+T_k@ [ =FK PX@3  l _  ` :G;G W C HK(PX@3  l _  ` :GCG W C HK-PX@0  l _  ` [ :GCH@7l  l _  ` [ :GCHYYY@ VU-,jhdbZYU_V^NI;631,T-Q"!/! +632#"&"#"543>=4'&547>"#"=4#"#"&76767676;272#"&'2=4"3632#"& " %' 6 $% [e .  W'6  d  r*I4      T f){2 uJ (o+E w )+9y@ ^ j FK(PX@4  l _  _:G X ;GWCHK-PX@1  l _  _[:G X ; H@8l  l _  _[:G X ; HYY@xvhbZYURB@860."!/! +632#"&"#"543>=4'&547>632#"&%&54632;26762"#&#"'&?>54&#" " %' 6 $  d  FG.&5  -* E)  3!H3'"r*I4      w B7& -& 8#("$$5w(3Axa@h W /FK PX@R  l  b  j b  l   ``:G W:G;GCHK PX@R  l  b  j b  l   ``:G W:GCGCHKPX@S  l  j  j b  l   ``:G W:GCGCHK(PX@Q  l  j  j b  l  _   ``:GCGCHK/PX@Q  l  j  j b  lo  _   ``:GCH@R  l  j  j j  lo  _   ``:GCHYYYYY@/CB*)trmkecRPLJHFBxCx><86.-)3*2" (% +%"#"=4#"#"5767676732;272#"&'2=4"3632#"&54"5463232654&#".7>7>54&#"'&7633H% [e .  W'6  d  D !"*'   $  $$ %BX; %^lT f){2 uJ (o+E w!#&.   HE%4#8G(K%-9@6l_SXL+*'&!%% +"'.546767>74322632"&462:2)87# 05%41  2##2#2)t'"4   8' '3?$+#2##2F'$F'?$('$!'$'$L' $O FK PX@B d  b jlS _ W :GW >H@C d  j jlS _ W :GW >HY@}ypbZQN!k4B'%C$4 +;26=4#"3276767>32#"'&'&#";267676#"&+"#"547>=4&+"#"&#"#"547>76&/&5432326;2#"'&'&+"| V 00     #*=! h<  >,B!&# $. A!>W!: X x%A   + E    #,%- 0  %B  ! =Y$  7$   :- $  .l'+& F'( F'( ('( '(BF&.,BF',B(&,B&,!' 1-F'2-F'S2-('2-!'2-'2l5**@' FlSWK,$ +?632#"/&"'&54?6/&5476"  y +  y  1*2<@910(FWBGWCH,+ +2,2'%* *" + 32654"&54?&54>3276#"'"&MKmnt  KTMl^PHL,SO|aP)j,yAbpQ  J^~]bUO  HY}D}b:SPonOp`F'8F'Z8<'8/+'8mF'< KE@BS`  _:G;HDB?=5.!KK  +%27654&#""&#"#"&#"#"547>54&'&5423263232?632 >#@H7"3#O!CN!('#!:8E!(& -Wt/ j/c=_  :  ""!"   "\U$eS~)FK-PX@+ljWGWCH@/ljWG>GWCHY@MKIGDB+!(* +&54>7654&#"#"&"#"54765"'.47674>32#"&463232654.')>)4C2?*'")*$+DG$?T.! ]&E!1+ .("&"$2+6,B^`j     R|B P67, Z'6-N  '$!#&:D#'D#&5D#X&'D/+#Q&+D/+#&PD# jf@cU F  l j j  ljW=G W=GW CHig\ZTR%"-&%)/%" +73276=4#"77>7654'&#"#"547>327>32327632#"'&#"#"&54?>=4&#"s  45 \289 (T$*A,I J_ XE* #I7=0 "7Ih !&W 4*C " 2"    "#.  2- !) 8S0 3.(  29!/ B'#tCK PX@Bdj  d j bW=GWCG X?HKPX@Cdj  l j bW=GWCG X?HKPX@Dlj  l j bW=GWCG X?HKPX@Cdj  l j bW=GWCG X?HK-PX@Dlj  l j bW=GWCG X?H@Alj  l j b  \W=GWCHYYYYY@B@=;9853$#  CC +"&54?#"&54632#"'.#"326762#"54633254&#" GJayZQ'   #4:YF%M4 #[" '  ZsO_0  Z@;(%!F"32654&0jGVx\1+(N\/v6eKruUpX]h0PEJ 2+5! 'zQfDLvJKVX&jQ/+#&qR#'R#&lR#X&^R/+#Q&bR/+2E!B@? F__SWK +7"&5463!2#'2"&462"&4@   &&&  &&&&'0?@G WCG ?HK-PX@3l  l<320.*(  +%2>54.#"4'&54767372>32#"&'"#"&"#"5472>5)+/(0&x.[c*JZ\> )")  &I/6L! 53%?  ">($/rK\ 3   Q&V\/+ '$#+& D /+4'$#`&D/+RaKPX@2   l  `BG:G>G;GW ?HK(PX@4  l  j  `BG>G;GW ?H@/n n n  `>G;GW ?HYY@a_ZWIGC@75/.$"! RR +"&547&#"547654'&+"#"&#"#"5476767>4367>32#"'32>76;254/&#"/CU!=& (!!?R!<`[ Jh.$!_X' [ZOB/UZ  # t  ;  7' KP#  I=# Zh@eJIFljj   lW=GWCG X ?HWUSQCA<:53*(ZZ%" +73276?6#""&547.#"#"&54?>?54&#"#"547>323276132>32s   d.7l 7$7If!&9 (T$#0$ "N"?W 1"]75ST2<* >&     "#-4%G@O % =.lF'Q&#t'F.l('&#t&\F.l%'A&#tR&wF.l7'&#t&[F/+7''# ' G)JE@B;98F_W:GW ;HHC><64/,%)) +"&#"#"547>=#"&546;54&'&542;26324&#"32+32632>s/;!&E ;&!:8 ª`t (   + ' Im3  $  # ax `#DU@$"!9 FK PX@>  l `G W CHK PX@A  l  l `  l `G W CHK-PX@A  l  l `3232+326##"546=#"&54632"326=4&R 8Q  ?4A D-Rg|e5h%(!2-)6D   # 9%WA3 +|P["F/5M$4%.N  '(h+& H /+ 4'(h`&*H/+ %'(hR&dH nK PX@>d  l  _W:G=G W >G W ?H@?l  l  _W:G=G W >G W ?HY@!ec_]SPKHFD;963.+'%! nn +"&547&#"#"547>54&'&543232>32#"'&'&+";27>32#"'&+";27676+32>76}/CB!'#&!&i"(jJ+  `,   ]#h5  ;S' [B/QY !##  Q / ' * 6- %0  (?IM#  If ?a@^Fl  l_ W=GWCGW ?H <:86-+)'#  ??  +";27654&"&547#"&54632+"32763232>32'?R/ 2.7gFbsTG;HY@mkhf_XRQKE><86!!(7!2 +!3!2="&"#"5476=4#!"#"&#"#"547>5#"&546;54&'&5423262!54'&5432326232+ZxsP$!:8&<!D,#!C>!$@ 6#!:8::!DB!C.:!"C  1a 7'   < -  %e  ;%   ;;<:   !< YK-PX@F NTF@F NTFYK-PX@$   _ H@(   _ G>HY@WUQOLJED$(1:(15 +%+"&"+"5476=4&#"+"&"+"547>5#"&546;&'&5476?232+632+)"%'<"7 %$") 6 ,+[  zUB3@D    %5       ;  "9,  ??9B!&,X&/+C &,+&  /+B4&,`&/+B@+@(:G>GW?H751-  @@ +"&5467#"#"547>54&'&543232632#"&#32>76/CX5L!(&&!C=!' '(!9W' [B/1[" !"#  "<"! JP#  If D(FKPX@)  l_=G>GW ?HK-PX@,l  l_>GW ?H@0l  l_>G>GW ?HYY@ A?=;7653'% D D$" +4632#"&"&547""547676=4'&547>32#"&#32>32D5.7g+(!/9   %8"?375W^   ?  \+  CV % =B%&l,$iK-PXFFYKPX@=G>HK-PX@n>H@n>G>HYY@ $$ +2#"&""547676=4'&547>  -",(!/9 \+     ?  8'-a,h'ML/+85<& -/+&'.&NYK-PX@ Y%F@ Y%FYKPX@=G=G=G>HK#PX@n=G=G>HK-PX@n=GX>H@n=G>GX>HYYY@OH6430!% +7#"&"#"547>=4'&547>3276767654'&54;2632+"&+"54654/&#!") /9   [ 1H )i $]$.M:,~A    ?  \+? O   \ +e"    ?F'/\' O/+?'/&O?' / ܰ/+' O?' /(' O:F0@-0)Fl:GX>H?7g%; +76;26767632#"&#"547>=&54?54&'&543232632ͪ /&   G.)(AH'!?J! 7?>! +V)  #   <aK-PX@ <4 F@ <4 FYK-PX@H@GW>HY@ 86.,+*18 +7+"&"+"5476765&54?54&'&5476724327632 )")!6 = [9 :>       !3 ">( F'o1'Q'+1'QK'1/+&wQ/+& Q ް/+UK-PX@+ll \W :G;H@/ll \W :G>G;HY@JD:83.!  UU +"&5463232654'&&#""&""547>7654&'&433232765.'&54;2632-J &$  @!:1 .:!12S( ] '!9= !% > %]D* D   ;10 I@W"  DkKQK-PX@ $)F@ $)FYKPX@)l=GW=G>GW?HK-PX@)nlW=G>GW?H@-nlW=G>G>GW?HYY@NLCA@>86-+#!!% +7#"&"#"547>7654'.'&4767632>32#"'.546323267654&54&#"*)") 4:m*2:M-* )(3(4)E    /N: + 4 0>9 29<7  #13:+20- '2#+&B R /+-4'2#`&MR/+-R'2#'R-fK PX@G d l _WBGW:G =G W>GWCH@H  l l _WBGW:G =G W>GWCHY@!YVQNLJA?<941-+'!fc$" +4&#"32>5"##"&54>3232>32#"'&'&+";27>32#"'&+";27676#"&VCjl!&+- '-Ml+0 G(m+  `,   ]#h5  A+*o O Œ]b  Q / ' * 6- %0  (?# 8Fa@^ )Fl_ W =GWCG WCH:9A?9F:F42-+'%#!88%3 +;276=&#"%27672+"327632#"&'&#"&546"327654&R/K?b?8eHC" UB; T?*O>pUrI9 P:KP>2L M3(- Ic(  ;*%OrWV((]Mu7'OKwF'5I'U' 5I&UK'5/+I&3U/+)F'6-'V)<&Y6/+%&&V)YK PX@A  l   dbWBGW:G  W  CGX?HK2PX@B  l   lbWBGW:G  W  CGX?H@?  l   lb\WBGW:G  W  C HYY@!VTMKJIDBA?;97531 YY +72654'.5463232#"'.#"#"543232654&#"#"&54?"#"'&'&546327<=BrW7! >+0C3ML(Z'-  ? S3  F>5Tf)S7Dc )+0;1+*ct:b+  . /E "! U &MB++%RK PX@Clj  d j bW=GWCG X?HK-PX@Dlj  l j bW=GWCG X?H@Alj  l j b  \W=GWCHYY@QOLJHGDB,*&$  RR +"&54?#"&'&'43232654&'.54632#"&5.#"#"54633254&#"h G %@ :##$(-3BD4&""(a #[" '  Z & .& ' 9!1E9$$(9c!  )6Q) -)K&Y6/+%&%V/+d0FKPX@Alj l bG X ? HK-PX@>lj l b \H@<nlj l b_ \ >HYY@ca`^ZXVTRPHG)")2&$:C +4?"#"547>54'&+"#"547676323!27>2#"'&#"#"&##"543232654&#"#"&CH!''7/.    ;}&  Tc$O!= (Z'-  iZ $#(  .A  B! ).)9@ ,  . /E "! #2I)@  FKPX@9b  l  j jbW=GX?HK#PX@8n  l  j jbW=GX?HK-PX@6n  l  j jb`X?H@;n  l  j jb`SXLYYY@HFCA?>;9'%  II +"&54?&=4&#"&547>32;2+"3276#"54633254&#"t GY 0r c &21 #[" '  [n ,& ,03+   )6Q) -K'7/+#2' W İ/+_@ 7HFKPX@.(} s9-.    <]E[=     t$  r'(!CL!''i  (  .A O   ) %%  %(A;~@ (FK#PX@&n` W=GWCH@$n _`WCHY@;:##(###14& +.767632;2+"32+3276#"&=#"546;54.?1&  vg _  M+,I#+@* `6 -0 \ e. "8)} [('8/+X&cX/+ '8+&G X /+4'8`&RX/+L'(8'XR'8'XN1@.F:GXCGW?H)%)+ +32>76#"&547#"&54'&54323263232654'&'&43232632 H='2' [(/C.!?6 ![]`'!.6 !/# O| #Q(#  IB/QU <  )Zy=b   N@ FK PX@;l   l=GW=G>GWCG W ?HK PX@>ll   l=GW=GWCG W ?HKPX@;l   l=GW=G>GWCG W ?HKPX@>ll   l=GW=GWCG W ?H@<ll   l_=GWCG W ?HYYYY@KIGE?>;931,*'% NN +"&54765#"&=4'&5476763276=4&'"5463>732326#32>32r.7[H]3?+ #D4 :-*$  1/@"?75NR ?G>9( .$7!* 9E@T % =<'J:/+'Zm<'</+&`\m'</+LF'=t']L%'=tR&Z]L7'=t&>]/+N@ /-"FKPX@0  ` G>G WCH@3l  ` G WCHY@NLHF@?>=20*(  +%2654&#"632#"&#"#"=>5#"&=656;54'&547>737232+8CJB<RR 5]Mgtk%cQ  ?/'+ eMBp?y3@s ;sR_ 8  1  A6DRW@T Flj _W:G W>HFE87NLERFR?=7D8D1/(&66 +2#"&#"#"547>54&#"#"&54>2654'&#"27>54&#" "%&1%D\BK!(& -" "Os<`J-;&?0DM&BQ>" %<)':& " ""&% -+9Y?X) (N 3&3L%   LU@Rd_W:GW:G >GW ;H KIHF=;9730+*$"! LL%" +732654'&#""547>54&'&5432;2632"&'.+"327632#"&#"(%<`J-;7!(&&!C#  " 38\k$9gX:l"%Y?X)$ !"# ?  2`V5 "  J@ 0E FK PX@;dlWG >G  W C HKPX@<llWG >G  W C H@?ll lWG  W C HYY@CA@>=;754321-*'%!  +%2654&#"4&'&543;2>2372#"'.+"363632#"&#"#"=>58CJB<R!"    5]Mgtk%ceMBp?y3@$>+ A )&$ ;sR_    <4@1d_BG>GW;H86!!)"$%" +732654'&#"327632#"&#"#"547>54'&547>32(%<`J-;7 38\k$9gX:!(&F"C) l"%Y?X)$ 2`V5 " !"vD  6Aw=FKPX@%G>GWCH@(lGWCHY@:87542.,! +%2654&#"'4.54>7>32>32#"&#"#"&=>8CJB<R   "  #RMgrk%l eMBp?y3@X%  - sR` R3A@>(FljWBGWCH$" 33 +2#"'&'&546327>54&#"#"546567>7> ´[]  t/puo 7$!    &$#7 &M% 0F)G!  .J@JFKPX@3dlW32#"&54632327>32#"&#"_3`k    +}ؔF$ ;$/ " [H#.3rSbyG!Ȋ *( & #v4%FKPX@7llj W:GW=GWCH@5llj _W=GWCHY@31+)$# 44 +"#"'&#"326762#"&5463&54632#"&?++ L4:YF%i=JayZ$-J&1  -K!L3 %#Z58#rjd0 5" "ù/;!&C-.R8j&&$ 2B5  $-/GK-PX@2l_W:GW:GX ;H@6l_W:GW:G X >G;HY@FAa&4$'# +%54&#"326%46322=4&+""&5467432;2632"&#"#"&pF.0 RG$,]3*  #C!&&(!:9hsl*(1$P^1iUp3 ) ? #<"! b#X@ I .FK PX@L  ll GXCHK PX@O  lll GXCHK-PX@O  lll  7H2K*.I(R7-[&+6ukDw]NDv0)NHz4, )*+=   ? &8&;B&^uTEt YK PX@2d  l_W:G=G W;H@3l  l_W:G=G W;HY@XUQ-$53)"3 +%54&+"#"54654&54632;26=4&+"#"54763232632#"&#"#"'&5476;26R]   ,`  +Jj("i&!&#'!B/D  5h#f -6 * ' / Q  #>#! ?(  0l'5C@@ Fl_WBGWCH)(1.(5)5$+"&2 +7463!254&5.#"#"546567>7632#"'.267654#!"S5S xhG    UYǗL$<861/%" GG +"327632#"&546764'&'&54632#"&'.#"32632#"&7@XAd& >hVT7% R"   1-!0>1%( )-SV=Ch_, MeRO] 3M\ 9# +. O,5Q 8O˵,FK PX@4dl b_  \W:G=HKPX@5ll b_  \W:G=H@6ll  j_  \W:G=HYY@NL$'b'#W4$f +4&'&5432372#"'&'&+"326327>32#"'&#"&#"#"&54632325$!%e"  + S ,    " !* .M.9 !B 0.  G $ ' #,'MB#A@ -(FK#PX@1 ll W&,!$'32 +;2+"#"&54632326765"'".7>74>32#".#"v^M-!A )#   +EH$&$*188  9<7!:)"  R|B  \- ]@ H\FKPX@1l_ W32#".#"x  S>o;wLN: BJ6 lB$ەF\ ?$+   #wR`%=)    $'   ,ȏ*('$  = L#@ :GCGX?HGE6/$ +3254'&"'&'&54323263267654'&4322632#"&54766$)  0!SI!'  C! B*R !"4  J4*-HS2",B4]^;   f  1HQA25N?16 Rq@ >EFK-PX@"GWCH@&G>GWCHY@OMHF=<1:%&' +%4.54632#"&=4&#"+"&"+"547>54'&5476?263232>` + -,-gG+I5.! %$") -[U>.9+!&2!;! #Q1>tUM3"8     @  ">/ ??9$1;:l$"@l:GXCH$!" +732632#"&54&'&543232632#<?$9<&!C=!' NC2G<#  "H:#@ `:G;H$'Q'#' +4&'&54323263232+#"&#"#"547>=#"&546;&!C=!' J8'(!CL!(&I  ?&#  ""!  !"]K PX@'d`:G W BG>HK-PX@(l`:G W BG>H@,l`:G W BG>G>HYY@][(}!!(&" +#"&54654#"#"&#"#"47654/&#""&#"#"547>54&'&5432326232?>32# $$o@ #")!R .=!:4J!&&!?3:!# 3D!L?! &!#nM '  ;K   !%"   !5/_K-PXFFYKPX@$dWHK#PX@%lWHK-PX@%lWH@)lWGX>HYYY@][YWRPFDCBA?,%!= +776767654'&54;2632+"&+"54654/&#"&"#"547>54632#".#"Z 1H )i $]$.M:,~#!") mI=  0 O"   \ +e"    -/    v{ iG8NK-PX@`H@`G>HY@ #&$( +7"&""5476765#"&546;54'&5476737232+ (,",(!;  1.[<*>     ?  ">(%M_K-PX@ MF@ MFYK-PX@H@G>HY@CA@>=;&$#"! +&54?'.546276#"&"#"547654./.#"&#"#"5476?>/; }"\ le +."-B  S 7* -v  AT $U8 ! 4?$         7K |sKPX@)lb :G>G X CH@*lj :G>G X CHY@xvkd\Z$%&!!-)u +4'&5432263232>=4.'&43232632#"&#"#"546=4#"#".#"#"&54'&5432263232>56!D,F!,DG*>!! 4_!(&&!* 0   6&+E' 3!fe6!D,F!, 9'+> #:  ([0PW1   !"<#   $#!:  (-PL,-MR/8JvKPX@(ld\W:GCH@)ll\W:GCHY@B@;9/) JJ +"&5463232654&'&433232765.'&54;2632#"&'&&#".9 !!&12S( ] '!9=   0  F#qM10 I@W"  0!%p2YxLSK-PX@ */F@ */FYKPX@'  l=G W=G>G?HK-PX@'n  l W=G>G?H@/n  l W=G>G>G?G?HYY@KJGDCBA>31)' SS +"+"&"+"547>=4'&4767632>32+"&"+"5472767654&9> )") )4:_*3A +"*!2m*7    @ + 4 +>9    +2- 1@.]WBGWCH  $" +!326'.#"4>32#"&m$bns}ge}bMl-tvi3]b-  1vFKPX@$_#"0eK PX@$b`W=GWCH@#n`W=GWCHY@$#+)#0$0)"$" +%#"&5463232654&'&54632#'"327654&wkUrZ )L  #6$9 P:KP^rWV   ( ? /k((]Mu7'OKw)f8IK!PX@,:G WBGW :GWCG?H@/l WBGW :GWCG?HY@:9B@9I:I6531-+$"88 +2632#"&#"#"547>54&#"#"&54632376"32654.!' '(!CL!(&% 7xÏB-//Fh0-iJI]#> "#"!  !"% Hζ ]MO_n7Y^?(# @K(PX@*  _=G W=GWCG?HK-PX@*n  _ W=GWCG?H@.n  _ W=GWCG?G?HYY@?=3210/.   +"32>54&#"&5463232632"&""54767654&#":Rc8%1(     'D@M@Jlj _ W :G>G;H861/(& @@ +%"54;327654&#""&#"#"547>54&#"#"&54>32_2 7%?nA@C!:4N!'" -" "QuH;ye%%3 0pLR'%K   !$'% -+: 4])f%2QFKPX@3  d WG WCG?HK-PX@7  ll W54.#">32#"&'"#"&"#"54767654632#".#")+/(0&3e*JZ\@ 9"+!rE= !.&I/6L! 6+ 0*5T/rK\ 3     k aOP_0@-`[:GW;H'/#.2Q& +7#"&#"#"547>54&'&54323263237>3232#"&'.'&'&'&5327654.#"'(!CL!(&&!C=!Gms0"2)5-9a$+=+- 8(Db"!  !"#   ;VRB-  !  R '+N+,6)9qKPX@(lWBGW:GWCH@&l_WBGWCHY@-+)'! 99 +727632#"&54>7654&#"#"54>7632>32`  3`Wl5.? WA0)> 0CJl)> :?BVBM& MP*D/ 8V3G=,)B;)=-#'MnR%;;@8ljW=GWCH-+&$! ;; +"#"547>323267632#"&54>7654(B=B O0 H&KB   @%9-+  +V" & >)  (.NRO 0>@;-Fl_W9=-F^J,r  *:x_ %-0eS\#2:@ 9FK#PX@.nlW=GX CGW?H@,nl_X CGW?HY@5320,*" :: +"&=4&#"&547>32;2+"3276#"&5463232676517 0r c &2M-!A )#;< ,& ,03+ B<7!:2A FK&PX@'lj2#"'&#"#"&#"#"547>54'&+"#"&546I&  Tc$O!CL!''7>-" "p B! ).)9@  $#($ -@7`6$FKPX@'dW2#"'&#"32654632#"& 7/.    ;}&  Tc$$&$-<oR:D=(  .A  B! ).)vX, )=Bf >!@n:GXCHh)+" +4632#"&=4'&54323263232654'&'&432;2654&'j  l.!?6 !|`]`'! $ _.&-M u<  )gy9b  1OX@ #FK PX@.l=GW=G W>GWCHK PX@,l  _=GW=GWCHKPX@.l=GW=G W>GWCHKPX@,l  _=GW=GWCHK-PX@*l_  _=GWCH@.l_  _=GWCGCHYYYYY@FD#&)&#" +326##"546=#"&=4'&5476763276=4&'"5463672>54&'&54324A H]3?+ #D4 :-*M5  77; FE3 G>9( .$7!*   !-1 3B@:GXCH.' +32>54'.543232632#"&5467654.'&543232>32./1u^AX#I )6I !Q1@AxA57J !K/""13lidOsIZ:    1|Y~W)  94@12Fl:GWBGWCH%"))# +#".54'&54323263232>54.#"#"5&632Xe:\5.!?6 !aMGp7+  $&Tnhq,GP)E<  )ax^G'3M11 =J]K PX@"d:GWBGX;H@#l:GWBGX;HY@ %#&)Q, +#"&#"#"5476=4/&'&543232632327>7>32#"54654#";;)&!CM!Nu7"! O6 ! \ ]>J( 2[e"+  F-X   &&2^*!6?K-PX@0l  lb_=GX?H@6l  l  jb_=GX?HY@>=1=!#'!$" +>32#"&#"#"&543232767654'&'&54;226;227~04' ./  .-t!"$O"+1"NJp*) Ow  %)  % LXc@`)6 Fl   l _BGW:G X ;HPNKHA?;94.,*$" XU +"+"&'54767#"&546;67654'&#"#"547676323327232+32767632#"&PM:SHm  }YHHJM4   >4]xo =u }PW 0A?NT(  <Nrc~m!" E*Qp^ ptV@ G /FK-PX@6ll  _=G W =G W>H@4ll  _  _=G W>HY@RPLJE><;53*'#! VU +%26?>32"&#"#"&54767#"&546;>76+"#"&765462326327232+3' A: %2>  K 9u    $_[RK PX #&'Z  2H)Z   (2  } #A[@X Fl  l   _BG W:GWCH97640.+)"  A@ +"#"54767632;26232#"'&'&5463232654&#"#"54?654#5  +  Onf;> L*JNJ;  ]$" E* ^SjqM ,4=eG=`  #HU@R&%$FljjBG:GW:GWCHEB><642/.,'"$S +#"&#"327632#"&5467>5/4.54632;27632#"&/&+"*27@XAd& >hVT7  OB   0,V=Ch_, MeRN^ J% K }=FKPX@/djj=GW=GW?HK-PX@0ljj=GW=GW?H@.ljj`=GW?HYY@ $!&2&"m% +6#"&5467654/&5432;27632#"'&+"#"&#"326k #WYL?#} f#H8   K^| 4*32#"5468.= | B*   *H?j D9z^(6"K0 g[TmX6=  % 7 E  hj kRN"$ )3N24QF@C .F  l_ WBGW>HPNJHDB<5A$'&! +#"&7>3232+3327>7676+&#""54?67#"&546;654&#"V  0K(FU- q  } !5<6,!   `&`  89*,R )1"cI#f"      SW5I>H@ G%FK!PX@;lj W:GW:GW =GWCH@9lj _ W:GW:GWCHY@DA<;532,HH +2#"'&'&5463232654&#"#".<576&'&5432;2632"&'.+"6Vb4> F)HAY@b&!C#  "hAeOl}M ,5  lllj_ W =GX?H@<  lllj   __X?HY@GB?=651,"$#$$!" +732632#"'&543232654&#"#"&6?6&'&54632;262#"'.#"&#""Mlh6  GfG</ " & _  pNd bFDf ' A )&#&)B9h@ FK#PX@#nlW=GXCH@!nl_XCHY@ #%*16'" +54#"&547>32;2+"#"&'&'43232654&'.Q 1    "(%@ :##$(-4(),&,0 $(9x & .& ' : DK(PX@l=GW=G?HK-PX@nlW=G?H@#nlW=G?G?HYY@ ><;:97)/" +4&#"27>4&'&5476?327>32#"&"#"547676q4)$U Pq*J <' :;dQ     (U @7'?'f'@'/+#n'@G/+8j'->/'M>//+'MO/+8.'-1'M1/+g'MQ/+K'$/+#&4D/+BK&,/+&/+-K'2/+#&kR/+K'8/+&pX/+'w'8w/+' M&gX/+/+' (6'8 6/+' &gX/+/+'i'8i/+' &gX/+/+' %'8 %/+' &gX/+/+p*2@/l_W=GWCH$#"$4%3 +%676+"326'46;2654&#"#"54632#"&  Z/ 3" /4- E7K& aAJcpPGTV20.&/ =U2CsO[I'w'$w/+#' & D/+/+'|'/$|/+#' & PD/+O '#+&w  /+-WE@Bl_ ` W BG W C HVTPNCA)!S'$#$%$ +#"'&'.#"32767#"&546;4654'.#"&46323263232+#"&54632m  S>qjU%  BJ69 ( Fl8ٗ*pM# #z%*       " s@Y%P7FKPX@8  __  _ W =GCG W ? H@;l  __  _ W =G W ? HY@#nljhgeb`LJFDA?=;42$"&" +!326'!654&'&'#"32654&#"'32+#"&=#"&546;6767.547>7.5463232632#"X A0,I1%= &s'05)%36|`H ,`*(?#   p6Km   7"8!lFE  ( &--N "&K)1PJ2/J[Kr "   5F6<  $% 5GW -K'*/+ &CJ/+K'./+''N/+-'L2#'R- '#&J /+#K&cy/+&<T/+&/+>'='f']'#n']G-F'd* 'J%`jK-PX@%` :G=G;GWCH@)` :G=G>G;GWCHY@ZS7m!!(4&*" +%32>54.54632#"&=4#!"#"&#"#"547>54&'&54232623!2=4'&54323262Z:%&3 !""#i>S,#!C>!$#!:8::!D#B!C.:!"EI:;(*>$'B&aML -  %%   ; :   !L,D.@+lWBGW:H!!!-Q/( +7>54&#"#"&#"#"547>54&'&54323263236320/C*/B_O!CN!('#!  FjPP#$?4J*Aev< }:  ""q!"  ebF'1'Q' f' $ f/+#& bs& PDs/+OF'#'1F'S'Y' $&D4'$#e&D/+ Z& U(/+h&H 5'(/+he&*H/+BY& ,&B4&,e&/+-Y' 2#&)R-4'2#e&MR/+Y& V5I&U4'5Ie&U/+Y' 8&.X4'8e&RX/+)&w6%&=V'7#2&PW(8@KPX@1llb_ \WBH@2llj_ \WBHY@<:20'%! @@ +"5463232>54&#"#"&467>54&#"#"&54767>3232u 0=Y(95&L  (37?29F  FBKq>.E[#SwCAZ$2G/7S=C #9WE:arJ%o7J@Gl  j  jb_W=GX?H0.#!#$!$#" +4&#"#"5476326322#"546323254&#"#"54676763&%<   X)9Wy>TOQ .3^B`@c4O $?%K'+/+Z&j;K;/+M<@9:GWBGX>G?HA?6/'%" MJ +"#"547>54&'&5432;2632327>32#"&"#"547>54&#"#"&_!(&&!* (  "c6z6!D,F!,nX_t! 4 !"#  !"3:  (%bv  #} DUd@a,3<  F  lo_32632#"'#"&54"326=4&9)- D-Rg|e58DKDZ67"z%(!2-)6DAp +|P[ & >(K MG1E  "F/5M$4%.N-.4CI@ A$FK(PX@BGBGWCH@nBGWCHY,/.( +654.54632#".54>7.5463232654.'E~+, @:PF'77TuC-TH, :)#ERY@ Qo_B?_;&%@E=L(8:)AU#!1C*;S#%A)5$'#M9CO  )3GAX843"&A#,:$@!8F54.54632#"&5467.5463232654.'78 FGB',6vlXoRK=CM>SL>:A0'#9=)= *8 ?<0V3"59 \v]U=c7+S58]/-IQXZB1..LaF@)FKPX@4ldBGW:GX >GX?HK2PX@5llBGW:GX >GX?H@2ll\BGW:GX >HYY@A?=;862/'! FE +3"+'477654'&#"#"5476763232723!2#"546323>54&#PM:{HJM4  A4]xo = P^\x;u 0Jc,#N,!" E*Q`Eh.&x/!%~F@ 5FK-PX@5l d=GW=GW>G X ? H@7l d_=GW>G;G X ? HY@CA=:3,*)#! FF +232654&+"#"&547676+"#"&7654623263272;2#"546y,.H+}: %Jpu    $_[ -8EPF>*K 2j   (2   F3K %'/$#R&PD zK PX@Kd  l d b_W:G=G W >G X ? HK PX@Ld  l  l b_W:G=G W >G X ? HK-PX@Ml  l  l b_W:G=G W >G X ? HK2PX@Ql  l  l b_W:G=G>G W ;G X ? H@Nl  l  l b_ \W:G=G>G W ;HYYYY@ywvtpnljhf^[QN2)#54$!3 +4?&#"#"547>54&'&543232>32#"'&'&+";27>32#"'&+";27676#"'#"543232654&#"#"&I\*B!'#&!&i"(jJ+  `,   ]#h5  "(Z'-  sc !##  Q / ' * 6- %0  (?4  . /E "! f LFK PX@El  d   j b_ W=GWCG X?HK-PX@Fl  l   j b_ W=GWCG X?H@Cl  l   j b_  \ W=GWCHYY@# KIFDBA><.,*($! LL   +";27654&"&54?#"&54632+"327632#"54633254&#"'?R/ 2Q HFbsT(a#%/E>," K"M U@6;AUKFKPX@. o_=GW=G>G W C HK-PX@.n o_W=G>G W C H@2n o_W=G>G>G W C HYY@PNJHDB><531;"$! +%32654&#"'4#"+"&"+"547>=4'&4767632632632#"'#"&5467 6$ pL8; )") )4:PK18..!+Z,I% +!kB]*7    @ + 4 B=:#%/E>," K"Q0:v@ 1 FK#PX@(no_W=GXCH@&no__XCHY@ $$13'*$$! +7632#"'#"&546754."#.47>32;2+"32654&#"..!+Z,I% +!  0rc  6$ #%/E>," K" .' ,0B0FKPX@ =G?H@ n?HY% +#"547676=4'&547>32O ).9 S3T  5=@  H#8GX@4 FKPX@CGW>G WCH@FlG WCHY@IH:9SQHXIX@>9G:G+#$(!!$# +632#"&#"#"57>=#"&5463232=4&'&47>322654&#""326=4& 5]Mgtk%cD-Rg|e588CJB<R%(!2-)6D ;sR_ +|P[ & >(eMBp?y3@j"F/5M$6%.N#$l@ %( FKPX@U  l  l=G=GW =GW =GW CG>GW CG ?H@X  ll  l=GW =GW =GW CGW CGX ?HY@+kifeb`\ZXVONKIHBA@5420,*$$  +%2>54.#""27654'.7>32#"&'"#'".#"#"54727676=4#"#"&546322676326)+/(0&:RcpE e*JZ\@  +!'XSun=  &I/6L! 6+ 0*5m_RZ[nO->8/qL[ 3    "gYj  _ka@U gWNF/EKPX@@  lllm` HKPX@C l  lllm` HK(PX@D l  j jllm` H@= n n  nnllm` >HYYY@%kifdRPJIDC976410.,*&$#"! __&! +?#"3254'"&#"#"547654'&+23#"&##"50#0?#"#"5476767>4367>27632;7'&#"h7 ((. fJ !=&My!* #+R!<`[  &p % #F.$!Z2M'>tF  #  JK ;  s k7' #w.lH@$54-9D@=;E$FEKPX@3llm32#"'#"50#0?.5463276322'&'&'32.Ak  -@hLA5 #D@JؔF$  % % ?O|orJG!"]x/T 5A67#(727\@Y1)" Flo_W=GWCH -+(& 7 7" +?&#"7"'3267632#"'#"54?&546327632%4: )8%i=*% #-4yZ"  w Z<; & ?6 P9T_ $  &JJH@E&$9Fl`:GW>HC=64/,)'!JJ +"&546;54&'&54323263232+;26767632#"&#"547>=G <'!?J!   /&   G.)(=  #   ! +V)  < ]@FE R]% F EK(PX@:  l  jlm 57#"#"&#"#"'#"50#074'&+"#"547676323!7632327>2#"'&'Ia ''Pb*&O!CL* #7/.    ;A! % !&  N$#J8@ Jn (  .A :: B! )-CGB@?ljl[W=GWCH#&#$$*#& +.'&'43232654&'.54632#"&5.#"#3254&54632#".G:##$(-3BD4&""(PP$#/ 73!. ) .& ' 9!1E9$$(97CdI %3E8ENyF@ ;#FK-PX@4ljl [=GW=G;H@2ljl_ [=G;HY@BA920/)' FF +254&54632#".'"&547676+"#"&7654623263272)/ 73 '>/ %Jpu    $_[ !3 %3E-BD4 2j   (2   .@?,#='@$lWBG;H31*(" Q& +%#"&#"#"547>=4>7>54&#"#"5467>32'(!CL!(&  $@3%6 BMKs* a!!  !! >97S-! PSC)A- %U9RK-PX@lW=G>H@lW=G>G>HY@ +*)('&'#" +4&#"#"54767>32"&""547676=47>6(@   ];]$  (,",(!6*&=2. -,<58     :+" '- #[AFK-PX@+ _ `W :G  W > H@/ _ `:G W :G  W > HY@%%$TL8651*($[%[ ##    +27>54&#"2654'&#"32+'"546;4&'&54232632#"&#"#"547>=?0 qm"%&1%D\BK!(&s 0&6N%Y?X) ` C( R$" EP>" %<)':& " ""L(I:@7 `:G W C HFD?=:81)#" II" +!326%"546;54'&543232632!4'&'&4323263232+#"&=_hr`^c5.!?6 !'!.6 !/A /o tt{m <  )=b   B@  tv@KPX@lBG:G>HK(PX@ljBG>HK-PX@nnn>H@nnn>G;HYYY@ )&!W +7#"&#"#"547676?>367>32#"&#"#"47>54'&#"!!?R!<`[  Jh.$! fD !f   ;  7'  "! p@ONM ZP [ p9  F,EK(PX@C  llm  _W:G W H@A  llm _  _W:G =GW>HY@"omki`_USKIGA31.-+)&! 2 +&+"37#";27676#"&#"#"50#0?#"5476?54&'&543232?632#"'.'67>2#"'&+  / #h5  C/ * #(! $&!&i"mf % 3 y#   j`  rR %0  (?JE ?# /Y/  " * 6-f2;Ef@c D3 4+Fnlo _  W=GWCH=/#! #   Q'?R0x 6w?]V} %(- !, ;: s'79T 8:9dKPX@d`\:H@ l`\:HY@751/(&"  99 +25#"&546;54&'&5432326232+#"&54632NBt j%!C1:!$J 8 .M.9 !$ "  $Kb=B#g&!/+.1%5:@7lBGWBGWCGX?H')#$$$$! +%#"&5463263232654632#"&=4&74&#"3266cw -&#<hE1E`CEf.5Y8,o (!SyM$ )<@URj`+A]M:k[6@#} ;98FKPX@:ll =G=G W=GWCGX?H@=lll =G W=GWCGX?HY@6410-+'%#!  +"27654'.32654632#"&=4#"#"&54632267632:RcpE!#/ O?9='XSun=   ~_RZ[nO->Tv` %-0eTb"gYj  />8LZK-PX@-T W:G>G X;GWCH@1T:G W:G>G X;GWCHY@YWQOJHGC<:64-+*('&#( +32#"'.'&'&'&"&#"#"547>=#"&546;54&'&54232632'4&#"326-#O,2)5^,  /+C!:4N!'"^ T$!:2C Z9N&CSE D3_( 6 $ J   !$ 0. l\FPah R'ZKFK PX@/db  `=GX=G >HKPX@0dj  `=GX=G >HK-PX@0ndj  `X=G >H@4ndj  `X=G>G >HYYY@KJFD<:&$#!$$$- +754'&547>?3232>7632#"&#"32+#"&"#"547>=#"&5463k) $  0,* )E 351"+ 6 9?   0 +$&.,m   r elK PX@! d `:G  ; H@"  l `:G  ; HY@ \WVTHFCA80%$ e e" +#3276%"546;'&'&5432326323>7654'.54323263232+#"&#"#"5476=4/) S 7"! O6 !  ) .H 5! Z _+)&!CL!NTI&&!( X   8   $0 /K"+  F-X}K-PX@(d  ` =GX?H@/ ld  ` =GX?HY@WUOMIG@>=;:8!&$(!% +%#743232767654/#"&546;'&'&5432263237654'&4323263232+#"&9o2 .-PI -#"& + " 9 9j./ { Ow   .)      &Jp*)i;O@90FK PX@*lb=GW=GXCHKPX@+lj=GW=GXCH@.lljW=GXCHYY@GE@>,* ;; +"&=6&'&54636?3272>323267674654764&#"327>$7!(H"<$!&E"H ##EB3 #  6#$   ""8!D!$ "     #\=, > # =FKPX@4l=G=G W=GXCGWCH@7ll=G W=GXCGWCHY@8620,*&$   +"3276=4&3276#"."#"&5463232>7632:Rc8''G# '$"0Rqn@!   ~_RZ[9->TM  gYj  3 8@! 4FKPX@&=GW=G>G>GWCHK(PX@)l=GW=G>GWCH@)nlW=G>GWCHYY@20/-,*&$  +%2654&#"'54&'&54767372>32#"&#"#"=> ;FY;,&N@4*P"EgkgUZ_R2(DW0 !kRxw >9ϵ4FKPX@1dWG>G WCHKPX@2lWG>G WCH@5llWG WCHYY@20/-,*&$ +%2654&#"4632#".#"632#"&#"#"=>58CJB<RoE= !. 5]Mgtk%ceMBp?y3@i aOp ;sR_ ';@8ljW=GWCH"  '' +"#">7>32#"&'&5463237654&(3 I,Vxwl$Q %JO2 $) vR^  ) 8'OKw( 2@ *FKPX@)do_W=GWCHKPX@*lo_W=GWCHKPX@)do_W=GWCH@*lo_W=GWCHYYY@ $$%#%%$! +732654&#"&54632#"'.#"632#"'#"&54,C*&6+yZQ'   #4: OP%8nH>. X2`8J_0  Z<@2D$ 3K+ #dE[@X/Fll<86.,!  +"326=4&'#"&5463232=4&'&47>3232654632#"&'%(!2-)6DDD-Rg|e58!#/ P>9<{"F/5M$4%.N+|P[ & >(x_ %-0eS#kD"FK PX@@  dl WGWCHK PX@C  dll WGWCHKPX@C  dll W<751/,*&$  +"326=4&326##"546=#"&5463232=4632#".#"%(!2-)6D4A D-Rg|e5qE= !/{"F/5M$4%.NA3 +|P[ 9i aO#x0B@?Fl_W=GWCH+'%# 007! +&#";254'2"&'&67623254##"'&546#?K /RYPc,SnP  +w\>A2 grP*MH+% U;">p >L@I$ 2'Flj`W=GWCH#"&-#!&%% +%3254?63232632#"&546?#"&54?&#"#"54632!3"h,F(  % ; -pPGT,#EK& aAZs $0l/ # ,%%*[I*G2C68K PX@:  lblj_ W=GWCH@;  l jlj_ W=GWCHY@76%*##$!#!" +32632#"&#"3267632#"&5476'&54632#"&5."s$  &3'9  Y74KK 7V:/+4%3232#L )C ;.9  1US4S  5=k ;@  g37 #EKPX@Adl   lW:80.,*%# +"276754'.54#"#"&54632=4632#".#"#"&54632326:RcpEG'XSun0% oE= !.#4D>2m! &=!7`~_RZ[ I'O->I3"gYj 3i aOBj@+3-00b#A*FKPX@:l  l=G=G W=GWCG W?H@=ll  l=G W=GWCG W?HY@?=;953(&"  +"276754'.4#"#"&5463232>7632#"&546323265:RcpEG'XSun@!   #4D>2m! &=!8a~_RZ[ I'O->|"gYj '&'Bj@+3-00b\#:4@1l_W=GWCH!2$$'$( +%#"&54632#"'&'&#"327654'.54;2632 #$J"Xd>/   AITII+0g . B yV_$+ gIMl3  IgK-PX@ 7'F@ 7'FYK-PX@=GW?H@l=GW?HY@ ,!!-* +32654'?654'&543232632#"&54>?&'&542262    *T 0 u%C3+;($"&( (;2!A@>=*FlW=GW=GWCH#$)#"+&$ +73254&'#"&546?.#"#"5463267632#"46&#".( bp&8' !! 6&) # &'))8FF /-6^'! D6)"##0#5<>-6'/ H$$nO@ N=FKPX@*l=GW =GWCG?HK-PX@(l _=GWCG?H@,l _=GWCG?G?HYY@JI+13%## +327>=4.'"5463>7323+"&"+"547>=4'#"&=4'&547676;"7  $  2") UB2@+ #DL$6  8    ??9' .LK-PXFFYKPX@&dWHK-PX@'lWH@+lWG >HYY@EBA@:(18&"%" +4632#".#"632+"&"+"5476=4&#"+"&"+"547>5UqE= !-UB3A)("&';"7 %$") i `Pp ??9    $6     NK-PXFFYKPX@5 dl WGW?HK-PX@6 ll WGW?H@: ll WG>GW?HYY@LJHF(!))!&)$ +>32#"'.546323267654&54&#"#"&"#"54765>32#".#"m*2:M-* )(3(4)*)"),pE= !/d0>9 29<7  #13:+20    i `Pf AFKPX@ _ ` =G>HK-PX@# l_ `>H@' l_ `>G>HYY@ 7520('&%$" A A$" +4632#"&232+#"&""547676=#"546;54'&547>U^ ? 2 -",(!C ;/9 3l\+Jr     r ;?  :FKPX@=GXCH@nXCHY,&" +73276#"&=4'&547>32  -"0/9  L 1#?  \+'=K-PX@=G>H@=GW>G>HY@ !-!( +#"&"#"547>54'&54322632 +"+ %#"*(K     )  C@>, FK-PX@(l _  ` H@,l _  ` G>HY@A?8765+)%#!CC +2#"'"&""5476765&#"#"54>3254'&5476737232> ( (,",(!  ' .[  %*      $?  ">(E@ &E9FK PX@$lb_HK-PX@%lj_H@)lj_G>HYY@ +!$# +54&#""&""547676=.5463254'&54767243267>32r  (,",(!8H5* .[##  13"/ F     .'(3?  ">(  N"$@!l9>h?  ">(wa %-0eg@?J  FK-PX@;l   l   _G W ? H@=l   l _   _G>G W ? HY@fda_[YTSQOHC9876" +4&#""&6?6?6'"&#"#"&""54767654'&54767372;27232?2#"'&543232633= | B1 (,",(!.[*H?j D9=TEzC6  EhC@a  % 2#     ?  ">( hj XA6uS wiq@ , FK PX@9lj =G W =G>G XCGCHK PX@<ljl =G W =G XCGCHKPX@9lj =G W =G>G XCGCHKPX@<ljl =G W =G XCGCH@:ljl  _ =G XCGCHYYYY@ec^\YWQOGE@>&)#"'#" +326##"546=#"'&#"#"=4'&5476763276=4&'"5463>7323276=4&'"5463>7324A Y5F P-d, #D0 5"*$  0 ;"*$  KF3 +< "w$ '#%:3 5 %:4 4v@ 9 FKPX@7  ll =G  W =G XCG?HK-PX@5  ll    _ =G XCG?H@9  ll    _ =G XCG?G?HYY@rpkifd^\TRMKHF)#"+13 +3+"&"+"547>=4'#"'&#"#"&=4'&5476763276=4&'"5463>7323276=4&'"5463>7322") H\FM,08. %D4 1"*$  / :"*$  L   C< ":7$ '"%:1 4 %:2 3@o f tFKPX@=ljl =G W =G >GW?HK-PX@= nljl W =G >GW?H@A nljl W =G >G >GW?HYY@~{ywunmVSRQPM*13'!&4 ++"'.5463232676=4&#"3+"&"+"547676=4&#"+"&"+"547>=4&'.7>72632327>32'b* )+1 5"  *"+!0 5" )")   HVF P-.7'r?s  #1,%:3    %:4    $ 2 C< "GG@ FKPX@$l=GW=G>G?HK-PX@$nlW=G>G?H@(nlW=G>G>G?HYY@ ((1;() +754'&4767632>32+"&"+"54727676=4&#"#"547676I)4:_*3A +"*!2(9>O )B@ + 4 +>9    +2*7P1P  5AuJK-PX@ .3F@ .3FYKPX@)l=GW=G>GW?HK-PX@)nlW=G>GW?H@-nlW=G>G>GW?HYY@IGDB><75-+1;# +4&#"+"&"+"547>=4'&4767632>3232654632#"&q2(9> )") )4:_*2?!#/ O?9=hx+2*7    @ + 4 +>9x_ %-0eMfK-PX@"lW =G>GCH@(l _>G>GWCHY@GE(&$# +#"&'&#""&""547>=4'&'&543232632325'4&'&54322632 !  ("$( <  "&!  P      !     #0@-]W=GWCH"" +%!32765%!.#"72#"&546zM7K L49VxwkUrHg7'O'@[('nwR^rWV#K\@*.C FK PX@Idb  l  j  ___ W >G WCHKPX@Jdj  l  j  ___ W >G WCH@Klj  l  j  ___ W >G WCHYY@VTPNKFBA<92"42$$! +#"&546323326;2#"'&+";27632"'&+";2676762#"&#".#"3267654T $d_ *".  +dQ  K+R% 25!MEWQ a]9#<|  & n3(.  nR\v 22dKPX@%lbW=GXCH@&ljW=GXCHY@ $&&#%%"" +%#"'&#"#"&54>3232654&543232654&#"wX^ 97:=`RqP.A8/!70z\h\x?  jFLu;uh4"J8<Z!-P;dle#&B3,2FK PX@/lbj=G>GWCGCHK PX@1lbjj=GWCGCHKPX@/lbj=G>GWCGCHKPX@1lbjj=GWCGCH@1nlbjjWCGCHYYYY@ ,!$$%" +326#"54674#"#"&54632326=4'&547>324A 0,* )/9  &F- +$&.?  \B5K PX@0lbjGWCGCHK PX@2lbjjGWCGCH@2lbjj  ">5!FKPX@0lbl=GWCGX?H@0nlblWCGX?HY@ #$&,!$$! +74#"#"&54632326=4'&547>3232654632#"&5 0,* )/9  !#/ O?9=, +$&.?  \+x_ %-0eSI;@ &FK!PX@&dj=GX=G?HK-PX@&ndjX=G?H@*ndjX=G?G?HYY@:8751/+)%#"!16 ++"&"+"547>54'.7>7243232>7632#"&#"5/") )$  0,* )    ?  0 +$&)^8FK!PX@1djl=GX=GX?H@1ndjlX=GX?HY@ #$%!$$$! +4'&547>7243232>7632#"&#"32654632#"&5Z)$  0,* )!#/ P>9=?   0 +$&.x_ %-0eSI%YK-PX@dW=G>H@dW=G>G>HY@ %% +2#"&#"+"&"+"547>=46* '5/") l$#1   KpI%YK-PX@dW=G>H@dW=G>G>HY@! %% +2+"&"+"5476754&#"#"&546MSl )"/5' *pK   1#$BL FK-PX@'  _ W =G>GWCH@+  _ W =G>G>GWCHY@LJGEA@<;+)('&$ BB +232#"&'&'&'&'&#"&"#"54767654.#&546364&#"32ǥB 5!0 /  )"+   #%5/!hfD`$ ,M n       g#'&`GQ<FKPX@! `=G=G W>HK-PX@!n `=G W>H@,nl `=G>G W>HYY@PNKIB@;9!!.!!$ +4&543232632#"&#"#"547>=4'&547>323276?64#"326F&$ - 2 "\LA A / 9  ,& ( %h!7(*i   &` 18E  ?  Q1LIO`&0%?K@H?FljlW=GWCGX?H)$$($$#$" +32654632#"'=4323254&'&54632#"&'.#"#"&/_/ P:T,J"&aFD8'% U($^ %-0;  G&E9-E9'*$59xF%;@8ljWJB]!Q8Z32#".#"32+#"547676=#"546;54&'&5426765ZnD= !-1#L )C ;+0 i `P US4S  5=k B# #;@8ljW=GW?H  ## +232654632#"&54&#"#"546t>?!#/ O?9=#  @}ox_ %-0eS8R^"!ue*6z@ / FKPX@&d_WH%# ,, +223#"=4+"4;26=4&#"&54>}17  +rc &2 9;< .' ,03+ #Y-\K#PX@#nlW=GX?H@!nl_X?HY@ #$%13'% +4."#.47>32;2+"32654632#"&U  0rc !#/ O?9=h .' ,0x_ %-0e V@ D *FK PX@5l  `=G W =G>GWCHK PX@8ll  `=G W =GWCHKPX@5l  `=G W =G>GWCHKPX@8ll  `=G W =GWCHK-PX@6ll  _  `=GWCH@:ll  _  `=GWCGCHYYYYY@RPMKHG@?8620&#"#%$# +%#327653232+326##"546=#"&=#"&546;54'&547676354&'"5463>p4 :-@ 14A H]3?)  + #D*$ 9$7!* 9jGE3 G>9PX( .g_6JK-PX@=GXCH@l=GXCHY@ !(($ +#"&5476.'.542262327654'&543226322wkUrC ($"&("P:K60( X:I^rWZE    e6Mu7'O)   'DKPX@=G=GWCH@l=GWCHY&)&! +754'&54767323254'.54632#"&U+ #D4"%* -,1kG-Ql( .2FB*"#Q1>uTIY /+Z /+\ /+GXK-PX@ =GW>H@ =GW>GW>HY@A?>=<:0/&%$#"!!* +%#"&"#"547>=6/&'&5422622?654&'&54322632 +"+ S($"&( 8  6 %( )-?    D+   aV   'S@ +FK-PX@=lj  l=GW=GW >G X ? H@?lj  l_=GW >G;G X ? HY@OMJHDB;930)"  SR +3"#"&547676+"#"&7654623263272;26?>3232654632#"=4#w: %Jpu    $_[ u'$$ / P>l  2j   (2   &'_ hE_ %-0XrIQ@ C+FK PX@4lc _=GW=G  W>HK-PX@3lo _=GW=G  W>H@1lo_ _=G  W>HYY@QOLJIHr)7!C#F +7>2#"&'#"547"&#"#"&547676+"#"&7654623263272;2654#">B2 ' : %Jpu    $_[ X9##0="$)()6 2j   (2    )I@ , FK-PX@;l  l j_=GW=G W ? H@9l  l j__=G W ? HY@HFCA=;'R$%!X" +4&#""&6?6?6'"&#"##"765432;27232?2#"'&5432326-33= | B*   *H?j D9=TEzC6  EhC@a  % 7 E  hj XA6uS wU@H &%  FK-PX@=   ll   __ =G W =GW?H@;   ll  _   __ =GW?HY@RQOMFA?=97!X%$$#! +&#"327"'&'#"&54632654&#""&6?6?6'"&#"##"765432;27232?2JFGUr4 Lc==S7?H 33= | B*   *H?j D9=T=![N<* !X:04@:@a  % 7 E  hj XAC2TK-PX@lWH@lWG>HY@20,*" +4632"&""547676=467>54&#"#"iVYfI! (,",(!6.G@7(03WQO7h>     +OM0GR* s3tKPX@dWHK-PX@lWH@lWG>HYY@ &%$#"!#%" +4632#"'.#""&""547676=4&'. }YQ'   #0<23 (,",(!"BZj0  P5LR-     >[Y0IKPX@d["Zj0  P5LR->  "<#%jKPX@$djW=GW?H@%ljW=GW?HY@  %% +"'.#"32762#".54632] %6O#9$:&p>/E&nuQ'?  EO=)2 @.Sc<0 ({"4@1_WBGWCH  +"32654.4632#"&$2"&4K`s1lJ_m5X,!!,!qmRco;o]9ʌ . .s#6U@R Fl__W=G W CH20/.+)(&" 66  +"54>7676'&#.54632'2>54&#"32632"&#" "0m?Vy~U&7 P>$1! ' !$Ai, ($9>wR])>2Kw !),  0%$=#qJH@Ed  l_   _W=GWCHGEDA$$%!$&$+ +%#"&54632=4632#"&#"#"'&'&#"327654'.54;2632$ #$J"Xc)KA    AITHJ+0g /  !@ vV_  !Bt!,. gIMi3   ~bf'3?x@ 8FKPX@"__=GW?H@%l__W?HY@54;94?5?$&*-$! +#"&546326=4'&547>32#"'.4632#"&2767&#"h1_1EX7'& .9 0G 6WK,+(3'm,%,=?z@  HRRN5/!#mK-PXFFFFYK-PX@l =G>G?H@.l=G W>G W?G?HY@mhgeURQL63210-*) +65654'4'&54;226;23+"&"+"547>54&#"&#"+"54767676'&'&'&543232632)v#!") 2") %C , '3c s$4 $  ,/         G   c   /[ FK-PX@l=GX>H@!lj=GX>HY@ !-V2 +7;26762#"&#""547>54'&54322632 E.  ,!C( %#"*(Q. T   )  (# MKPX@? dll W 8620.,%$!   +"27654'.3+"&"+"54727676=4#"#"&54632=4632#".#":RcpE2")!'XSun *qE= !.~_RZ[nO->    "gYj/i aODhK-PX@$  l_WH@(  l_WG>HY@DB)$($)" +463232+"&""547676=#"&546;5467>54&#"#"iVYfI!U C (,",(!I  ?6.G@7(03WQO7h> t     t +OM0GR* sEKPX@#d _WHK-PX@$l _WH@(l _WG>HYY@?=($)#%" +4632#"'.#"32+"&""547676=#"&546;54&'. }YQ'   #0<23M ; (,",(!Q  G"BZj0  P5LR-0 t     t >[#Yj@.?FKPX@G  llbG XCHK-PX@H  lljG XCH@F  llj_G XCHYY@[ZecZj[jYT&7y+#$'5" +327654+"5#"&5463232=4&'&47>323263272;26?>32#"&#""326=4& u  GD-Rg|e58$^\ u' @Cz%(!2-)6D+|P[ & >(|  &'Z {"F/5M$4%.N#M@}` FK PX@`   l  j  l _G W CGX?HK PX@c   l  j   l  l _G W CGX?HK-PX@c   l  j   l  l _<;9530.*(#"   +"326=4&7;27232?2#"'&543232654&#"#"54?6'"&#"#326##"546=#"&5463232=4&'&47>32%(!2-)6D,H?j D9 =PEzC6  Eh335 | B 4A D-Rg|e58{"F/5M$4%.N hj XA6uS w;@a  - A3 +|P[ & >(# qy@^ o AFK PX@Q  ld c_ G X C HKPX@P  ld o_ G X C HK-PX@Q  ll o_ G X C H@O  ll o  __ G X C HYYY@%ywtrmf][PNKIEC>:752.('%#  5" +327654+"'"326=4&;>2#"&'#"547"&#"&=#"&5463232=4&'&47>32326327232654#" u  %(!2-)6D 5>B2 ` &D-Rg|e58$^\ \9#M"F/5M$4%.N 0="$)()6!+|P[ & >(|   )#HK#PX@.nlW=GW=GX >H@,nl_W=GX >HY@><8620$! HG +3"=4."#.47>32;2+";2>54&'&54632#"&'.#"#  0B3 A=3 !\ (A=/C9&  '25Hj#4Q@7FKPX@H  d jll W 32;254632#".#"#"&*c &2 )#< 17  0rpE= !-M-!A=&3+!:0;< .' ,Di `P^?<7# Pg@ OE/FKPX@7n  d  _ W=GW=GX CHKPX@8n   l  _ W=GW=GX CHKPX@7n  d  _ W=GW=GX CHK#PX@8n   l  _ W=GW=GX CH@6n   l _  _ W=GX CHYYYY@ NLHFA?<:53.,'$#  P P$! +%32654&#""&=4."#.47>32;2+"327&54632#"'.#"632#"'.B (%,17  0rc &6FyZQ'   #4:]J$/eGL2k\6%;< .' ,03+),6_0  Z<8-7$ 3K??K-PX@kiE  F@kiE  FYKPX@JllWGW?HK#PX@LljlWGW?HK-PX@Jljl   _WGW?H@Nljl   _WG >GW?HYYY@ ~|ywqofedc]ZYXWTMJ!))!&)(! +632>32#"'.546323267654&54&#"#"&"#"547>7654'&'#"+"&"+"54765"'".7674>32#".#";26m*2:M-* )(3(4)*)") %](*)"++,+EH$&$*19v%( 4 0>9 29<7  #13:+20    ^8J     R|B  ]a5 GFKPX@.lG>GWCH@1l lGWCHY@FD:842.,#!GG +7"#"=>54'&547>737232654&'&54632#"&'.#"#"&x/'+K9)/"&aFD8'% U(Ld k  ?  19=<%&E9-E9'*$59:>AMf FK-PX@#lH@!l_HY@ JG:987&7q +3263272;26?>32#"&#"#"54767654'&5476737276+"^\ u' @!.[ u    &'Z    ?  ">(y  JI@Fe Fnnn  n  nCHoldb\[SPGE;88&5 +4&546;2"/&#"/&'&546;2?654'.46;232?64&546;2"/&#"/&'&546;2?654'.46;232?6y! N  Y=@Z g  -" f ('! N  Y=@Z g  -" f ('       h S   ^ V       h S   ^ V (-lK PX@!d ]]CH@"l ]]CHY@'%"!-,  +%2#"&=!#"&=4632#"&=!#"&=463~    >      2    2Rյ< FKPX@9  ll W =G W=GWCG?HK-PX@4  llS W =GWCG?H@8  llS W =GWCG?G?HYY@PNKIFD+13%#" +7327>=4.'"5463>7323+"&"+"547>=4'#"&=4&#"#"54632;"7  $  2") UB2@ ?-8$$6  8    ??9C.#-'5EG I3 FKPX@<  llW =GW=GWCGX?H@7  llSW =GWCGX?HY@GEB@%&#$'%#" +7327>=4.'"5463>73232654632#"&=4'#"&=4&#"#"54632;"7  $  !#/ P>8>UB2@ ?-8$$6  8x_ %-0R> ??9C.#-'5EGD>)@&29F_W<H).:)6 ++"&5476=4&#"+"&547654'.76732632 k " j  -,2!.Co  l%%a'!DA`FK#PX@ do_W<H@!lo_W<HY@ :)9%#%" +4632#".#"632+"&5476=4&#"+"&547651X6'   B,2!. k " j ]R   j7'!o  l\{ (2@/FljmW:H)! +4'.7>73632#"&5436765462"= 3% Fn_30%t//8@5 FdS_WK/-,*&$7 ++"&5476=4'&47>73267632#"&#"e# r    !!  1c  p%  &   1~@ -FK-PX@+ndjjSWK@/ndjjoSWKY@ !$&1 +32676##&5&#"&5463232=4'&47>72  %-!!  1   f+&  0;$    22C@@.Fndl_SXL,!$%#$" +32>7632#"5&#"&5463232=4'&47>732 A%M!!  1   ;<- #/  0;$    63>4@1FnnnSXL><86-*5 ++"&5476=4'&47>7327?654'&54;232654&#" H.l    ed#  (0 p%  T   #3> J%@"FnneGE;88&5 +4&546;2"/&#"/&'&546;2?654'.46;232?6y! N  Y=@Z g  -" f ('       h S   ^ V n$ 9*@'nnSXL0.-+(&3 +&54;2?654'&54;2#"&547232767654/&c +' P X  &F f \  ,D  \ > >  (# >K PX@cW:H@oW:HY@   +"#"&54632 ')K=&8") I2)8 v$ $/+%@"[W:H  +"&54632#"321JX: )1$9-4B )%6 0[A2i @o<H" +4632"52" #!v @oBH$! +#"547632/ )5  k2Oi @ne" +74632"52" s @SWK    +#"&546;2     #r@FU>H +7'3#nKKKxx#r@ Ce +7'3nKxO#R$G'*@'Fl\=H#!&! +63232632#"&546?'q(  % ; C} # ,%0 %+@lW<H&$4 +3+"&5472>54&'&476732e  n C @   %  1D@AFlj_SWK.,(%11 +"#"&'&5463265&'.546;2#"&'&q 76 -(3'   !) !)  Q'@$FSWKIF74"f +&'&546;2632?>'&546;2+"54654/&+"5476?6'4 3  H  +? d#'E0     "   7a  78  @ C @o:H$$ +.5432#"~W1 Q !j   @o:H$! +#"5476325 Q 1W  j@Fo:H%# +#"546762#"'&'&$ C  C 0)$0 }#$| <&G9@6noS_WK  +"5463232632#"&#"(G Q #D V ( J" I%<,! @SWK    +32+"&546T !  = @SWK    +!2#!"&546k = >O @nSWK#" +27632"&5432\  :b: :11)AA)>R @SWK$" +4632#"&>#>@SWK +2"&462"&4-&&&&>&&&&( tK PX@laWBHK&PX@lmWBH@lmSWKYY@   +"547632"&547654&#"@ &+/   W $       @[W:H$#" +3254&#"62#"&4E'% B05"!08%8$-!&32B' @W:H$%$! +#"547632#"5476325 Q 1W] Q 1W  j!  j)K&PX@ o:H@ neY$ +76762"'&5432*X  X :  I &K-PX@ oBH@ neY$" +4632#"5    ,K-PX@ oBH@ neY$$$" +4632#"574632#"5  W    ' @o:H%$%# +&5432#"'&5432#"a1 / a1 / ކ| |  &'@$l[W:H$%"" +327632#"&546326462"[ 2-0 6 ?B(&&#,  9 &&>T @oSWK### +#"54632#".'."^7438 * 854^*&=L('c 8).K +. @ne$$ +.5432#"\W1 Q !j  6 @ne$! +#"547632 Q 1W  j$@!noSWK#$#" +#"&=#"&546;54632j  `  7+ $@!noSWK#$#" +463232+#"&5j  ` `  7+ >K PX@cWBH@oWBHY@   +2#"&=#"&5463 x  `  Ou>K PX@bW=H@nW=HY@   +2654'.5432#"546<+ 7(O4!   !3,B "+@(_SWK  +"&54632#"32}'47( .!'2 # NK PX@bSXL@nSXLY@  +"&546;5463232#"  $ /  O a NK PX@cSWK@oSWKY@  +2+#"&=#"5463  $ /  WO a 4@1noSWK  +"&546;5463232+#"&=  3 >  ,+ = -  7Ks @SWK   +"&546;2#    <%@"nnW?H!$$ +7#"&54632326765M-!A )#54'.54632@ $4O  -8)8A!hK-PX@!nnnbX?H@&nnnbSXLY@ !! +"&54?3#"54633254&#" X' #[" '  p3  )6Q) -(@%nnW?H  +"&54>?332>32k.7)) "?75?.&  !$: % =- @ne%" +4632#"&5 b   sNKPX@cSUI@oSUIY@  +2#"&=##"&=463  K  7-  C ~':@7 FnSWK#! '' +2>32#"&/#"&543232>54632+#+    ##S"O @ne#% +767632"'&4320 Y  X < @Fne%# +#"546762#"'&'&$ C  C 0$0 }#$| <>) @nSWK## +267632"&5432\&D& :b: j$$)AA)>) @oSWK## +."#"5462#"&D& :b: $$)AA)2C69@6noS_WK  +2#"&#"#"54>3232>, ):  +5<).(+2s6 @SWK    +#"&546;2   s @SWK    +!"&5463!2q k     0@-_SWK      +!"&5463!2!"&5463!2q k   k   j  2~1@.S_WK  +2#"&#"#"&5463232>] t, `j#1!~W0  Z02d^ 7K#PX@ W=H@SWKY@     +!2+"&546J   2d 7K#PX@ W=H@SWKY@     +!2#!"&546J k  |@ FoBH&" +632#"574) /I |@ FoBH&" +632#"574) /I ,+@(_SWK  +2#"54632654&#"546:'47( W.!'2 # sLKPX@bQXL@nQXLY@  +"=4632354632#  K  7-  C  0@-]QWK   +2+"=46335  z  Opg  o UU+?@<FlmSWK&$ ++ +"#"54>32>32#".#"#"&54.F  & !    #" $ @ FW:H +&7>762"/&'&?  $  +,     'w $ +,   'i/KPX@ o<H@ neY@   +2#"&54654&5468  9 # ,>+=v @oBH$! +#"547632/ )5  k&%5@2oS_WK  +"5463232632#"&#"(< R '9 S - H 8)x+& p /+("IK PX@bnSXL@nnSXLY$#"" +32>32#"&54632j   ) ! $ /-%('"%@"[W:H  +"&54632#"32}'47( .!'2 # !@FSWK +&47>762"/&'&4? $  +,    'v $ +,   ',%@"[W:H  +2#"54632654&#"546:'47( .!'2 # "; @nSWK"$ + '&5432 7632Y@YL 44 "3 @oSWK"$ + #"'& #"547YY3L 44  '/@,l_[WBH#%3$"1 +;254#"4632+"32>?2#"&B@% +4&& c  *"/d7(9 ' />{("muv @o.H$!+#"547632/ )5  kC' /&  #& m##/+-y\& #O#/+Q& #O#/+& #O#/+& ##/+,& #T#/+& # #/+ & N&&  &/+ /+$%5)@&W&GW&G'H4&!mQ'+#"&#"#"547>54&'&54323!2632#"'&'&+"'(!CL!(&&!D"  +%="!  !"#  J $ !h)*@'lj.GX'H5'5"+%&#"3!25467>3>7>32#!"54 $N-  xL  /    (L=%+2<KPX@,d  ` W.G)GW/H@-l  ` W.G)GW/HY@<975/-+(%#&2 +46732#"&"32654&632#"'.+"#"54767632;22,SOJjlnt   {6   "@D}b:o BA & ;:B,.?MKPX@l.G&G'H@lj.G'HY@ &!Y)+%#"&#"#"47>54'&#"#"&#"#"547>77>3>7>323/$! fD !"!?R!*  7'   H   !#   a01b"JmKPX>F> FYKPX@Gd  l  j  _.GW&G)GX 'HKPX@Hl  l  j  _.GW&G)GX 'HK,PX@Pl  l  j  _.GW&G)G)G X 'G 'H@Pnl  l  j  _W&G)G)G X 'G 'HYYY@3LK%#igb`^[XWQOKmLlCA:96321*(#J%J "!+"#"547676323!27632#"'&#!27>32#&#!""&547676327"#"5476762;27632#"&'&#'!   7$6  ,=L  Z+    O       M 56  :-&:  )8 4@   .L S*'-2 C@W&G'HQ-Q'2+%4#!"#"&#"#"547>54&'&54323!2632#"&#"#"5476\ N!CL!(&&!C=!' '(!CJ!Lc=  !"#  "<"!  3RL2FK,PX@+lj.GW&GW'HK-PX@/lj.GW&GW'G'HK/PX@+lj.GW&GW'H@/lj.GW&GW'G'HYYY@ !a&#-D&"b +46332727632#"&/&'&#"3267632#"&#&#""#"54>76'. od7>    :n 4(0   3@wQ$@kjw J% A   % X2wz7;2@/6+FW&G'H1/'% ;;+2'&#"#"&#"#"5476=4.#"&5&7>327>P@= /C_i)&!CL!N(F-C5 O)*F) &2M= !"+  F0gb@35)::::)# F/@,0*Fl&G'HA<;965$+%>54&5.546754&'&5432326323#"&#"#"547>7MkhKnfrr%!C=!Gtt (!CL!7s jJUT yK]r; }di     |di    ;Z4@1lj_&G'H#$*#%Q& +%#"&#"#"547>=4.#&'&'&#"476326=4&'&5432326322367>32#"'(!CL!(&K,(+"@ (%D'V&!C=!' W&D%( @"+(-Q c""  ""  '#kV \J}  "  " |J\ Vk#' ']@ \PONFK,PX@#lW.G W'HK-PX@'lW.G W'G'HK/PX@#lW.G W'H@'lW.G W'G'HYYY@[ZYV(!+("8% +%.54632;27632#"&#"&#"#"54767>54.#"#"&#"#"#"'.'5'432;27276Ob{aN 0T   316 3L4iA[uE@ 713   3*' Q$W{Z(+ 8"   &KF]a`/ /  "8 B&'#' /+-0' /+' /+A& S/+' && = '&/+ /+# =ŵ FK PX@3lj_)GX/GW/HKPX@5lj)GW)GX/GW/H@3lj_)GX/GW/HYY@ #*("$&#" +%4&#"32>#"&54632327>3232>?2#"&+?'[:K4]@18hS<CF@C)Flj_W(GW/G+H("%%%,!" +%4&#"#"&54>7654&#"32646323#"'&#"#"..%?  R;(IMg9Ac\d?G ??{SG4 &&%'<@  D}"Erc3@Q蔴tH4g Y?Mf; p#P758+bFKPX@ ljW)G+H@$lj)GW)G+HY@ ##!(-#+767632#"&5476'.#"#"5463232?4 6` "8R+* <)+Vdv&g8&G!Mi H] # 9kFKPX@'lW(GW)GW/H@%l_W(GW/HY@ *$%,%$"+732654&#"4>3276'&'&54632#".'&#"#"&U9/`Kk2'M,+ IJ01la"< +Ah6*sB7h%9rO%Gx<-mT wM4$ $_?/C|@j;^g-01rK PX@,dl_W)GX/H@-ll_W)GX/HY@ $$!$"."+%#"&54>76'.54632#"32632#"326?20W=,C lG,/;C M%&\, '> c1@7(.  :V!2.-  ." #BNAdK PX@$`[(G(GW'H@'l`[(GW'HY@ S##Y#)4&+7467654#"&5463:327>3232632#"&5432654#"#".#?; '<=# '< !]+%d1M.%3D'Z $-B]+)!-# 15@(>MHw"< 6G5KPX@ lW)G/G+HK(PX@&ljW)G/G+H@0ljW)GW)G/G+HYY@ #(&$5#!+4#""546323:67>32#"&747654#"#"&5476z0 5#(^( ) )"_' H >47/;cn,(2E(3GM* JC-+>@;_W(GW/H%#++  +2#".54>"325&'"32>76&*M)(H,+N)1U.6   0#.n:3YuEMxJJ`4  *N\8/PZ2 AxK PX@)GX/HK PX@l)GX/HKPX@)GX/H@l)GX/HYYY##"$+32>32#"/&32   *#52'W!0dV@KPX@)lj W)GW/HKPX@/ljj W)GW/HKPX@9ljj W)G W)GW/H@9ljj  W)GW)GW/HYYY@><;9#%#!')#"" +732>32#"&'&'&#"&547654#"#"54632327>32#"&#"C9>$9  0 5#=u% LBIY 4?2#8F >f* JCFH >47/; ^sg 7>@;ljW(GW/H/-*('% 77+%?2#"&'&'&#"&5<>7676'.#"#"54632[ <& l ""/5 <).: !$A 45$i T$ k&GH+' HaACLrFK(PX@W)GX/G+H@(W)GX/GW/G+HY@FD><64(& LL +%27>#"&'&5#".'.#"#"'.54654&54632327>54632) $9'   + '/ J# '0(:0""$>4< "$F"P73@C$2K9F2YG!2?"F]'XFKPX@lW)G/H@ ljW)G/HY@ #'%*!+7327>54.54632#"=>54&#""54632 %I  %& # .)Fk !x:*A&" \ 9#BbW:OMFK PX@=bl `  [(G)G X 'G W / HKPX@<nl `  [(G)G X 'G W / HK,PX@<nnl `  [)G X 'G W / H@>nnlj `  [ X 'G W / HYYY@FDCA><97310.$"! WW +"5463:327>32263232632#"&5432654#"#"&54676'&'.54676c=#3 I" ;*Z(6["$P&3:#f:M.%3D*v 37@- 0 LG!-7 +  F@%/ !G4.)(Hw"< P.=l&  + S #m &@#W)GW/H   $"+%4&#"326"&54632E1$Da-#FdDHdP1Gm&=hF'9d~SXD`7T} @K PX@(  l )G W )GW/HK PX@.  lj )G W )GW/HKPX@(  l )G W )GW/HK%PX@3 d  jj )G W )GW/HK(PX@1 d  jj  _ )GW/HK*PX@6d b  jj  _ )GW/H@6  nd b  jj  _W/HYYYYYY@=8531/'%  @@ +2#"&#"32>32#"5464#'&#"&54?654#"#"5463232>"4   $"6 C (  4H  RX*$ - ,/d23"b (3S < '%@"W)GW/G+H#')&"+%4&#"32#"&5454632#"'&a4$10& "bRIKlP)' &=0`D**:%V7,\vx3B6&3@0[W)GW'H! &&+2#"32632#"&5432654#"#".546 0Ls+%d1M.%3D'Z $..PC)>MHw"< 7G*R#)KPX@)GW)GW/HK PX@"d)GW)GW/H@"ndW)GW/HYY@(&  +"&5463232?2#"&#"'32654&'&#"ENw=%Y,l1$HU CPOV $/65Q)7gH"Ew1"K PX@'l )GW )GW/HK PX@-lj )GW )GW/HKPX@'l )GW )GW/HKPX@-lj )GW )GW/HKPX@3ljj )GW )GW/HKPX@3ljj )GW )GW/HK*PX@:  lljj )GW)GW/HK1PX@: n  lljjW)GW/H@8 n  lljj_W/HYYYYYYYY@.,+)&$"  11 +2#"&#"32>32#"54654/"#"5463232>"X   8$>'C> O.*m$ - 1ZB $L &KPXDFYKPX@W)GW/HKPX@lW)GW/H@"l)GW)GW/HYY@ $'&#!!+4#"#"5463232654&/432#"&546x0 5H"#5W !8vI2B&H >k ,"uF*O32"325'.'>54&'4654&@NtW=%++6~xhLj;1&2E4PnH#@X>-H0LbsP6 #',7l:_;t;*FK#PX@*ljW)GX+G+H@(lj`W)G+HY@ #!)*#!*#+#"547&4'.#"#"546327>3232632#"'&'l9&5 <).: j "-: <&B#EA#! 2R?' HaAB  (0Y_E" 45?\Nh>}KPX/F/FYKPX@W)G/GW+H@$lW)G/GW+HY@:964#! >>+"#"546764.5432>7>32#"&=.'.H 5$3#  "(>0 %"V1"4F #H =8n[&2e*] OSRX  [q_70pIS_BpF#;)@&_)GX/H'(%""$)!+%32654.5432#".#"#"&54>3232654&546320(51 0PTI#*9%:9=A AA 8> l;fE$='MU,,,,oI@x<Ll*"64+ 3 : H&  /+H&= ' /+#m' !/+' '/+#' +/+>@ :F0EKPX@0l __W(GW /H@7  ll __W(GW /HY@ 42,*&$! > >" +.#""'.#"#".5463232>7#"&54632>32`U5;,- + &$;fT2.S/"  /&C}|E454&'#"&54>7.467.54>32HcfF!Da]D VwvV RpsTgiH:B!Jz9D:Ef 8yk# :c2"E$ !; 7,(#%.PK@H&51F_ _  _)G W/HPNGE($#&%)""% +#".#"#"&5467&54632>32'&#"324''"'32654&5463232&$L1#*9%:95! [-Cv(  `9]-Ea[|UQ@4' 8> (ng?K6jK,,,,oIJh"071  @-j.&%1*B"64+ 3 : ;#m)9@6 FW)GW/G+H(&" +"&54632#"&546?4&#"326DHdP1GL>1$Da-#Fd~SXD`7Fp8,*#G&=hF'9dB/zK PX@$[)GW )GW'HK PX@/[)GW )GW )GW'HKPX@$[)GW )GW'HKPX@/[)GW )GW )GW'HKPX@,[)GW )GW)GW'HK*PX@*_[)GW )GW'H@*n_[W )GW'HYYYYYY@*%"  // +232632#"&#"32632#"&5432654#"#".546P$ ' MJn+%d1M.%3D'Z $. 6YD)>MHw"< 7G*T)<3KPX@'l_)GW)G+HK PX@.ll_)GW)G+H@.nll_W)G+HYY@-+"  33 +232?2#".#"32>32#"&#"#"&54>%D\" 4U+_*  " 6 $/ 0  % 3B%V7{R+@@ F)#DK PX@no'H@nneY))&+#"54>54'#"&547%&'#"&547%&'&'&'46l ,   ) ^(@sUC]"AB ^I"x6JFKPX@.ljjW )GX/H@4ljjjW )GX/HY@A?%#!('#"$ +%32>32#"&5476'"#"&5467654#"#"546323276767>320.,>$/= C  $: 0 5# ?# , #)!5O 4?J2;2 D!D* HWH >47/;5##/ , < '%@"W)GW/G+H#')&"+%4&#"32#"&5454632#"'&a4$10& "bRIKlP)' &=0`D**:%V7,\vx3#R0@-ljW)GW/H$$##$!+&#"3267632#"&54632#"$!Da-#'Nh;DHdPF'<hF'94A~SX< .l.4@1  FlW.GW/H%.$)$+%>32#"&54632'&'&'&#"32J  -@hؔFH( 3`k54&#"#"5463276763232>32#"&=.pjV +  5$;*=/&   *# ?o_ A)"P737h4  B!5.:)!$ 031  F'V 'V&p@ 6Q FKPX@9n l oWGWG W GH@7n l o _WG W GHY@lj^\TRPN*&"b&$:Q% +%#"&#"#"547>54'&+"#"5476763232767632#"&/.#"327632#"54>7>54&#"NP!CL!'&).     >G!D gA  $$(  .A  J&   )z@~Z=  O_P'yjF'T-TO@ IFKPX@:l_ G  W GWGGWHK(PX@= ll_  W GWGGWH@@ lll_  W GWGWHYY@CB><8654('"  OO +">323276#"&#"32767>3##&546322'&'.'&hV~El##-$l*/1f@j8   ?nu7>>  ! 3xn,& 9|`5. '5… B+ . 3)6B,B3&G/+8,-BR  FK2PX@0d  _W GWGWH@1l  _W GWGWHY@PNIG421/+)#  B= +27632#".""547654+"#"&5463232>54'&54322632654'&#"!53C\k;)D\'5&::!E#0A/"%.(B!N "<`J >!  7/`V9W"  <3*wJ "2kÃ6  !`?T)%mK-PX@&    ` GGW H@&    ` GGW HY@%lke`XQJG@:-+*('%mm +"32654'&#""5476=4#!"#"&#"#"547>54&'&54232623!2=4'&5432326232632#&"<`J >r::!D,#!C>!$#!:8::!D(B!C.:!" I\k;)D\FL !`?T)  < -  %%   ; :    $`V9W"r @ R \FKPX@7 n  l  W G  W GWGHK-PX@5 n  l  _  W GWGHK2PX@9 n  l  _  W GWGGH@7 n  l  _  _WGGHYYY@pnljecXVPNLF&$:Q)!+%"&#""547>=4&#""&#"#"547>54'&+"#"5476763232767632+.5.#"327632$!:59:!$<@!D $!:5H!'&).    7.+" MK+!#"".+"#"547>54&'&5432326323!2654&'&54323262#"u L!(&&!C=!'  &!C8:!&"'!kkkk !"#  "<!(#  #<"! $ LU@Rd_WGWG GW H KIHF=;9730+*$"! LL%" +732654'&#""547>54&'&5432;2632"&'.+"327632#"&#"(%<`J-;7!(&&!C#  " 38\k$9gX:l"%Y?X)$ !"# ?  2`V5 " %2N+@(OWGWH%#3%K43+73!2654+"232#"54&#!"#"'.5432>54&'&54323272632"  @\  $66$,H: %!B]@!'$: 8" 6+^DE^+2{:ẅ    ([@X d`G W GG W Hrpomig][RJA?53/-,*$*!+4#"#"'&54367>7>76'.'.#"#"&54632326=4&'&543232632327>7>32#"&#"2#".'.'.#"#"&#"#"547>5 )(./ $)9 L"e    $ ,3 ;'!C=!(; 3, $    e"L 9)$ /.() '(!CL!(&61& h&0 % .?4. :0 "  ! 0: .4?. % 0&h &1""  ""#EZ@W(Fl  l __WG WHA?<:31 EE +"#"5463232654#"#"&547>32#"'&'&5463232654&.) (''yU" j$Rr %&01PZ0;> K*KN=S I2 #9-OM@  %<)6T/M ,4=eG?W%Y_K-PX1F1FYK-PX@WGH@WGGHY@ m!!*(!| +7654'&54323262"&#""547>54#"#"&#"#"547>54&'&5423262|A!C0:!#$!::::!"!|&(!C>!$#!:8::!D' q0    <'  ]3   %%   %Y' YiU@Rd  `GWGGG W  H_]YWB@?=97-+# ii +""&#"#"547>54&'&54323262327>7>32#"&#"2#".'.'. E!:4J!&&!C/:!#; 3, $    e"L 9)$ /.(GJ   !%"   !0: .4?. % 0&h &1AjK2PX@#dWGGWH@$lWGGWHY@9431$ A@+"#"&54632324&'&54323272632#"&#"#"547654#B ,;,"%w%!B]=!' '(!CL!N `vI "  "<"!  =8a0%+-2J@WGHQ-Q'r+%4#"&#""#"&#"#"547>54&'&542323272632#"&#"#"5476Q%DeO!CL!(&&!::1"4=!' '(!CL!Mc =  !"#  "<"!  3.l&7yE\K2PX@lb\H@lj\HY@DB><4,#! EE+727654'.'&543232632327654&'&43232632#"&54632 #! O6 !&s  y!!.B !,@V(#+$0: d1-      Bw!"( EK PX@*b   d `  _   HK PX@+b   l `  _   HK&PX@*n   l `  _   H@2n   l  m ` S WKYYY@"@;:854/.*)#  +%"264&5"&546354&'&5432326322#3#"&#"#"547>I\id^hf|~%!C=!G|~ (!CL!7mwXj-†tq   mx   ;3M.@+PGXHE=41(  MM+%2#"5654&#!"#"547>54&'&543232632;2654&'&543232632,RL!(&&!C=!' !&!C=!' )7+%=) !"#  "<!)#  #70~GT@ CAFK-PX@`GH@`GGHY@ *!z(g+54&'&542326232676=4'&54323262"&#""5476=&#"f#!:8::!DEC)V C!C.:!"$!:9::!E b<%   :~-9 :   !<'   =#h!@GXH9-2+;2654&'&543232632#"&#"&#""#"547>54&'&543232632;2>54&'&543232632.>!&!C=!' '(!CG1ԆL!(&&!C=!'&!C=!' &63)#  "<"!   "$  #>"$  3n4@1PGXHe]TQIA74+# nn +%2#"=4&#&#""#"547>54&'&543232632;2>54&'&543232632;2654&'&543232632 %3jԆL!(&&!C=!'&!C=!' >!&!C=!' 2* 7+T7  "$  #>"$  #63)#  "9 mWI@FF_WGWGWHRPJHC@7/&$WS($ +%4&'&#"32626327>32#"&#"#"547>54&+"#"&5467432323/$2+ 'GU=!'! "\m$9gBK!(&1"   `%1F $B- "5bV5 " "#!  ?1Gq8@5 Fl`GXHQ-"*$ +%4&'&#"3264&'&54323263227632#"&#"#"547>54&'&543232632#"&#"#"547>5/-; GU&!C=!'! $:\m$9gBK!(&&!C=!' '(!CL!(&1F *o%B#  "1 bV5 " "##  "<"!  !"G1@.BF`GWH91$GG($+%4&'&#"3262#"&#"#"547>54&'&5432326327>/$2+ 'GUo\m$9gBK!(&&!C=!'! "1F $BbV5 " "##  "5.TK@ J 51FKPX@:  ll  _  _GWGWH@=l  ll  _  _WGWHY@GEDB!"$%'%$" +.#"&56763>7632#"'&'&5473232>76#"#"&#"&54>32327674tdZ3 !  >>ELYt5/   C[Fe-1>V/-4(^7kq3 . +B Zh5' +=\O 7-"#+KJ@G`G WG GWHGE=;9731/-%KH +"32654."547>54&'&5432326323>32#"&'"#"&#"`s1lJ_m5Xu!(&&!C=!' w u '(!CLqmRco;o]9 !"#  " Æл "! `C@@_GW GGWHKIEC75,'&$``'$ +3276=4'&#"722632#"&#"#"5476=4.#"#"'&5432>767>76/.546")9/ '=YE(=!' '(!CL!N )  #[. )'. DZ3E  $On "<"!  < %0R , %7"f:aZ#D# //@,nWGWH%#  +"327654&632#"&'4767>76327->;@F3]UnmjY]O<" "x &$Sdn=!OMu9XvS`z_H  4  ;IN@K  _ W GGWH=<EC54&'&'2632#"&#"#"547>54'&54322>54&#"'7! 2RXL %942$;) %"Q#&*;_2$+ *5Q+(!.  %   #,`X<dK-PX@#ljWGH@'ljWGGHY@ S'1.!# +73#"&"#"547>=4'&54632;262#"'.#"&#"  )"+ . " & < >   ?  A )&#&u[T@Q7 T= F PWG    X  HZXRPJGA?421/$"![[ +732654+"'27654&'&54632;263232632#"54654&+"#"&'.5432 Y9N.  "      %,,h8P  *   ) $' ,$ 8JhHl@ F.EK PX@Bd  l  `GWG  G WHK-PX@Bd  l  `GWG  G WHK2PX@Jd  l  `GGWG G  G WH@Kl  l  `GGWG G  G WHYYY@&zxtrki][ZYXVSRGE$/!$&'!&+%54'&54322632327>7632#"&#"2#"'.'&'&#"3#"&"#"547>=4#"#".5436767>767276'.'&#"#"&5463232,&!"# +"2 & " 3 -   %")  + 4 1 % 2", ^'    (^ 2E6!3, c .r       r.  c ,3!6C3 L=F@Cll__ W GWH97$$!"!$"%( +7#"&'&543232654&#"#"543232654&#"#"54767632 R&=8Q "C)3 ") #&5'   D7F&6  L/,!0$#3@ -d(cjK-PX/F/FYK-PX@ GH@ G GGHY@VTSRQO@>=<;9!/!' +4.'&54322632#"&"#"547>=4'#"&"#"54767654.'&54322632?6n %"'  +"+  +"+  '"% S                i' y/+j!3 FK PX@6d   l  `GXG  GHK+PX@6d   l  `GXG  GHK-PX@7l   l  `GXG  GH@?l   l  `GGXG G  GHYYY@a_^]\ZWVMKDB>7632#"&#"2#"'.'&'&#"3#"&"#"547>5Z%!"#% ,"1 '  4 +  )") J%    '] 3C7!3, d  .r      EK+PX@&   dWGGXHK-PX@'   lWGGXH@+   lWGGGXHYY@EEDB><85+)('&%!1, +77654&'.54632;2632"&"#"547>54+"#"&54632M   !   ('") Y@'1/K    &    &&k*! f_mK-PXFFYK-PX@ GGH@ GGGHY@[YXTNIHF43210/! +"&""547>54'&#"'&"&""54>7>7654'&543232632?6;2>32  (,",(  y   ($"(  -3! n! %,U>$    7      :  :  bfK-PX@  ` G H@%  ` G GG HY@a^USRQPN?=)9!/!&+4&'&54322632#"&"#"547>=4+"#"&"#"54767654.'&54322632;25^#"%  )")  )")  %"# Q      {y         g#RS]K-PX@ WG H@ WGG HY@IGFEDB20/%$" SS +#"#"&"#"547>54&'.54632;:23272632#"&"#"547>54Q $"%    '/:T "   $"% i&            &S#tF CmK-PX@ W GW GH@$W GW GGHY@@?8730&$#"!CB +27632#"'.+"#"&"#"547>54+""547654623@%  P )")  @    %  "       +/ GK-PX@dGXHK2PX@ dGGXH@d\GHYY@>=<:64(%$"!13 +&54;226;2?654'&54;2326;2#"&546322767654'&!"$OC+" -*  ?tz  %  .  &Kp*)  %)#& FK-PX@% GW GW GHK2PX@) GW GW GGH@+lm GW GW HYY@FEA@:819 +"32654&#+"&"+"547676="&546354&'&5476?322#>NKAF?NKB )")!Z][Z]~hDKtgELu     sV]k ">(_sV] [uYt FK-PX@P G XH@"P G G XHY@PNMLKI@=310/.,YY +%2632#"54654&#!"#"547>54.'&54322632;254.'&54322632   %"$  %"$ ' ' $&      &&    PaL FK-PX@  `G H@"  `GGG HY@OMA?/!**!' +7'4&'&543226323276=4&'&54322632#"&"#"547>=4&#"&8 $% " =#"%  )") )H-AZ    H( g      m.fmK-PX@ G X H@ G G X HY@#dbSQPONLC@754320'$fe+3"#"547>54.'&54322632;254.'&54322632;254.'&54322632#"&#k  %"$  %"$ z %"$        &&    &&     uukFK-PX@"P G XH@&P G G XHY@'omb`_]TRQPOMDA865431(%uu+)"#"547>54.'&54322632;254.'&54322632;254.'&5432263232632#"54654&a  %"$  %"$ z %"$ .        &&    &&     ' *&  F@ .CFK-PX@.l_G WG W H@2l_G WGG W HY@ ?>;987641/# FF#% +732654#"'"#"54765462;26327632#"&"#"547276?4& &9_|   P& 3-])")  h5$`! 1)   e65   K,9ey(FK-PX@"` GW H@*` G G GW HY@^\[ZYWHFEDCA#',!.!!+%#"&"#"54767654&'&543226327632'32654#"#"&"#"54767654.'&54322632w)") !"# 3-] &9_T )")  %"#       e6h5$`         w,9a(FK-PX@`GWH@$`GGGWHY@ #',!.!! +%#"&"#"54767654&'&543226327632'32654#"w)") !"# 3-] "$4_      e6h/*`k=&FK-PX@> l  ll  _  _ WGWH@E l  lll  _  _ WGWHY@<:6431!!"#%$$&# +#"54767632#"'.43232654#"#"&#"#"4632327654#"R   9DJepW<2  1#2<4 * 6 D U 'sO^ 6 YK / qEQD FK-PX@+  `G WGG WH@3  `GG WGGG WHY@PNJHB?!/!*#$" +7>32#"&'4+#"&"#"54767654.'&54322632;764&#"326 iLUohdPh@ )")  %"# 89K=+=<:*"$'! +%4#"#".543>7>767>'&5463232632#"&"#"5472>5'2=4&#" " 3   ZV> >! +") ::!+'  [.  = Q3<     n-%9h&VvjQ&Gv/+(PK-PX>F>FYK PX@'b  o ` W GHK-PX@&n  o ` W GH@*n  o ` W GGHYY@KIB@#%$(!)" +%4&#"#"&"#"547>5#"&546;.'&5476?232+>32#"547>q;60%$") 6 ,[ F*HQ)322632#"&#"iH>% dBJayZL' 407. P' B CDDsO_0  N>  # %VhL/+Q&/+gM/+NJX FK-PX@2 d  `W G WGXH@6 d  `W GG WGXHY@XVRPDBA>+!$$:!!%% +7632#"&#"#"547>54+"#"&54632327654&'.54632;263232654&#"w3:5[P(+ YB/    !  . ,3.1,G2%I9  &&n*"!P     a,)1,gdrFK-PX@)T ` GWH@1T ` G  GGWHY@rplj][ZYXVNKCA@?/!*(!%$+%7632#"&"#"547>=4+#"&"#"54767654.'&54322632;2=4&'&5432263232654&#"3:5[P("! %"-  %"  ")  +4.12%I9 {y        ge   a,)1,WK-PXRFRFYK PX@%  b   ` W GHK-PX@$  n   ` W GH@(  n   ` W GGHYY@USOMIGBA$(!*(!% +%#"&"#"5476=4&#"#"&"#"547>5#"&546;.'&5476?232+632+)"%'<"7 %$") 6 ,[  UB3@D    %5       2+ " H2 x ??9'{'yi& b/+WVK PX@c GX HK-PX@o GX H@!o GGX HYY@TQPN?=):!/!2" +#"54+"#"547>54.'&54322632;254.'&54322632#"&+"2P  $"%  %"$  ^ +~      &&     BtwX FKPX@4  l `  _  _G W  H@4n  l `  _  _ W  HY@ld_]ROKIDBA>5-$!wv($+%4&'&#"326"#"54767632;26=4&'&543232632;2632#"'&'&+"7>32#"&#"#"547>54.#/$2+ 'GUo:  d &!C=!&!    + "\mc9hBK!(& 1F $B-) 2& #  "86 $  Y bVz0 "#x Z i@*9=RFK-PX@4n_ WGWG  W   H@8n_ WGWG G  W   HY@ifdc\[WTNMJHGFEC&3("7!#%+732654#"'54'&547672432;27632#"'.+"7632#"&"#"547276?4+""54765462;2 &9_Z.[ F%  J 3-])")  :    %/ h5$`3?  ">(* "l65     +/  --v@,%FK!PX@'_WGWGWH@%__WGWHY@ !&&(#!!+#"&#"32654&4>32#"&"632327&l[4(t(ED cntMl,SO[4(t(ED O<3u ]bD}b:o<3|#".Q@N  F__W GWH$#*(#.$.""%!! +%#"&#"327654'"63232>7.'2#"&546y&"RL4K9 '"P I"VxwkUr( D`7'O ((]) >UwR^rWV./@,djGWGH#!$"+>32#"&#"#"'&'&543232632277#) $#0!SI!  (F--4,KGT  -{K&PX@dGWGHK-PX@d_GH@ d_GGHYY@ !$-17"+%#"'&'&54;226;27>32#"&#"" z!"#J 0Q)! #N'8(   ";w ! ' ))/+&.8$@!SWGHmQ)B"+>32#'.+"#"&#"#"547>54&'&5432;2>  '(!CL!(&&!D$ S  ="!  !"#  ^Ez=FK-PX@$l_ WGH@(l_ WGGHY@DB974)(& EE +#"3#"&"#"547>=4'&54632;223263267632#"&N  )") . "  %'i&   ? 3#]m<I~K-PX@ GWHK2PX@ GGWGH@_GW HYY@A?>=<:10'%$#" !) +#"&"#"547676=4/&'&543226322?654'&54322632 )")!$R !"#PR-(% T)     6b'   $ (  &Le^^HFKPX@d`GH@l`GHY@ Q'#))$# +%54'#"&546;&/&'&54323263232>767654'&4323263232+#"&#"#"5476y `u7"! O6 ! \ :!.B !(<5:|  s)&!CM!Nl   X  &Q:,  XQc  "+  \XFK-PX@# G X GWHK2PX@+ G G X GWGH@)o_ G G X HYY@[YVTKIHGFD!($*!)+#"&"#"547676=4'#"&546;&/&'&543226322?654'&5432263232+ )")! j  Q R !"#PR-(% Tf ])     ) '   $ (  &  B,y' L W /+i' w/+Y' Q#i& Aq/+'Q#Q&*q/+O# Z' V/+hi& ^v/+lQpl'p>&*3'FW/+Q'w/+#3&PX/+LQ&x/+#yT% 'Y+&K y /+%' YQ&ky/+-'_#Q&b/+-a#6@3]WGWH%"+%!32765.#"372#"&546zM7K O59DEVxwkUrHg7'w@Z(#OwR^rWV-'#Q&b/+.T3'n/+kQ&/+y 'd+&+  /+y'dQ&K/+yR'd&r~3'h/+Q&:/+13' l/+KQ'/+#R6-x4# T:Z w 1# jf@cU F  l  jlj  jW =G XCGWCHig\ZTR%"-&%)/%" +4&#"32>54&3267654&54632#"&'&#"&5467>76=4#"#"547>32327>32326  45 \289 (T$*A,I J_ XE* #I7=0 "7Ih !&9 4*C " 2"     "#.  2- !) 8S0 3.(  29!/ B'<   ; Q 3  f <,   :   ( XtD?K-PX@=G>H@=G>G>HY@ @=<;:718, +76?67>?67632+"&"+"547>54/&+"&"+"5476B V m &"  GL  )")-'  %&  "      8 M > /+OW /+ /+O /+ /+  /+ /+ /+ /+r /+  /+  /+  /+` /+  /+ /+ /+R  /+   0<6@3Fl_SWK)$,"" +".#"#"&546?>=4&#"&767>23276'3276=4  $'O #- <.& A )     |'-5 4P@M$#Fllj_[<H31-+*)" 446! +4#"326""&5654&'&54767323632#"&P .& &0*3DR6<` ">&-6"   r@14O7 >b@_-Fl  ljj  _ [<H 9764,*  > >  +"326=4&"&##"&5463232=4'.7>3232632,G-&7 6BNH  &  (.5g"M&# C/ANK( %#   (;@8#Fl__SWK$"#5$$1 +;27654#"4632+"327632#"&F) ('=P8 0 !_ ,$71D!J7O#" , !F  *;@8&Fl__SWK#"$53$3 +654+"327+"&5476372=.'"#"&7632& (+RL;0 &_ -#!?.GVkBD$! 1 3Cd  /;J@ )# FK PX@4  d  __ _ S WKK-PX@5  l  __ _ S WK@;d  l  __ _ S WKYY@#=<10EC7&54767.546"32654&2654'&'#"yB"@-6HEV:0I#*  D%$+)!% ,E "2N!$ & &+4'+'&/ 5N2@//FS'&54;2+"54654/&+"547654&'.767h+ \ 04"!uOa 84 #     ' =  O   l9@6[`-FS_WKjhcaZX<+<+8 ++"&547676=4&#"+"&547676=4&#"+"&547676=4.'&47>?326327>32  h #   g #   e  25- 4 '?    m##k    m"#k    q *%  &#   0@-_SWK      +2#"&546"32654&1KH@3HP,( ( H08PC58P4'+>4()?o2AH@E"FllT__WK9!$(-$% +32654&#"4&'&476732>32#"&#"+"547276e5,7", 50;V= ( k! 9)..   C-7Sh   ;*1@.Fn_SXL%13''" +#"&=4."#&54767632;2+"32762* # B81 ! '*&x   A@K-PX@F1E@F1EYK-PX@'nnlSXL@*nnnlSXLY@=<75/.*(@@ +"465#"&=4'&5436763276=4./&543>723276#.=!)4     %- *%"r   e ^    w*&@Fne73 +&54;2"/&'&54;2?654R VZ]**    f dIRAUV  +@(l_SWK$"$)" +4632&'&#"327632#"& Q84(&,%& D(.A8O 3!,6 &G3e@ !FK#PX@ do_W<H@!lo_W<HY@ #%*722 +;2+"+"5476="'.7674>32#".#"pE5n..'   B0   1J&    6C@@0Fnlj_SXL%"74'8P +3272;2>7632+"&547676+"#"&767632E"$@ }F     P0 <   <  iH  + 4\@[:H  +#"&546;27>7632 " 1;   ?P" 1K-PX@2l  j  lo  _W BH@7l  j  lo _  S W KY@+)'%$"  11 +2#".#"#".#"#"&546323263232654&54>2&F $D5#C #08%%B65( '4?%%G77 ,' $ p/+#&CD%'%b'E /+3' % |/+@'EO& r% |/+s&HE.lF'Q'+&#t'&~F%''#a'G /+3' 6' |/+#@'GO' ' |/+#s&=G''#'G$' ' |/+#&gG ' '( /+h& }|&  H|/+ /+ ' 0'( 0/+h' |&  H|/+ /+$ & ( |/+h&LH2 ' ( |/+Ch&"H 4''(h`&*'H/+%')Q'I/+- '* +& J /+%%'Z+%'KӰ/+%3' k+ |/+@'K%'+<'^K/+%&)+ /+ &K /+%0'  + |/+)&>K2B& , |/+Ch&˿L/+B&us&,s/+' W&/+/+F'+.)'N/+3' '. |/+@'NO' . |/+s&5N3?' / |/+@&FO3? &' / |/+@'&FO/+O?' / |/+s&O$?' / |/+ &OaF'0'XPa%'0R'P3a' Z0 |/+@'TP%'_1R'Q3' Y1 |/+@'QO' 1 |/+s&UQ$' 1 |/+&Q-' "1'2 1/+#' & sR/+/+-''2/+#'j& sR/+/+-' '2 /+#' |& B R|/+ /+-' "0'2 0/+#' |& B R|/+ /+F'3'S%'3R'S%'5IR&OU3' :5 |/+@I&QU3 '' :5 |/+@I+& &QU /+O' 5 |/+sI&U)%'6%R&AV)3' 6 |/+@%&uV)y'T' 6T/+/+3' J& WV/+)'}&Y6}/+%' B& <V/+)3%'' 6 |/+@%R&A&uV%'7#2R&W3' 7 |/+#@2'WO' 7 |/+#s<&W$' 7 |/+#2&0W3' 8 |/+A&GX2' 8 |/+C&OX$' 8 |/+&yX' )1'8 1/+' & xX/+/+''8/+&g~& G X~/+ /+!'9X&BY/+3' 9 |/+@'YF'Z:'ZF':'(Z'H:Q'Z/+%':R'Z3' : |/+@'+Z%'A; R&|['; Q&W[/+m%'<R&{\L('=t&?]3L' = |/+@t']OL' = |/+st&]s&3K2Q&W/+'Z&{\#'DQ'A/+9K-PX@ 91F@ 91FYK!PX@lWHK-PX@!ljWH@%ljWG>HYY@53.,)'" 15 +7+"&"+"5476=&54?54>32#".#"7632+)")+6 =+DG$&$" )19B BE      !/R|B  )]aR" "Aŵ.FK PX@, ld _ W HK-PX@- ll _ W H@1 ll _ W G>HYY@<:8620&% AA +".#"32++"&"+"54765"'.5476747#"&546;>32 )M{n+)")+ (<  =m7$%^mj     A5MI  )!UL@IL  FljjWBG>GXCH*)~(5#+" +%#"'.5.'&63232654'&#*&4?6&'&#"#"&"#"5476=4>323v;  6 9DJ+a  %F.G*!RT!.ERbi *aV_n^ .6.`?Z) /PZ3Ya+)  !##.%" +%4&#"3276.546767>7632#"&#"#"&54676ld%)% K/H) H21D.A)[5$#4&+6|l@p]NDv0(OJx44! +=  ? % &;B&]vSEt3' $ |/+#@'DQ' !$#&7DZ' 0'$0/+#'  f& KDf/+Z& g0'$0/+& f& KDf/+q' ! '$ /+#' Y& KDY/+'|'$|/+#' 4& KD/+3('' $ |/+#@&5'D' 6e'$e/+#' k& Dk/+/+' a'$a/+#& ]k& Dk/+/+' !O'$O/+#& :W& DW/+/+''$/+#' 4& D/+/+34'' $ |/+#@`&'D/+3 ' ( |/+@h'H Q' !(h&KH !'(hX&;H/+Z' y0'(0/+' f& _Hf/+ Z& 0'(0/+h& f& _Hf/+ q' !W '( /+' Y& _HY/+ '|'(|/+h' H& _H/+3 ('' ( |/+@h&I'HBQ& !P,&3B& n, |/+@h&AL/+-3' 62 |/+#@'R-Q' !%2#&nR-Z' 0'20/+#' Bf' Rf/+-Z& {0'20/+#& /f' Rf/+-q' ! '2 /+#' Y' RY/+-'|'2|/+#' k' R/+-3('' 62 |/+#@&l'R- <'Sb /+#'c- <'b /+#&qc- G' !%b /+#&nc- 'b /+#X&^c/+-3 ' 6b |/+#@'c3' 68 |/+@'XQ' !,8&sX<'Zq /+1'r<'q /+1&vrG' !,q /+1&sr'q /+1X&cr/+3 ' Mq |/+@1'rmF'<&e\3m' < |/+'\ /+mQ' !<&b\m!'<X&R\/+ I9@6*FlW:GW>H8.'% IE%# +32654&#"72632;26767632#"&+"#"547>54&'&54323'' "%J! /b&   ;0WM!(&&!C)9!"!C  )! +V) !"#  c|K-PX@'l   `  H@+l   `  G>HY@ca][UTSRIHBA@?64( +%"&""547276765#"&""5476765#"&546;54'&54767372354'&5476737232+y (,",(! (,",(!<  2.[.[= +>    9     ?  ">( ?  ">( #w+XKPX@l:G=GXCH@nn=GXCHY@$"++ +2#327654&'&54>32#"&54>A =A)#A&K2-  =cykQv-DOFw  1RO3kL7+OIi  vO^[K[D ((@%54'.54632#"&54>PdeAA&2$*' c)cGUi4KYF2#@>)R#  ^G?sU]_BoHS9@6O F`_[:H#+)$%$ +%#"'&'#"&54632&'&'&543232632327654&'&432326323267&#"8$ !7#&9R5$!6! O6 !]   !.B ! &$%i  >50$0@ lR  3 $  & (z)'"JV@  KH? FK-PX@& l  `=G X ?H@-l l  `=G X ?HY@TRNLEC85421.JJ +"&546327654'&'&54;226;2?654'&54;2326;2#"'&'7&#"32676.4B5%$*t!"$OC+" & %%##  -'.8i %)  %  .  &68 !^&#|' /+#|' /+#' & p#' & p#' "& p#' "& p#'Z' /+/+#'Z' /+/+&h&f& m#& #& m#& #& "m#& #& "m#& #'& 3/+'& 3/+-0|&r /+-0|&r /++0' & ++0' & ++0' "& ++0' "& +o&bq&d& i#& #& i#& #& "i#& #& "i#& #|' /+|' /+' & f' & f' "& f' "& f'P' /+/+'P' /+/+d&bf&d& i#& #& i#& #& "i#& #& "i#& #'& 3/+'& )/+6|&6 /+6|&6 /+& l& & l& & "l& & "l& '& :/+/+'& 0/+/+&b&d& i#& #& i#& #& "i#& #& "i#& # '& 3/+'& )/+#m|'! /+#m|'! /+#m' & D!#m' & D!#m' "& D!#m' "& D!&%&'k& i#& #k& i#& #k& "i#& #k& "i#& #|'' /+|'' /+' & N'' & N'' "& N'' "& N''8' '/+/+'8' '/+/+A&i& i#& #& "i#& #'& )/+#|'+ /+#|'+ /+#' ' +#' ' +#' "' +#' "' +#'' +/+/+#'' +/+/+& & & i#& # z& i#& # z& "i#& # z& "i#& # z'& 3 ~/+'& ) t/+#' /+#' /+-0& a/+-0' /+' /+' /+3& %/+A& S/+#m& z!/+#m' !/+' '/+' '/+#' +/+#' +/+#&|''/+/+#&|''/+/+#&' & p'#&' & p'#&' "& p'#&' "& p'#&'Z' '/+/+/+#&'Z' '/+/+/+U&h' '33/+U&f' '33/+U& m#& #' '3U& m#& #' '3U& "m#& #' '3U& "m#& #' '3U'& 3' '3/+3/+U'& 3' '3/+3/+|'&/+/+|'&/+/+' & f&' & f&' "& f&' "& f&'P' &/+/+/+'P' &/+/+/+Ud&' '3b3/+Uf&' '3d3/+U& i#& #' '03U& i#& #' '03U& "i#& #' '03U& "i#& #' '03U'& 3' '43/+3/+U'& )' '*3/+3/+#&|''+/+/+#&|''+/+/+#&' ' '+#&' ' '+#&' "' '+#&' "' '+#&'' '+/+/+/+#&'' '+/+/+/+U&' 'U3 3/+U&' 'W3 3/+U& i#& #' '3 zU& i#& #' '3 zU& "i#& #' '3 zU& "i#& #' '3 zU'& 3' '3 ~/+3/+U'& )' '3 t/+3/+#Y&I  /+#+&>  /+#&' '/+/+#&'/+#&' '/+/+#<&Z/+#&<&Z'/+/+4' '& m##/+& m##/+U' '3(#A& #*6& #3' & #' &/+/+&/+' &/+/+<&P/+<&P&/+/+\& #O#/+\& #O#/+Q& #O#/+Q& #O#/+%U' 'V3' &  #' "&  #*'& e #Y&  /++&  /+ & &&  &/+ /+ & N&&  &/+ /+<&/+'& /+ /+B4& B && #O#/+& #O#/+' &  #' "&  #*'& [ #Y&' ' /++& ' /+& {&& = '&/+ /+' && = '&/+ /+<|'# /+<|'# /+<&8'/+'9&= '/+ /+4' ',& #T#/+,& #T#/+w&dC& V/&  #C' /&  #&  ##&' '+/+/+#&'+/+#&' '+/+/+#<'+/+#&<''+/+/+& ##/+& ##/+& # #/+& # #/+'U' 'S3 &  #& # @ Fne  +7#"567672' @u54 @ Fne  +7#"567672' @u54  @SWK  +7!2#!"&4>$ 9    2 @SWK    +7!2#!"&546J k  2 @SWK    +7!2#!"&546J-   2 @SWK    +7!2#!"&546JG   d1'__(>KPX@\<H@nSXLY@ 4% +#"&546732!$/a-'97*E` 50 (@K!PX@oW<H@oSWKY@ 4% +.54632#"547>54&o!$/a-'9Z7*E` 50 (mu$@!oSWK4% +7.54632#"547>54&o!$/a-'97*E` 50 (|-RKPX@\<H@nSXLY@--%"4% +#"&546732#"&5467325!$/a-'9!$/a-'97*E` 50 7*E` 50 (|-SK!PX@oW<H@oSWKY@--%"4% +.54632#"547>54&7.54632#"547>54&o!$/a-'9!$/a-'9Z7*E` 50 7*E` 50 (m|u-3@0oSWK--%"4% +7.54632#"547>54&7.54632#"547>54&o!$/a-'9!$/a-'97*E` 50 7*E` 50 #{AqKPX@"_W =GW :H@& S __ WKY@;986310."  AA +232632#"&#"#"54.54654&#"#"&46323254&546 N$OML{b # ,+Jd1/hH)+ !^!(vqK PX@4c  `   ___ : HKPX@3o  `   ___ : H@; no  `   _S_WKYY@fdca^\[YTRLJIGCA@>!#!%&!$!% +%32632#"&#"#"54654#"#"5463232654&546=4&54654&#"#"&546323254&5463232632#"&#" L  L # K#LM  L# P P, !> M # -.5.- !HK#PX@ W=H@SWKYY+* +7#"'&'.54767632[= di P <$F] a0WM 'CdlHFKPX@ =G>HK#PX@ W=H@SWKYY+' +%.'&5432#"54767>4&$<P id =[C' MW0a ]Fd'dY-5M@ !FKPX@WBGWCH@_WCHY@ 32/.+( +7>54'#"&'.547&'.546767322"&4%:-D,7#   "M2##2#6$ 'TS#+7 ; #2##28<n81 1/+#@oBH&" +632#"&54  J  /Idr'""d'#"d&'"/3K PX@5djbbbW:GX?HKPX@6djjbbW:GX?HKPX@7djjjbW:GX?H@8djjjjW:GX?HYYY@ $'C!%$$!! +4#"#"&54632#"&54&#"#"&543632#"326@" !)4$1@ C 0?Ei@eT ," &#.R' %ElAMt6#/"3 x x/+(2'0'0'00 0@-_SWK      +2#"&546"32>549DNA;DQ5J"dBJpjEFk 162-(1%@"&F[W:H1/,+%#: ++"&547>=4'&547>732&462#"h  r  A @  j&  8%#*6Q@N1&Fnno S WK,+0/+6,5%  *' +"#"=4&#'"#"57>7676732;272#"&'2=4"3$ [\ .X,0L \ r2 +#(o1?4,$@!_SWK-"# +#"543254.'&56767632"G25n: >6 9 .#7G' \ 9     (bFK&PX@nl[W:H@%nl_SWKY@ +#%"" +4&#"#"547>32#"&54767232  +PF:;;D;^-1+:(   N1W>5ZA7 1L/+1&@#lmSWK'4"4 +>.+"#"5476;2#"547   0  7CG@D8&Fljj_SWK('%% +32654'&#"7#"&54>36'"&'&'&54632'654&"z >67 L-+B - B)&;$  * S/$,)#+9.'  % ''!  8!( /9@6&$Fo_SWK+) // +2#"547>7>54&#"327>76#"&5460DNZ G*#  #3KF4TG4:4 &1'"  , ,K W : /+ 7Wd @SWK   +2#!"543N d   f L /+8_ 7 /+8^ 8 /+H<*@'7FS_WK'.:)6 ++"&5476=4&#"+"&5476=4'&476732632 k "  j . 63"/Dfdu&   (&"L 0@-_SWK      +72#"&546"32>549DNA;DQ5J"dBJpjEFk 162-U$@nSXLz! +7632#"&"#"5436=4'&547>t   %' 46 $*  1#  W@6@3%Fl_SWK-Q&Q% +7&546323632326762#"'&#""54?>54&#"* G.&5   -*   )  3!H3'"H A6& .& 8$ ("$#/M7FK/PX@,ljd_\CH@-ljl_\CHY@31,*'&$" 77 +"5463232>54&#".7>7>54&#"546332qB ! '   $ !+H X;)^!&   3E&'8GM")4L@I0FnnoSWK+*/.*4+3%  )) +"&#"#"=4#"#"5767676732;272'2=4"3% [e . u'6HL \){2 uJ )o+E4H,$@!_SWK-"# +#"543254.'&56767632"G25n: >6 9 .#/G' \ 9     J(~FK PX@n[W;GCHKPX@n[WCGCH@nl[WCHYY@ +#%"" +4&#"#"547>32#"&54767232  +PF:;;D;^-1+:N(   N1W>5ZA7 1L/+1B&@#lmSWK'4!4 +7>.+"#"5476;2#"547 $ _1 6  "#J 6B6@37%#Fl_[CH*'%% +32654'&#"7#"&54>36'&'&'&54632'654&"} >57 L-+B - B)&;$  * /$,)#+9.'  % ''! 8!( >/^&$FK!PX@o_WCH@o_SWKY@+) // +72#"547>7>54&#"327>76#"&5460DNZ G*#  #3KF4TG4:4 &1&"  , ,K kWp p/+ W @WCH    +7!2#!"&540     fP p/+m p/+n p/+OO0<6@3Fl_SWK)$,"" +".#"#"&546?>=4&#"&767>23276'3276=4  $'O #- <.& A)     |'- MN +i'FKPX@"l_[WCH@(l__SWKY@ #"$54$3 +7;27654#"46;2#"27632#"&K%%KM:0 &^ -"!?.GWBF$" 4 3EKK 0@-_SWK      +72#"&546"32654&1KH@3HP, *  )KH08PC58P!3&*=3')=pg p/+ MN %d!FK&PX@__[>H@(l__SWKY@ #"#4$#1 +4+"3267#"&54637254&'"#"&7632K)H@)nno W =G >HY@vtsrfdZYXWVUKI#')$! +#"&=7#"5476?54&#""&""547>754'&547672632763267>32"&""547>=4&#""&+   $(   <8B"=#$* ! %(   A > Z4-  @  ., ;B hI1    4 &  *`sK(PX@9  l W:G W=G>G W;GW CHK-PX@6  l [ W:G W=G>G W;H@:  l [:G W:G W=G>G W;HYY@pngdVTPNJH?=0.-)`` +"'.'&'&'&"&#"#"547>54&'&5423263232654&'&54632#"&'.#"327654.#"Z0,#!$+C!:4N!'"$!:2Dms0Vu"'"&aFD8'% U(Y =+- 8(&;502  J   !$0. VRB- |%"&E9-E9'*$597M'+N+,a#DUd@$"!9 Z FK PX@F  l `  [G W CHK PX@I  l  l `  [G W CHK-PX@I  l  l `  [3232+326##"546=#"&54632"326=4&!2#!"&546R 8Q  ?4A D-Rg|e5h%(!2-)6D4      # 9%WA3 +|P["F/5M$4%.N:   l_P@  ' ;FKPX@Cl S  _W BG W=G  W =GWCHK#PX@>l  S S  _W BG W=GWCHK-PX@<l S  _ S  _W BGWCH@=  l S  _ _  _W BGWCHYYY@!][WUPNJHFD75.,*(%#__ +2'.'&'.#"%2#%2#32767>32#"&'"&546374&547"&54637>F$ ; ' R<[~`  C  \:B.   +}uE  6"    67 ,# a  b%0Crv-RY@H SYB:FK&PX@.llm_327632#"& ! .W -We  3N n83#"&'&#"#"&546767>546Xe +2::?," \=.A1(  <$quR%0{B<!  9T" 2 HoB!+%",+"54767532327632#"&=7654#"-#(: Q0?.0vs.   X=(xNRC 'BZwotdaU1+ '|1M[XPI,+763232#"'.'#"&?&'&'&'&"&#"#"547>54&'&54232632'4&#"326P!L V#2)5^,/  :44$+C!:4N!'"$!:2B Z9N&CSE y(_ l  6;I@U J   !$0. l\FPap XMUb_YF,+7"&#"#"47>54&'&542326327654&5463232632#"'#"&?&'&'.#"5326'4&#"(5D#(8 Q3  x) 7D ,BT;z  ! ' >JL2O" q)8 &*  >0 / ! *,  ъ.3,2  0'/+/+ &/+/+ <~U< ,+7654&54632?654'&5423262#"./#"&54?'.'&5423262S$"2 r&^(")(B    !O%(36()F % G@V"")   =% <".' 6 &*W%   ' ']W,+6/&+"#"575>7632323263232>54&'&'&3232632632#"'&+"#"&546 '*3   317  @Eu[Ai4L3 613   T0 Na{b9 8"  /`a]FK&/  "8 +(Z{W.Lu6B?93,+&#"&#"#"".54>73>=4'&547>2'4632#"&   ,-    "&L ($'&a   3 1 &'%'4W H H/+ &';! /+B,',A,',',@,'9N, /+9',9',',9M', ',',9';[,;',;0',',;?/.l&'a0hL/+h'LL/+h'L'LL/+/+h'YL/+Yh'LY/+rh'L'LY/+Wh'Lu'L'LY/+/+h'[L/+ [ bh'L[/+ Gh'Le'L[/+O#tF#GP2p!,+%#"'&'&54767632!2#!!  nQ Qn  C  +@{ r**r KG B'K",+&'##"&5#"54767>32#"PB GK r**r @f  C  nQ  Qn  1p!,+&5432#"54767!"&574563!&  nQ Qn  C  @ r**r KG B'M /+2p1,+#"'&'&54767632!&'&5432#"54767@  nQ Qn  Cd@  nQ Qn  C BP r**r KGBP r**r KG'M3& ,+67632#"'&'&5432#"54767>32#"'&'GK r**r PBGK r**r PB#C  nQ  Qn  @(C  nQ  Qn  @/g3!,+#"'#"&=4'&5432;2 !  N) M]BnO`K )N  ".l.!,+"&547&'&546;27632#"'&'YO`K )N  " O!  N) M]+g3!,+463267632#"'&+"&54767+ O!  N) M]`K )N  "A0p2!,+2+"#"5476=4632`K )N  "A2 !  N) M]B2p9,+%#"'&'&547676323>7632!2#!#"'.'#!  nQ Qn  CW.N1  C  @  1N.V@{ r**r KGE3 KG BP 3EB'K:2,+"'&'#"'&'##"&5#"547>75#"54767>32PBE3 PB GK 3EGK r**r @V.N1  @.  C  1N.WC  nQ  Qn  2pH H/+'K /+2p!,+%#"'&'&54767632!2#!!  nQ Qn  C  +@{ r**r KG B2p3#,+!2#!#"'&'&54767632!2#    _  nQ Qn    S   4 r**r 4 'K2 ,+6762327653254'&'&#"3276732765   "* r**r *"  j  c  nQ Qn    2pH H/+'K /+2p9(,+!2#!!2#!#"'&'&54767632!2#  +  t  nQ Qn    v& ' ' r**r  'K<,+#"1"&5#"54767>32#"'&'#"1"&5&'##"&5  r**r      `   nQ  Qn     |f  2pH H/+'K /+!h< /+  % /+2&,+7"&4>3!2#@     2&c*91+&,+%4&+"&546;2=4632;2+"#"&52#!"&5463 "  $     1    D  |{?-y# !A ,& ,+%32654&#"654'.#"3267>32#"&'&#"&54632 (=/DV8,:d '=0GV8-'%.54;3"1"&54672#!"&5463  S  C(!    X #70",+7+&#%&5467%2172 +&#%&5467%2172g| S)  ,| S)      %     % #71$,+%>'%&'&6323""&546?>'%&'&6323""&5467  )S T  )S  %     %    M1^&\ Ű/+5|S&H! /+-y-?'y'yy0[A(*,:*-(*f' \'; (*' '; (*' '; (*p' f'; (*' '; (*'  '; (*' '; (* ' '; (*'  '; (*v' l'\'; (*' }'\'; (*' '\'; (*' '\'; (*' '\'; (*' '\'; (*8' .'\'; (*2' ('\'; (**'  '\'; (*8' .'\'; (*' ''; '!c'$B'tK'+4C!'w)|'?v'=nM')F|''1'!'B'!''!B?''!K'L'!CB''!''!?''!M''!F''!s''(*' 'D; (*:' 0'E; (*' 'F; (*S' I'G; (*' 'H; (*x' ' n (' 'J; (*2' ('K; (*3' )'L; /+(' 'M; /+(*%' 'N; (*1' ''O; (*5' +'P; (*2' ('Q; (**'  'R; (>' 4'S; (C' 9'T; (*' 'U; (*y' o'V; (*' 'W; (*[' Q'X; (*' 'Y; (*' 'Z; (*' '[; (' '\; (*' ']; -  ,+2"&46"264m\@@\@>,,>,@\@@\,>,,> |yW,+%32654&#43232654&#"#"&'#".54632#"&"32>327674&546322632#"&#"632&#"& -C#:   /$8 **6oCS$"!  <(8,/D('6  +2W=  +"*)_  9 %*$"21)G4,=IBQ-I!"$)::)4'# '  ;Y! -(9-  T-9-!`-+AJ#Ah RFB8-#,+4&#>7>'4#"32>5624&5>27654#""2654#"'46=&'&#"326;232654.7>767>54&54?4##"&#"#"&'&#"54654.'.'&6?>7>767&/.'&'&'4654&546;652676237.#&#""32>7>7>7632626236#"'"&#"#"'. 5&547>74.'.'&=>=4&54767632  ,  j      <.              $3  (^   P  '       #$  (      f    !     .  # B.[9 +   -  -  )       .   .    #    %! S FP, #    B      )!G=K1  -!`+v .H@ C6,& ,+2"&4$"3265432654&#"654'&#"327632#"&'&#"&54632ښmn00$+5'9J01$,5'54.'&'&5?67>32632632632322667>765#&'&.'67>76367>7>76&'"#326;23254.7>767>54&54574##"&#"#"&'&#"54654.'325&74&#>7>'4#"32>5624&5>27654#"2676237.#&#""* ( ( , (  (     !  6  k#        <.           -  j !3  (]   P    G%q   B # &        '  1      7     "    .  #    ;A Od+ ,+.'&'./.54762636237.'&#""&#"326;23254.7>767>54'4?46?>'&67>&7>7464&'&'&76&7>56&5>74>&'&'&756&76/&7>/'.546?6&=46=&'&#"#"&'.'&%>#"'"&#"#"'. 5&547>74.'.#".76&54&76323746754&547676322?2>76267>76M $-4  (^   P     <-          N   "$  (   "B  %$ !       % $      X   %     '  1  9/  6  B)      % $. (6  $J)    9 '   -    l#PW   B      q!& 0E: M/  P0Gn$   ") G(A 0y5,+26236#"'"&#"#"'.5'4>7>74'.'&=4654&'&5476323767>767632>322676237.#&#""4#"32>5>4&#>7>4#"54&/./.'&'&326;23254.7>767>54&54?4##"&#"#"&'&#"54654.'&'&76?>7>7>7>54&#"'.'&547>76?>76d     #$  (        #3  (]   P[ ,    '       <-          #     B       )!8!_0+d 6$E8/ `   M  r           )  4   ; %)! +       '  1  $ .    0" ! ; <M(4.) ,+2#"'.54>7>54'"#"&5462#"&546tLX54M  (X !%; *, ,.Xo*F*, (    $ Y 0- +- +N ,+462#".'.2#"&546V"D   B ,. *,0%68!)^4)`e- +- +*  _,+54&#"'"&547>&76322763232654&54632#"&#7>3232764&54632#".5463226767.54654&#"A29-T  -9(- !Y;  ' #'4)::)$"!I-QBI=,4G)1#C-?$*% 9 _)*"+  =W2+ 6'(D/,8(<  !"$SCo6** 8$/   *t@ t/+(*,+#"'.'&54767632.8E aL ;/2V   wo:*,+&5432#"547>76'&C.8E aL ;/2V   wo(*',,:*'--F<' 'JJJ/+J/+2ul' X 2l' ' X 2^P,,+!2#!!2#!#"'.'&547>7632!2#!!2#!  N    '-L$ $L-'    l   +  "   +0??0+   2^3H H/+?& / & O?&/a GK-PX@/ ` _:GW:G >G  ; H@6l ` _:GW:G >G  ; HY@!@>=;:931-+)'$" GG +"&546;54&'&54232632#"&54633254&#"32+"&#"#"547>5 _$!:2N qvn yZM@  C!:4N!'"  50. `Pb XT*w K   !$M$8?MzK-PX@-ll\W:GWCH@1ll\:GW:GWCHY@LJDB#+!I#$" +732654632#"&54&'&5423263232#"'.'&'&'&74&#"326$&$-<oR:D$!:2B v-#O,2)5^,,#!$+9N&CS*xU, )=BeS0. l< D3_( 6502  FPap XUr@oQI 3.&F nljjo W =G XCHMKHFA?64*(%#!UU%# +73276?6#"77>7276".#"#"'#"54?&54?&#"#"547>327632(   &?:h 72!7$ #+Im&9 (T$ # I 1 h   * - M<      "#- ("M#r8j@&FK#PX@!noW=GXCH@no_XCHY@ "$')#'$! +?#"3276#"'#"54?&=4&#"&547>32;7632kC '2 9( #4 1 m" % 4 ] ,& ,& %3_`K-PX@  `[ :G>H@#  `[ :G>G;HY@YRKHm!!(7!%%! +%2#"5654&#"#"5476=4#!"#"&#"#"547>54&'&54232623!2=4'&54323262d"(F!D,#!C>!$#!:8::!DsB!C.:!"]07+%<*  < -  %%   ; :   !uXK-PX@29TN F@29TN FYK-PX@"   [H@&   [G>HY@RPECB@<:10 XX +%"#"5476=4&#"#"&"#"547>54'&5476?263232632#"=654&+';"7 %&"+ -[UB1A+   $6     @  ">/ ?N: ' $ $3doK-PX@  ` [:G >H@$ ` [:G >G;HY@_]XVJHGD;91* dd +%"#"47654/&#""&#"#"547>54&'&5432326232?654'&54;273232#"5654& @=!:4J!&&!?3:!# 6p+!^:`` W' ;K   !%"   !  1Qj .x7+%;,up@7^ic FK#PX@#   [H@#   [HY@omge[YXVHFEB/.-,pp +!"54654/&#"&"#"547>54&'&5476737276767654'&54;263232632#"=654&#",~#!") XZ 1H )i $])       -/    #! !  =% O"   \ +e'1! $ $4DDN@K)FloBGW:GX>H<:51'! DA +7"+'477654'&#"#"5476763232723272#"5654&#"SM:{HJM4  A4]xo = 0A?"(&uN,!" E*Q7+%<+uoK@+@FK-PX@4ljo=GW=GW >G;H@2ljo_=GW >G;HY@DB7530)"  KJ +7"#"&547676+"#"&7654623263272;2>32#"54654&#w: %Jpu    $_[ $  2j   (2    ' $$):fKPX@%WBG:G>G;GWCH@(lWBG>G;GWCHY@ "$&!!('# +%4&#"326#"&#"#"54&#"&5463232676 `CEf.4X81lP'(! 0 3  @a%S74 (m+A]M:k[6g"! .9  !LaK PX@5lj   l:G>G;G W ? HK-PX@5lj   l:G>GCG W ? H@=lj   l:G:G>G;GCG W ? HYY@^\YWSQEBA?:83.#! +4#"#"'&&"&""5476754&54'.'&543232327>;6;2#"&546723265  8{  B:1 .:!3 )  $[ 'V7:b%-#(>0   E3  !4o  .  Ec4 0"sMKK!PX@%l:GW=G>GCHK#PX@%lo:GW=G>HK-PX@&ljm:GW=H@$ljm`:HYYY@B@:90.-(!KK%4 +%7654+"32232632;27654'&43232632##"'&.'&54jZO fJ !=& (:!?R!<`[ Jh.$!i4  # t*  ;  -7' 79@6:GWBGW:G;GWCH!"$%!!(&# +32654.#"'4&'&5432326327632#".#"#"547>5`Cet5Y8)rP'(! 0 0 TU%E)`!' +Aw;o]8] "! -  N "*KPX@$dl_=GCHK-PX@%ll_=GCH@+llj_=GCHYY@ $!$" +>32#"&#"#"'&'&54226227~ /4  % z($"&(J",-d-'8(   # uK PX@(  d j:G WBGCH@)  l j:G WBGCHY@}xvrp\ZYWVTKJA9+" +#"'.'&#"'.'&543232632?64/.'&5432326322767654&543232632767>32#"54654#"/ R 8:  !9@!MW N9 6!<4 )% $ !!gR@(%.4 $FF     ,   =4 -D   #X  /CH5-1*!KKPX@d_=GCHK(PX@l_=GCH@!lj_CHYY@A?><;9W&#!$" +>32#"&#"#"'&#"'&'&543632?654&'&5432326327t04  hm%ILLB /7 "K",-KY&   " '     =FKPX@'l_=GW=GCHK-PX@%l__=GCH@,ll__=GCHYY@ )!)(#& +654#""54632'&546322?654'&54322632#"' #" "O    ?*"F8H0( $ N% l%8~  (60? (  &d-'K7@4 F`:GW=G>G;H!!g'#8 +4&'&543232632;27>32#"'.*#""&#"#"547>5&!C=!* ,    j$!:4J!&&#  !' #+ |B"%  !$*N@ )"FK-PX@'l`_=G >H@/  l`_=G W >G >HY@GEDB#'#7!% +4'&54322632;267632".5&'&#"3#"&#"#"547>5R%#"*( F )   -) K)  (] 0 &   b   #'>KPX@+dW=GW=G WCH@,lW=GW=G WCHY@(((>(=75$" '' +%"&5463232654'&#"32632654&#"34&5<>7>32#R\'.    ,1SghR/e!NNSWfI (M+&nN=Y   ,\PraWhZe. 8:)NS.;<h@e'F<Eljl  _ W =GWCH0/63/;0;*(&$ .. +2+"3267632>7632#"'#"&546";27654&GWCGCHK PX@>llbjj W GWCGCH@>llbjj W HK(PX@=  l j  lj  _W=GX>H@;  l j  lj_  _X>HYY@VTMLCA43%QV2 +4&+""546746323262"&"#"5.4632;26=4+"#"&7654&5&6232>5 E.  ,!D( %("1    a G * A. T  ) 6  g 0 &   o{J9)& &66aG@)FKPX@7ljlBGW:G CGW?H@4ljl[BGW:G CHY@CA><640/'! GG +"&'54677654'&#"#"54767632327223254&54632#".#){HJM4  A4]xo =>b#%0_ICC,/ P8NPWm I,!" E*QT293HI3 %.<5LK4$K9} /+pM @oW<H"2 +4632"#p l 0 $ @FoW<H2" +.#'&4372# l 0p p8M@QWK7 ++"&53p 0i <$8@QWK2 ++"54?>=3 p0 (*'  (+'  D5#+5@2lWBGWCH)(%$ ## +2#"&##"5&'&'&546762"&4   14%50%1*4)22##2#$?3' '8 <=(p)2#2##22 @SWK    +7!2#!"&546JM  2 @SWK    +7!2#!"&546J m  ( ,+632#"5467632#"546O / 6 # / 6 #y+! +! (*,:*-(*.:*/%8VKPX@$d`\ :G;HK-PX@%l`\ :G;H@)l`\ :G>G;HYY@PI7m!!(3"$# +%#"&546323254#!"#"&#"#"547>54&'&54232623!2=4'&543232625.M.9 !B,#!C>!$#!:8::!DsB!C.:!"LB# -  %%   ; :   !MK-PX@ IF@ IFYK-PX@)lGW?H@-lG>GW?HY@ !))!&)% +7>32#"'.546323267654&54&#"#"&"#"547654'&5476?2e*2:M-* )(3(4)*)"),-[d.>9 29<7  #13:+20    @  ">/8& 7m@1:)ed  FK(PX@?n l  l  _ W=GXCG W?H@=n l  l _  _XCG W?HY@mk`^][VT$&'D*&/) +32>76#"&=4.#.547>7632367232?2"'&5432327654&#"#"&46?67>76'##  7#'5"  H E5=Qr;/&6 )6\/49 U` !:'  - ka ]BG 9hBe  %( -v2FK PX@-ll_W:GWCHK PX@*ll_[W:HKPX@-ll_W:GWCH@0ll__SWKYYY@ $$+#"! +#"'&#"327632>2#"&54676'"&54632 '&?]t& c6(#6 gZ4N45ESt9P3 'U=v s.*>! %]A1.r9+)'%EE +"232654#"#"&54767>54#"#".54676632654'& *=4#"#"54>763233272#"&#"#"&54632  6,'!, " .M.9 ! y%$B.*W    {  3NB# C{'FKPX@'ndS_X?H@(nlS_X?HY@@;82-+$  +%2=4&3#"&546326/4&#""5476763233272#"&#" 8`)F.9 !: )5 $/", " hK I=";#L:+ <, ED 8& j& ki M9zKPX@*lj=GW=GWCH@-lljW=GWCHY@64(& 99 +72654'.546323#"&'.#"#".'./.'4632+L:DY:<  /!(2-8?eB%)5-8<.2;5 "+ #(4,;H  @ & .]K-PX5F5FYK#PX@HK-PX@H@GX>HYY@]XFDC@-,+* +74654/&#"&"#"547>54&'&5476737276767654'&54;2632#"&#",~#!") XZ 1H )i $]$.|!   -/    #! !  =% O"   \ +e" ;aK-PX@ ;3 F@ ;3 FYK-PX@H@GW>HY@ 75-,+*18 +7+"&"+"5476765&54?54&'&547673727632 )")!. 5 [1 2>       !23 ">( OfB  FKPX@9 d`=G W=G>G WCG  ? HK(PX@=  l  l`=G W=G WCG  ? HK-PX@=n  l  l` W=G WCG  ? H@An  l  l` W=G WCG ?G  ? HYYY@'QP[YPfQfGEDCB@641/-,*($" OO +"#"&54;4&'&5476?32>32#"&'"32+#"&"#"547676=72>54.#"  *Je*JZ\@ 9"+!)+/(0&.3   . /rK\ 3S D     D&I/6L! 6+ 0*5WXo@  ;FKPX@A d  _=GW=G>G WCG W ?G?HK!PX@A d  _W=GW=G WCG W ?G?HK-PX@B l  _W=GW=G WCG W ?G?HK2PX@D l  _ _W=G WCG W ?G?G?H@B l  _ _  _W=G WCG?G?HYYYY@ZYdbYoZoXVPNMKGE)!+$(! +754&'&547672432>32#"&'"#"&"#"547676=&#"#"&546323254&546322>54.#"*Je*JZ\@ 9"+!* _3  $D:)+/(0&f3   . /rK\ 3     3&#n+U&=o>Xc&I/6L! 6+ 0*5#6 YKPX@Hl  d j   _=G=GW=GWCG ?HK-PX@Il  l j   _=GW=GWCGW ?H@Ml  l j   _=GW=GWCGW?G ?HYY@)WUQOMKIGDB?=76310.-,)(!   +"27654'.726763232+3"&#"#"54727676=#"#"&54;54#"#"&54632:RcpEh  ZN(4+! 'XSun=~_RZ[nO-> Q"e D    D/o"gYj #Zh@ J: FKPX@C  l  l=G W =GW=G W CG ?G?HK-PX@D  l  l S=G W =G W CG ?GW?H@E  l  l _=G W =G W CGW ?G?HYY@\[a`[h\hXVRPNLCA!!%#& +67654#"'2676326323"&#"#"54727676=#"&54676754#"#"&54632"27654'.|:1`  :M,?(4+!S 2D?'XSun=:RcpE gG% 5A3,     g=! $02@"gYj _RZ[nO-> W4>@;ljjjmSWK"*%#"' +767>54&#"#"546322#"54>7>54&#"#"548' % L+'= '$/C  ,-*"0$* 32%*7;,I  =-&: %AHK-PX@`:G;H@`:G>G;HY@ 7!w7f +4&'&54232623!2=4'&54323262"&#""5476=4#!#{#!:8::!D#B!C.:!"$!:8::!DU'%   ; :   !<'   <vD@ 1%FK PX@.lbj_3232654632#"&5r L8H5* .[##  1"#/ P>9=3"/ F.'(3?  ">(  jwa %-0eS*^K PX@&  d` W :G ;HK-PX@'  l` W :G ;H@+  l` W :G>G ;HYY@[YRQIGFDCA96/-,+*) ^^ +26323!2=4'&54323262"&"#"5476=4#!"#"&#"#"547>5'"#"&56 @ !DsB!C.:!"$!:8&<!D,#!C>!$02" "  ; :   !<'   < -  %>" -vQFK PX@2dl_ W :G=G>G;H@3ll_ W :G=G>G;HY@OI!!b'W4! +327676;2#"&#"'."32763263226323254'.5467654#"#'"  + S ,    " !*$!:4J!&$!%e"  $ ' ",'|B"%  !$0.  ;9@6F_:GW:G>G;HA&$$*!& +%#"&#""547>54'&#"32?2#".546322632%!N4:!&*'>SI9  :6Q*pE(=!' d&  ,$$Y@Gx  '=>cp "aeqK-PX@"  lj:G ;H@.  lj:G:G:G ;G C HY@_\[XSQLG#)!* +74.'.'&543232623276327654.542262#"&#".'&#"+"+"547> $&!C9:!   8{  B:1 .:!3 )  $P NS)!   $b0   È  !4 f .  B)@W;HQ- +4&'&543232632#"&#"#"547>5&!C=!' '(!CL!(&#  ""!  !"q@  F;'EKPX@/   ljBG:G:G ;G CHK-PX@1  l   jjBG:G ;G CH@5  l   j  jBG:G >G;G CHYY@pnge`_VQPO#&#'| +%2>7>7654#""&#"#"'&#""#"'&#""2632324'.5476232>7632b  4#! R*B !Cy       * "R?!"o 802         *#!   L;&0+0+kwql_S,+%4#"32?6#".'&#"#"&#"".#"&54323254&'&'&#"&4>54'&#"#"&5432326323254&546323254&'&54654#"#"=4>4.546323254&#3262#"&546323262"32>7632&#"#"&#"3254&54#"."3254&54654&54632#"32654&5463232654&"#"&54632#"&546%"32654&Z  ' >  $%    3#  *'3   !  1   ! 6   #"  "(N5"6 !   #      *"   _(- !!- R2K1\$ "4Rh+A .     A 08/;'+9*2 $.  $  &# :     )  ^'  #)#"   $    U   !! ' $ *3!. 4 13Z  Kp(#(%@A!,# q iD ,+%767654&#"'"27654'.%22#"54>7>54&#"3"&#"#"54727676=4#"#"&546322676326 C,!<:RcpE(;b/C  ,-*!=(4+!'XSun=  6 '(>%.k_RZ[nO->-$^8;,I  =-&:$    "gYj  #4Z@ X8 4 FKPX@( d W HKPX@) l W HK-PX@' l  _ W H@+ l  _ W G>HYYY@RPJHFD><!(I!% +%#"&"#"5476=4'&#"#"&"#"54765"'".7>74>32#"'&#"327>76++"++03+ ++"++ 2NM%5M)>5KA4: $ D    ?        U~@"@`_7 \> T@K A?FK#PX@ W HK-PX@ _ W H@" _ W G>HYY@HF98!(7!'4" +54#";2#"&"#"547654+"#"&"#"54765"'.54767>327>^?4J F+"+,  ++"++&."4C;  da^7         EmB,>(eK-PX@w uTF@w uTFYKPX@9dWHKPX@:lWHK-PX@8l _WH@<l _WG >HYYY@1~|rqpoigfdcaYXWUNLKJIG?;20/.-+  +"3274?<'&327>76#"&"#"5476=4'&#"#"&"#"54765&#"#"&#"#"54765"'".7674>327>32#"'&#"$'4-4"J A4< $ ++"++/3+ ++"++C2 +,++,%5C30+Z'])G5Ep B/-bF..  c4    ?            >b6$ "" =e K-PX@$"vtTF@$"vtTFYK#PX@2WHK-PX@0 _WH@9S _WG >HYY@/ }{qponhfedcaWUNLKJIG?<53210.  4" +54#";2%"327476'&7276#"&"#"547654+"#"&"#"54765&#"#"&"#"54765"'".7674>327>Y?4J "(4-4"" ++"++  ++"++C2  ++"++&%4C30+_da^7 @/5bF.R ?'              >b7# ""LT@ G8FK#PX@) WG W C HK-PX@' _ WG W C H@+ _ WG>G W C HYY@RPDB<:%14)!% +7#"&"#"54765"'".767>32;2+"3276#"&=4.#.767654.#"+)")+(+DG#A?vg +,I#+@ %2@D     R|B QE0 . "8) r"+a`#jq@6eV FK#PX@El  j WBGW=G W=G W CGW CH@Cl  j _ WBGW=G W CGW CHY@pnb`ZXPNIFEB=;#%'#$" +32#"&'&#"#"&'&'4323254. 547.54632;2+"3276#"&=4.#.7>7654&#"7 5)UYG  6F . \qW4gvg +,I#+@ E2>]"4-$ ."0./Ex & +D    ^=C^F9O-0 . "8)G5QNdY9   <    <  b  Q 3   ? <,  <"   <r # :   !  ( A Ad,+"54767>332547632326217>767>#"'"&#"#"'.5'4>7>74'&7.'&'.76&7>?>45.'&#&#&326;23254.7>767>54'4?46?>'&7>&7>7464&'&'&'&76&76476&7674>&'&'&756&76/&7>/'.5'./.>7>3>#"&'.'&2676237.#&#""'.'.'./.5476L3 ! $,#     #$  (  4"    )   %   <-      *  "    (   0$3  (]   P   %  )Lw2  ")C PW   B       !#( * 4 # %   ; 2#    '  1   = / B  A(     % $- (6  $:) ,   - C         suY#A'~c,++.#"+.#&#"#"&#.'#"#"'.'&5474654&547>763226767>7>7>7632;2>5654'4./"%36332654.'.#676&'#.#"264.'.+4674.'&'.'&7.''465&>5.'.#"'#"32>32632'&54654&547&'&>767>?674#&5467>    B "         E9  .   ,  >  ,&$   !  " OD       '  1    D" =    !* ( ( + 1u " 0=# /4  (^   PC     <     C 3 ?!  -! , !<-   $'    <KS[ @ XTPLIA2,+"&#"#"547654'&+"#"&#"#"5476767>4367>2;254/&#"62"&4$2"&4 fJ !=& (!!?R!<`[ Jh.$!ZO&&&&  # t  ;  7' #&&&&- "* @ '#,+"32654&4>32#"&2"&4$2"&4wjlnt@Ml,SOX&&&&qo]bD}b:&&&&5=E B>:6,+#"&54'&54323263232654'&'&43232632&2"&4&2"&4 o.!?6 !r`dc'!.6 !/&&e&&# tv3<  )tty=b   a&&&&(7,+27>32#"./&54 Y X bb6* * N N (( ,+"54?62#"&'&b b X Y SS * * , ,+&"54?62#"' 6%VV CB   ,+7632"/&54326VV6  BC F,+"54767632 #* , -U:=   &@F,+"'&'&54632 U- , *# @&   =:O ,+&54632#"5476542 %)D!,+"&#"#"&5463232632 d * A ^ %?  3 64 ,+27632"&5432'(~( NvN //"FF", ,+2"&462"&4"********1R,+"54767632"54767632 #* , -Ux #* , -U:=   &@ :=   &@1 ,+!2+"&546    9,+4632+".'.9"  "4 ,+&"#"5462#"(~( NvN //"FF"L  ,+3264&#"72#"&546+1!26%"17(4%"+&!*s%,+2"&4&,!!,!%!,!!,z. ,+"#"&"#"54765"'".7>74>327>327>#"&"#"547654.#"#"&"#"54765"'".7>7476'&"(++"++ %4C30+_'"  ++"+* 4J++"++! "p @/m#    "  >b7# "">(#    "!a^m#    "  bF.#P/,+%#"&"#"5476=4'&47>7632"#"&"#"54765"'".7674>327>32#"'&##"&"#"54765"'".767476'&*+"+,/ a"'++"++!%5C30+Z'^)F4K,+"+*#"E    ?  g3] @/k!      >b6$ "" <`^k!      bF.0RO6 ,+7#"&"#"54765"'".7>74>32#"'&#"#"&"#"5476=4'&47>76++"++ 2NM%5M)>5K++"++/ E      U~@"@a^j    ?   h2^P,+#"&"#"54765"'".7>7476'&#"#"&"#"54765"'".7>74>327632#".#"++"++  "D"(++"++ %4C30+=R&$" )hj      bF. @.j      >b7# D )J ,+7#"&"#"54765"'.54767>327>#"&"#"547654.#"++"++&."4C;  ++"++ 4JE     EmB,>(    !a^6,+%64&#"#"&#"#"547>5654'&'&+"#"547>763232767632632#"&"#"5476=4&#"#"&"#"547>e2t$O!CL!''7/3   7632#"&#"#"547654&C :a PU c1$,@D Cg$v7$,+#"&54632327>7632#"&"#"&54?654&#"R  }KHS'"jU!7<6,!  d:r7,(L ebG%])mU / vz1J1-v41$,+343232654&#"&767>54&#""&546322#"&- '&?]>6& 16(#6 gZ4Ni?Yt93 'U=?_ $/*>! %]A1Y=]@l IC%,+7;2=4763233272#"&#"#"&#"#"5476=4&#""&547>76;\  , " N EO ] )4    % Z3 +Y {*s:2,+%4.'&54>7676732#"5463266  '+4 Zu  ! c;27;.w8% ]  9P  ! @ a+Dd"  l.,+"&5476732327654&#"&767>32`eyxG":$:((4'3  ;5Nqq^yz( 9e1EC,%D/G  F5Tx m(",+6'#"#"547>5632332732#"&547y8    Z       # %-v0A A5& ,+32654'&#"7#"&54>764'.54632'654&#"#=2,;v ^C>yLGj1 '(%pF?`5  82%'=  0 6-8VB-IQ /,G7LiXC4*!(H(:HJ:4. .e(=2$! %u-,+2+"463267654&#"32>76#"&546IwGI3: -0YV6-5@'  -/6VxuVYP8> U>sJF).O  !J4I~&v,+2#".54>"32654.1O/)cF@^*)c384G?87@v9\m8PibNQg|{{N[&Vc'V>V]",+#"&#"3267632#"&5467.54632;2+"3276#"&=4.#.7>7654&#"324- 5A=/G uCERb;yO.mvg +,I#+@ E2>]%Mm V1Jp,( 1SzPM 8GZU*O-0 . "8)G5QN9<  ,+4?3#"543232654&#"#"&P)(Z'-  sl>  . /E "!  ,+"&54>?332>76w/C#32&' [B/=-&  $&9#  Iql2 ,+"3274?<'&%#".#";2+"#"&"#"54765&#"#"&"#"54765"'".7674>327632  '4.4 "L/lv^++"++C2  ++"+++%4C30+=S&$p @.5bF.5          >b7# D FP,+67632;2+"3276#"&=4+"3276#"&=4.#.54767632;2q  vg &,I#+@ &,I#+@1&  # -0 ."8) ."8) 6 -oK.,+32>76#"&=4.#.547>7632367232?2"'&54;2327654&#""'#&4?67>76'##  7#'5"  H E5=Qr;/&6  "6\/49 U` !:'  - ka ]BG 9hBe   %( uC+,+32#"5465.#"3232654&5<>3#"&'&#"#"&546767>546Xe +2::?," \=.A1(  <$quR%0{B<!  9T" 2 Ho-*70+% ,+&'.5467323267632#".$"32>54&q)%(SK0˛3QI#vheYfFݠjzHl1" 4Ml;F~X8 p9@HQ4~n_Iw /h&.+' ,+"547654'&'&43232632#"&"2"&4* W ,C@0 W I0MM,!!,!  2   /l . .:5,+".#";2+"#"&"#"54765"'.547674>32*1;x`+)"-+ ,+EH$n^]a5       R|B < ,+2"&47"32654&~~~EUZ@>]W~~~JYH@[Q;Gigt5' ,+74.#"4322632#"&"#"543>   >(=     E.I $D       *WBr3KiCj5)?CM-F\}&,+632#"&#"#"54767654'&'&476 0 PU 0 T|,@"   " v9' ,+#"&7>323327>7676#"&#"#"4?654&#"M  0K(FUFdW !<=5,!   h9r8+,R )1"`I0}nQ2vz5F>7v30#,+343232654#"&767>54&#"#"7>32#"&7 '&ISt& 17'%3 dA/Ri?Yr93 'T> $/*> #9G@2Y=TGk GB%,+7;2=4763233272#"&#"#"&#"#"5476=4&#""&76'676;\  , " N EO ] )4    % Z3 +Y{>s92,+%4.'&54>767>32#"54326J  '+4 +   ! c;27;.w8%$]  9P     @ a+Dd" r%- ,+"&547>76327654&#"&767>32`ey0RF%:((4'3  ;5Nqq^y1] <] 5tFB-%D/G  F5Txm'!,+6'#"#"547>563233272#"&5478    Z       # %7v0A A5& ,+32654'&#"7#"&54>764'.54632'654&#"#=2,;v ^C>yLGj1 '(%pF?`5  82%'=  0 6-8VB-IQ /,G7LiXC4*!(H(:HJ:4. .e(=2$! %#u,,+2#"543267654&#"32>76#"&546IwGI3:-0YV6-5@'  -/6VxuVYP8> U>sJF).O  !J4I~#v,+2#".54>"32654.1O/)cF@^*)c384G?87@v9\m8PibNQg|{{N[vM= ,+"&546;>322"'.#"72#'72#'3267>32#"&'#"&54637&547$  g-,2,IS      H3(= P&^s.  !bh <3/vY   >^C3# 41 m %,+4&5&'&#";27632#"&#"#"&67>76=4&#"#"&"#"&67>7674654+"#"&"#"4626765654'"'.54767>3276^2G FUB3@04  <"7 "4"5"   %?"3  &."4C; g =`_ % ??9     %5 #b    B < R7 ~ EmB, ,Aa,+4&5&'&#";2#"&"#"&67>7674654+"#"&"#"4626765654'"'.54767>32763276?4.'&4323272+&'#"#"47>54/.'&^2G E "4"5"   %?"3  &."4C;      Q,&o "{2$_$ &&4g =`_ %  B < R7 ~ EmB, ,AfO d  X ({0  )4Rex ska,+4&5&'&#";27632#"&#"&76=4654+"#"&"#"4626765654'"'.54767>32763267654&#"^2G F FYK\tk%b   %?"3  &."4C;  #:8 )UC5 g =`_ % 4vT_ 2 B < R7 ~ EmB, 2c">  #t@o .kg5,+#".+;2>7632;2+"3276#"&=4.+"#"&"#"4626765"'.54767>2/bv     vg +,I#+@c %?"3  (+DGF% %  -0 . "8)  R|B  k]5,+4'&#"#"&"#"4626765654'"'.547>74>32#"'&+327>76#"547676=654&i-3+ %?"3   2NM%5M)>3FA4: $ 5/ $E  <   R7 ~  U~@"@__ % RM'3> 2g-S$W@) ,+4'.7>76#"547676=654&%4>32#"'&++"&"+"54765"'.5476j. 5/ $2NM%5M)>4J+)")+ C   QL'3> 2g-SU~@"@`^j     SfaY<-,+7#"&"#"4626765654'"'.54767>3276632#"&#"&765&'&#"%3267654&#" %?"3  &."4C;  FYK\tk%b 2G #:8 )UC5 M R7 ~ EmB, 2' 4vT_ 2=`_[7>c">  #t@o -,+7#"&"#"4626765654'"'.54767>3276632#"&#"#"&67>76=4&#"#"&"#"&67>767&'&#" %?"3  &."4C; UB3@04  <"7 "4"5" 2GM R7 ~ EmB, ,A ??9     %5 #b    =`_[7[-,+7#"&"#"4626765654'"'.54767>32763276?4.'&4323272+&'#"#"47>54/.'&#"&"#"&67>767&'&#" %?"3  &."4C;      Q,&o "{2$_$ &&4 "4"5" 2GM R7 ~ EmB, ,AfO d  X ({0  )4R  =`_[7/$,+7"'.547674>32#".#"#"&"#"5476Z (+DG$&$" )19+)"-+D R|B  )]ai    XhL/+9-!`#AyGb,+>763232>7>76;32632#"&#"&#"#"'"&+"+.'&#"#"'.'&#"#"'.'&54654654&5432>767654'&4.'&#"%4654&547>76'&+"#"&#&543232>7>7>326762767>&'./.'.'"&#"'&767672326323;2;67654'&'&#"&+"#".'.+"#"&#"#"&#"326;267323254&3254&#"326;3254'.'.+""&+3263654&#"2654'.'.+"@   l'!k$]?M, ' , AH !  4     # "  #d/  3  w / ' %   3(. 6   . $:;' (F  ;&  #/   " % `dH.   O&   "        G      9     '4+ !7  ) = /A54&54656&32632#"&5465&"&#"#"&#"#"&54763267>7654.'.#"#"&54632#"54654"326323254&54>54#"'&6763232654&54"#"&547632654654#"#".'&#"'&47632"32654.t #   ! 6"5N "  "#   6 !     1  !   3'*  #3    %$  > '   A+hR4" $\1K2R -!! -(_    "*     i.   "#)#  '^  )     : #&  $  .$ 2*9+';/80 A     #(pK  Z31 4 .!3* $ ' !!  U    $,!A@-!`#Av.,+#"&#"#"&#"#"&+"#"'.'&6'.'54654'.6'.'&547>7>54#"#"#"'.'&547>762;>732;>7>32254&547>54'.'.#"%326;;267>767>76;276'4&'54654#"#".'.'&#"#"'.'&+"#"&+"'.#"32>;27>76326;'.#"#2367>7>7>32632"#"&#.'&'.'#""&#"767>4.254.'.+"3276764732"#"&#"232>7>4'&'32>7>76'4'#"   0d#  " #     4   GA -   ,M?2\$k!2<    ,    % %     /#  &;@G( ';9#  5 .(" 3  & ' /  u   *4   1    $   G   1: ) <& )4'     :      )   ^ +#3+ $ ( LA/     D[  !              ,                 !  y   I7,+32#"'&5462"&4^   +(   ,+54632"&754632"&(   W   g 93 g 93  < ,+?#"?"54?"54?632?6327272##"?e?A % '& )A" $ " Wc b Vd bd b X a `" Xc b[>,+32574#"#"&?4#.#&'.'432574'&5467657632#"&'&'&3>54&'$.  CC& !U=7  )    ( &"&x( { +G. 0  8 ", 77 >  2 />$).  &2>@ 83,'  ,+632#"5422#"&546"32654&2#"&546"32654&X   &&+1,(*4#&+1,(+5# z =*.D?-*C6%B6"#@=*.D?-*C6%B6"#@g q R2 ,+?654&#"32?'.'%32676#"&/+.54?'.546732767654'&74322632 $%B,93 33) +! %   "&  -Cm   3# 0?  = = &/3*$N%1 1) , (  +&U/   $"; 9 <( Y,+4654&54632#"* ( 'E ,+2#"'.54676 %79# &OI)  #HL!$GF&,+7"&547>54&'&5432Q& $:7%*HH$!KI"' ,+&54&66''&J@>5 1 17 :<"  ) );&]$# ,+7;2+"#"=4+"&54;2=4632x l" wo  s x  a  uF ,+7&54632#"547654&-9< - :*: 1 f ,+7"547>32 B* uf()(vF,+62"&4>""F"" ,+632#"& _ O  ,+2#"&546"32>549DNA;DQ5J"OdBJpjEFk 162-8V$ ,+632#"&"#"5463>=4&'&5476 # %'  ?R*   Q.,+7#"54632;27632#"&#"#"&4?654&"*D1,/]&I"$ GG 'o2!@5(*s2 . #dB ".Q9+,+"&5463232654&#"#"&54>7654&#"#"&5463232p)    $ +,E$"47*U   '&  )' 4(.'6I"P$/)%,+%#"#"=4#"#"576767632;272'2=4"3(% [e  v(:\J \){# "v-J4L(,+7#"543254.'&54767632#"G25n #DC MR)|G' \  @ " T!,+7632#"&5476724&#"326c"1'3C=;;D;^)Sg*'!7&6H>5ZA7  E 4.'--N,+>.+"#"5476;2#"547 '  1 9  "# T.< <3& ,+732654'&#"7#"&54676'.54632'654&#" ;3 J/+B*' B)&8  % -"(' ,8/& ' !&# % ) R  ,+74&#"26'2#"&547>7#"&546- )2)81CE ?c)1$;N"1))H2Z j7$*"3D*x ,+62"&42"&4@""""""""u ,+7&54632#"547654.2"&4-9: +"" :*: 1 ""J,+7'%&5467%6W _ x x ^ Hf ,+7!2#!"54>!2#!"54>0- -    l   S,+%6/&'&6&547  ^ x x ,%" ,+2#"'&5467>54&#"&5462"&4F3P"  #7)   c/$ $ $ ! ""(e HB<,+%"326?6&"&#"#"&54632>332654&#"326762#"&54632)$1:!0''2Y@   ':oN[Y#_7frU\54@M,&BS c'<'Lio\Wx# EesyS?NS0 ,+;24/&"#"&#"#"47676767>5767>32#"&+"#"47>54'4&'&+",  e 3g1- (==  s 3+} Em   #   !  = W@R EA:,+%4'&#"326'4&'&543232632#"&+"#"47657254&#"0%  '>$ )IG *>( 03Pf'1q6', 5 )0&  $, %J /  ,  1+,+2'&'&'.#"32767>?6#"&546 0'0DX^I'*SXz+  bDLu$ xSVv0,& ,+732632654&#"""47>54&'&5432;2632#".)J[lM2& '&$ U{^,>IrLFc  f\UxOZ?+,+7;27>32#"&'&'&#";26767632#"&#"#"47>54&'&54322326;2#"'&'&+"D  ('C(  ,+) a   V   "  'D/(  % 5T=+,+"326327>32#"'&#"&"#""&#""47>=4&'&54322326;2#"'&'&# 6    )&" 0$' `  o T  " J()   C@:,+#"'&'.#"327654654'.#"&463232632#"&54632  5)KcbJ++ 0 $  NI_`lv,  nJHi  &(yWUq Z2,+%"&"#"476=4#&#"""&#"#"47>54&'&54226323327254&54'&54323262&$(,p\$, ) &$&, nZ*, &, < $zr  #uK#  #,+4&'&543232632"&#""4765\, '3$,2$3J  %%),+6&'&543232632+"5476326765V, ( $? K  V0  !$<a ,+&5432;2632#"&+"#"47654/&#"#"&#"#"47>54&'&54323262327>?651(%"<':@2  (" 0, &,  E q   .A +H.  q A r1#,+;2767632#"&#"547654&'&543232632_ .X4)0T 3  #   OL,+&+"547>54'&'&54;2?>;2+"547>=4".i*x  f gv`    0D* !     =      iH3,+2632#"'.'&#""&#""4767654'&'&432323254'.'&54r8L)C$ %& &!4 &8    jBY0K& !'.p += <     ,+746732#"&"32654& vfYwfXDJUFBKSUwnWV{t aDPrfBJv`7,+7"#"47>=4&'&543232632#"'&563327654&#""&z2 2L_);   ")G+)+&" ;;:H-0."kF%1+&!,+.'.546323276#"'&"32654& 8.^d]1:!+"  &&MDKEYnOETk  dCZ{eV(D)%  ( - bAP~uFGoBRMF),+"'&'&'&'&"&#"#"47>=4&'&54323263232%327654&#"<>% +&" 2 +GK   3 &&1 !E8 g- 41(     .!2+=/ ,+72654.'.54632#"&'.#"#"'&'.5432)% +/A>4   /* %  CC7#   7 $+$3 (: # %%    +G 6 =@,+7+"547654'&+"#"5476762;27632'". #"42 !*   %$    5 E'  ')  0   6,+#"&=4'&4323263232654.5&'&43232632^FZZ ( # Q>=>  "H)FZm\#  >\UI *9:2 ,+#"'&'&432326322?654&'&43232632`|q  31KU  3 ,$8-+2   $RuF,+27674574&543232632767654'&4322632#"'.'&#"'&'&43232632?654/&'&43232632    C4 " #h2 (" " , 472%/ $ $e 2 1E -* (y XYE  {q s U$  ZN,+%#"&"#"47654/&#"&#"#"476?6/&'&43232632?654'&432326324@DX2 / 9$Q^"* 6 < ;F0 &8Jd  Z h*^z,   M U >R*C(,+2767654'&43232632"&#"#"476=4/&'&43232632(<*   ,'+ 3$,23L& 3 #  c8 4(DY++Ys6~B* ,+%67632#"&#"+"&'54767>&#&#""767632323272328 & $N&DH2,  )H/X Q.,8 C 0_'&  s I,+4;2+";2+"&5It : Ek <   ,+#"'&632    ,++"4;2654+"4;2 kE : t  'j,+#"&'&'&#"547>Y) PS ajs@hl E ,+!2#!"546- I     ,+.54632#"t/ 0 / P 1=;4#,+".#"#"&546?>=4&#"&767>3232632'3276574  $'O #- <' A)     |' -552! ,+74&#"326""&5654&'&54767323632#"&%+ .' &0*3DS53232632,G-&7 6BNH   &  (.5g"M&# C/ANK(  %#  '$,+7;254&#"4632#"32762#"&Ad'?P8/ -#" 11D P8N%'9 F5',+;2+"+"5476="'.43674>32#".#"pE5n..'   B    1J&   n ,7D >82-& ,+&54767.5463232#"#"'#"&5467"3254&2654'&#"=*  B/1&A, 6T<0I;:2%*)(&  "*-+?  81D!5 %= '1D;.,+%+"&5476=4&#"+"&547654'&476732632 k "' j  -":$22g&"f!%%%."(0/+! ,+73+"5472>=4'&476732&462"s nC E/ "o{ ('# ,+74'.7>?232#"547>765462"= 4 % F/#0 BK 5D ,+22?6'&54;2+"54654/&+"547654&'&4767h :  \ " J V#uOa  84 0   7 X  OH   (! ,+73+"5472>54'&476732l nC /  &%mZ,+%+"&547676=4&#"+"&547676=4&#"+"547676=4.'&5467>73726327>32  h #   g #   e 25- 4 '.    m"#k    m"#k    q *%  &#H</,+%+"&5476=4&#"+"&5476=4'&476732632 k "  j . 63"/3fdu&  (&"  ,+72#"&546"32654&1KH@3HP,( (H08PC58P4'+>4()?s2 :1,+732654&#"4&'&476732>32#"'+"547676e!#"*& +7", 5->W<# kK";'$8!  B.:Pv   rC 8,+7"326=4&7>32#"&"#"&546=4&"#"&54632".0%##1      )-3JZ=*;%)>$Q ;     U B1;R/,+7+"&5476754'&47>73267632#"&#"e# r    !!  1cp%  &   -! ,+7"#"&'&54>32654/&54632#"'&q +(B+' (,:&% !$)%!'  --,+7#"&=4."#&54767632;2+"32762* #B8 ! ' * xAE0,+"54>5#"&=4'&5436763276=4./&543>732;2676#.=!)4      %-*%"r   e ^    w*' ,+7&54;2#"/&'&54;2?654R SX]**    f dJ,+%4&546;2"/&#"/&'&546;2?654'.46;232?6y! N  Y=@Z g  -" f ('       h S   ^ V M0 ,+7&'&546;2632?>'&546;2+"54654/&+"5476?6'4 3  H (< d#'E0   ' #   <Z  45  = p$5",+7&54;2?654'&54;2#"&547232767654/&c +' P  F a W    E  -*,+732>32;267632+"&4?6+"#"547632G5." F    ?    <  - . ,+732#"&=4'&547>54&54632#">3' 1K=L1 (..`  ('k)  C')  <( =l ,+4632#"5= # | .",+76'.54654&#"&5432#"546326=46.( 1L=K1 '3 (<  )'C  )k'(  `.&R,+23267632#"&#".546P2  ;X / J$  8$ 9=l ,+7#"=4632'54632#"l#  / # d S 2FE;,+2#"'&#"#"&547632654.'&54>7>654&'.'&   $ -"j7! & F :NA"$(  " (N4B # H? 1#2.B" %7%' Xp$ ,+2=4#"&54>;2+"#"&54632 OwJh;P 6 .', ] `J5L! 6'4 '5 3,$,+74632#"32762#"&7;254&#"7&54632#" P8/ -#" 11D8d'4@   u8N%'9 Fj kK  K =  ,+4632#"54632#"5= # l # |  \0F!,+232632#"&#"#"54.54654&#"#"&546323254&546  5  5 3  2 D  " '5W7%$2R5("   @ `,lN,+732632#"&#"#"54654#"#"43232654&546=4/4654&#"#"&54323254&5463232632#"&#"3 2 ! 22 3 2  !66  :!  * 7<  !#   * 7   7hp p/+(zp p/+ wp p/+"*p p/+ `p p/+gp p/+(zYp p/+p p/+ p p/+ i p p/+&k] p p/+ u p p/+ p p/+(hvp p/+Kp p/+_p p/+8np p/+mp p/+.jp p/+a"p p/+4cp p/+hp p/+fp p/+#b p p/+ Zp p/+*hxPp p/+uPp p/+mJp p/+ fPp p/+mSp p/+,hp p/+( p p/+m!p p/+mW"p p/+g#p p/+l$p p/+mO%p p/+m5&p p/+h'p p/+m (p p/+m)p p/+*p p/+m+p p/+mr,p p/+e-p p/+e.p p/+ h/p p/+m`0p p/+"F1p p/+c2p p/+e3p p/+p4p p/+h5p p/+g6p p/+fR7p p/+m8p p/+m9p p/+m~:p p/+I;p p/+K<p p/+=p p/+'>p p/+E'?p p/+}@p p/+k kAp p/+i5Bp p/+ nkCp p/+g7Dp p/+ nkEp p/+pFp p/+ kGp p/+pDHp p/+pIp p/+{Jp p/+ p5Kp p/+ pLp p/+ouMp p/+pHtNp p/+kkOp p/+2rPp p/+CmQp p/+pqRp p/+ lwSp p/+nTp p/+kAsUp p/+ifVp p/+gfWp p/+pgXp p/+$fYp p/+ plZp p/+[p p/+=l\p p/+]p p/+&3R^p p/+=l_p p/+ `p p/+X3ap p/+ n bp p/+=cp p/+0dp p/+,ep p/+7 /+(" /+  /+" /+  /+ /+("Y /+ /+  /+   /+&]<  /+ u^  /+~  /+(v^ /+ /+g /+8n /+i /+.i /+ "h /+4 d /+l /+f /+#  l /+ j /+*x /+u /+J1 /+ `f /+S1 /+, /+(}  /+! /+W" /+# /+$ /+O% /+5& /+' /+ ( /+) /+* /++ /+r, /+ - /+ . /+ / /+`0 /+"F1 /+ 2 /+ 3 /+4 /+5 /+6 /+R7 /+8 /+9 /+~: /+I; /+< /+= /+'> /+E? /+%@ /+ A /+5B /+ C /+7D /+ E /+F /+ G /+DH /+I /+{J /+ 5K /+ L /+M /+HN /+O /+2P /+CQ /+R /+ S /+ET /+AU /+V /+W /+X /+$Y /+ Z /+[ /+=l\ /+] /+&R6^ /+=l_ /+` /+Xa /+ b /+=c /+t0d /+x,e /+7= /+(N /+ E /+"ra /+ A /+ /+(YN /+8_ /+8^  /+ G  /+&]  /+ `u  /+[  /+(v /+G /+ /+8 /+  /+.  /+" /+4 /+  /+ /+#   /+   /+*x /+`u /+J /+ f /+S /+,E /+(?  /+N! /+WB" /+F# /+C$ /+O@% /+5@& /+F' /+ @( /+@) /+]@* /+A+ /+r@, /+A- /+C. /+ F/ /+`B0 /+"#FE1 /+B2 /+D3 /+X4 /+@5 /+@6 /+R@7 /+B8 /+@9 /+~I: /+I>]; /+G< /+>]= /+b'"> /+KEo? /+F@ /+ A /+5cB /+ C /+7aD /+ E /+aF /+& G /+DcH /+9I /+'{9J /+ 5cK /+ aL /+M /+HN /+O /++2P /+*CQ /+R /+ S /+T /+AU /+V /+W /+X /+($Y /+ Z /+\e[ /+=LlG\ /+\e] /+&{R^ /+=LlG_ /+8U` /+X({a /+ Ub /+=LGc /+0Hd /+,He /+U ,+4632#"'.2"&4]  2##2#= ,,Z=''fI#2##2> % ,+47632#"=4&4&'747632#"=4.45>/ / l Ej9  Ej9  @$,+?#"=7"54?"54?632?6327272#"=7r!q1, ,?C"@E*)q+*; 8"= :+ + Ƴ  / /   $# 5 er phH,+32574#"#"&5>74#.5.'463223254'.5467657632#"&'.#"3>54&'&*9G% # hf  9  3 ! >E^T A 1:4AsB(46 $GwL 5 ^ :J  +U74i  O (?h ;EX1;&2>@ 83,'  ,+632#"&542#"&546"32654&2#"&546"32654&f   ~6GR=7HU1!$"'"!!6GR=7HU1!$"'"!# 5 (R8A_Z;=XA*8TH/4L0R8A_Z;=XA*8TH/2N%W z \> ,+7654&#"326?'.'%232>7632#"&/#"&54?'.546327>54&'.5432326 7(*9!,D/3L' (J ) &(     %<4;+ '"""Gh R71J3. _ $J  < ExV1!1G; '1)->'* /M[ !' 1C, ! K?M  2<9./G a"'d  > ,+47632#"5654.'>/ l Ej$ (*  ,+#"'&5467632 ;yq?  =[]7 ;*wu? =v|7$+ ,+"&547654&'&5432 |; 9gb< @ow;  9yv< @"t35% ,+432&'43267632#"'.'#"/#"54?&'&":  4 I/# :  4 I/# A+2\ : +2\ :2&&",+;2+"#"&=4+"&546;2=4632J  " $     mu,+"547>54&'.54632$'9!$/c 50 7*Eb ,+7"5467672# @#3<`,+62"&4\. . ` . .| ,+632#"574) /I (  ,+2#"&546"32654&Y~}XY}}^=PG:AMF{WZZWz)_IEmWZCf4% ,+74.#"43232632#"&#"#"543>m !11  := D      7,+'&#""54767654&#"#"54>323267632kAB(O($I+ $:!.:)[  3 ! (oR#+0 I212W" ] $B?5,+2"546327>54.#"#"546767654&#"#"5461;*4?<*6 0-- )" & (#) ^9/!OC(Q  ?B&$ $F% PK.94/,+>;233272#"&#"#"=4&#""547672=4&37 , " 1  )5  6by ;;   7r 4C5%,+"547654&'&54767>32V"!E42 j )Q L<& /Y;B 1  *<I$[s)0,+"&547>732327654&#"&767>32_`s*U GY":(+7'3  ;4Ilq^0\9eE*%!B/G  F5Uw?(",+6&'&+"#"5476543233272#"&547X uY *  N  92" # %=M1A A6' ,+32654'&#"7#"&54>76&'.54632'654&#";.*7n Q=8nGA`,#'"hB:Y0"  60"%:3 *1J6(BK0(B4GcS>1& (B%6DF62) ,X$9.! ')F,,+2#"547>7654&#"32>76#"&546If~,1 *!LJ6-3;'  -/5LptX|+Y  p+e~?XE*/N  !I5J}Fu ,+2"&42"&4f. . . . u!,!!, . .mu,+2"&4"547>54&'.54632T,!!,!'9!$/cu!,!!, 50 7*Eb5,+7+&#%&5467%2172| S)      "2l" ,+!2#!"&546!2#!"&546J  C   C l    5,+-.546323""5467%6 ) K u    "D5#+($ ,+2#"&'&5467>54&'"#"&5462"&4l:2)4*1%05%41  2##2#2)p(=< 8' '3?$#2##22}OIC,+"3276?654&"."#"&5463226332654&#"3267632#"&54632.H1"'B  53C}V) 7Oi{y0y& Nz2Ԙq{EQE1- $g:3Xo%+ L54&#'&43 p l  0[,++&'.'&#"547>4  .$4  [Y  >5M  +J| ,+!2#!"&546  9   ( ,+4632#"'.( !G "G!| $ /M! JC,+;:6&'.'."&""47>54'&+""&""547>7>4767632& t3(3":(  (,"'( t QDT  9 3       ? ) ,+7"32654&'32>54#"'2632#"&#"#"47>54&'&542&))?Dj!#'[=, G?!rZU>#(8n"<*8)7$Q:hI )DC" <$,+2#"'.#"3267632#"&546RM? >=JelR'O e+k\/"pLX*$ H fg +,+%2654&#"632#"&#"#"47>54&'&542Rdi`"0\M{K>#(8tQad'`yl" ZXJ,+2632#"'.+";267632".5&'&#";267632#"&#"#"47>54&'&5421    aO 2  d+    5>#(8;  | 0 &   o"(." K,+7"&""47>54&'&54232632#"'.+";267632".5&'&#";(;"J(#(81   aO ( -O)  " 3)   | 0 &  < ;#,+%54&'.543232632#&54632#".'&#"32  :+  =mlnM?&kI\lRPP,    : fhI QoMXbW,+4'&5423262#"&"#"47>=4#&#""#"&"#"47>54'&5423262332725:(>>(:#C*D#jZ#C*D#:(>>(: f #X`<    <<    <]$,+6"#"47>54&'&5423262#"*D#(>>(#"  "Q',+4&'&5423262#"&54632326765x(>>( ,.=6 . a!  !f+H//"1*&#>3`R,+%"&#"#"54>7>/&#""&#"#"47>54'&542326227676'.54232632(]  (1D#:(>4(1B0  (65Z7 ?  ~<   &Z&45  <7 G.",+7;26762#"&#"#"47>54&'&5423262b,  5>#(>>(N& M"  "W=,+"&#""47>54'4&#"'.'&#"&#"#"4767>54&'&542326327676372632B(5<( [ $# ', !( =;&@ ^93h/ -E :  ?@$,+#"'&#""&#""47>7654&'&54323232=4'&5423262 (.3(.V :(0'(_#1FF45   =   "<,  ,+74632#"&"32>54&<_eudCOXP6F`[Ď-qL]zCS-Q1,+7#"&"#"47>54&'&54232632#"&5432654&#"#C*D#(8 GHaPD  "%;-,O" <>CO  8'0B<"$/*%,+&'.5463232>32#"."3264&1wic=I&/C*KN3bKW`TJHS# Nix[C9b +#ImN`|{ 9FC=.,+7"&#"#"47>54&'&54232632#"'&'.#"5326'4&#"(5D#(8 Q3 #7<0:*-+' >JL2O" q)8 Y@  26T  ъ.3,2 <rB' ,+72654/&546323#"&'.#"#".'./&'432 ,..NS_?'!   7#,"UGbO'#     /".25H7? ; *'( 4-F.S B   #<1,+74&+"#"54>7632;2>32'&'&#"#"&"#"47> H#  ('4  9P #C*D#O%  ,! 9$:1 ,+#"=4'&5423262326=4&'&5423262$\E8(=6(BE:J(")(2b{BjIΠ=   ! [WQW"   5,+6?654'&5423262#".'.'&5423262QW (")(@  q (36(!  =%-     hH ,+?'&'&54323263276&'.54323263276'&54322632#"/#"'.'&542326324P< 0)+  &=/BA..>' LS  (3 8 r e-  0WW    ( *    *$]     !S3,+&'&5423262?6&'&5423262"&""5476/&"&""5476?6'x)(3@(  BD(,)( dx"(A"H(.NT$(,"'(@*Yr(   Y [   w    m r   4l C8",+754/.'&5423262?6'&5423262#"&"#"47> W!(36( \Q (")(0E #C*D#OA*&         |9Y(@*,+73267632#&#"#"&547>.#&#""54676323272:ª,   /7  "*h.  w  "& M.N% K   fR1" ,+32#"&54654'&54627654&54632#"ZK K6Pz _ _ zP6K E'P,n#32 DA$pQ##Qp$AD 23#n-Fd  ,+4632#"&5d$  "A #f\1$,+6'.54654&#"54322#"5432654&546'E K6Pz _ _ zP6K KF-n#32 DA$pQ##Qp$AD 23#n,P2~,+2#"&#"#"&5463232>] t, `j#1!~W0  Z0\L,+"&54>32"&462  2##2#* (#":**#2##2#51,+7#".546?632#"'&'327632#"&7#9J5'A^sXG$"" W5i 5Ke=@XR tIV2 1,  ) +X3uR5,+4>32#"5465.#"72#3232654&5<>3#"&'&#"#"&54676767"&546?-fFe +1: u5?." \=.A1(  <$T  KUGZR%0y =|=!  9T" 2 0&C8%,+"264%&546326327632#"/"'#"&54?&47,vSSvS -6AD2. -''/ .22/ /''UxUUxh -)). -33/ .)). /32jkH,+.'&54323263232767654'&4323263232+32+#"&#"#"547657#"&546;54'#"&546;&''! O6 ! ]8!.B !(&'&'&67654&1  &!h<-0G$$*4  "^!! L&X +/X + ("%7]6fF3F1S+  R #`T>S'1NZ& *2R1Z& *2R)> ,+2"&462"&43&&&&>&&&&+v'/: 50,(,+%632#"&54632'"'.#"322"&4$"32654 SFesM,!2??7Bښmn $jDH^+ M8;Xmnom  3?N G@=6#,+".#"#"&546?>=4&#""5467>2326?2'3276=432+"&546 $'O # (  <.&  A    )   |' Jd@75& ,+%&'.54767632#"7&'.54767632#"C^o P c:6e ^o P c:6e %^3WM l-*p ^3WM l-*p 2+&~,+"&54>3!2#"&=4#@  "B    ,+7#"567672' @u545 )4<D @ A=951,,+"5436=4'"&63632"#"'&#"#74&#"326&2"&46"264k     # + O  Z?X??X+3H33He:il ,+7#"&546;2J :     ,+2654&"62"&4H+<++<+`HI^I ,,++[E`NN`2&c,=2-(,+;2+"#"&=4+"&546;2=4632"&5463!2#@              <,+2#"54676#E" D K/ !.)2!,+32654#"&54>32#".#"#"&54632#"&#"", iY_-  2 @1$4)! "/#tS|;  'R.#&-,+2"&4N,!!,! . .!,+"&54?3#"54633254&#" X' #[" '  p3  )6Q) - &  ,+2#"&546"32654&32+"&5461KH@3HP, *  )    H08PC58P!3&*=3')=d@7,,+%#"5467>4&'.5432#"5467>4&'.5432a e6:c P o e6:c P o% p*-l MW3^ p*-l MW3DK9%-*&,+"'.546767>74322632"&462:2)87# 05%41  2##2#2)t'"4   8' '3?$+#2##2  +A/+  ,A/+  -A/+  .R/+  /T/+  0A/+w 1< 2 3A/+ 4A/+ 5A/+ 6T/+ 7A/+ 8A/+ 9A/+- :T/+ ;? <R/+<, =A/+<, >A/+<, ?A/+<, @R/+<, AT/+l5*,+?632#"/&"'&54?6/&5476"  y +  y  <, C: DA/+: EA/+: FA/+: GT/+ HA/+ I< '  ' aA A/+ ' bA A/+ ' cA A/+ & d|R R/+ ' hT T/+ ' jA A/+wE ,+;:64=4""#"547>54&54+"#"&#"#"547676&/.63232632#"'&'&+";27632#"'&+";27674>32#"&?] T2:b $-88 &"> Z6   M.8  H/H*  0 vP :)   65  %$ *b0 "( <'  & arA A/+' bA A/+& cmA A/+& hcT T/+& aA A/+& bpA A/+& cA A/+-& h T T/+'<-(,+632#"&#"#"47>=#"&546;54&'&5422654&#"32+M{K>#H  >(8Rdi`"fT0`ylk" \tQads'?' dR R/+<,' aA A/+<,' bA A/+<,' cA A/+<,' dR R/+<,' hT T/+2E! ,+7"&5463!2#'2"&462"&4@   &&&  &&&&<,/  ,+32>54'"7&#"54?&546327632#"'-N6FCO29>_\G& 9>uUBE54&'&5423262)GbPD  "%;-,#C*D#(>>(:` B>CO  8'0B"   & hvT T/+ l LK/+ l& e`K K/+  NR/+ & fkR R/+  P/+ '' /+< RA/+<' bA A/+< TA/+<' cA A/+< VA/+<' gA A/+< XR/+<' lR R/+' lR R/+ YR/+ \ ;l ^K/+l& eCK K/+ `R/+& fNR R/+ bA/+' gA A/+ d'  fR/+& llR R/+<  hA/+< ' cA A/+<  jR/+< ' fR R/+<  lA/+< ' gA A/+< ' /+<  m/+b pA/+b' cA A/+b rb , tR/+,& dR R/+l vK/+l& eK K/+ xR/+& fR R/+ z&7 & g/A A/+ Q= ~Q=' ( Q A/+Q& cA A/+3 /+3' /+3  A/+& bqA A/+ /+' /+ A/+' \A A/+ C/+g C9: C/+ C9 ,+7"&54?54&'&54232627632;26762#"&#"#"47>=# W(>>(P  Pb,  5>#P /r"  "I, ,& Mu,? A/+?' bA A/+? ?' ? R/+?' lR R/+? ? ? <,l K/+<,l' eK K/+<, R/+<,' fR R/+<, A/+<,' kA A/+B BIXQK,+#"&54632326;2#"'&+";27632#"'&'&+";2762#"&#"&#"327654'0d_ (2.  ,bO  -P6 1!'7MEWQ) a]9#8z  & n:(. nR\v   A/+ ' bA A/+   '   R/+ & lpR R/+<r A/+<r' bA A/+<r A/+<r& cUA A/+<r <r&  <r R/+<r& lTR R/+#  /+#'    /+#'R R/+# R/+# #M3 ,+%32+#"&"#"47>=#"&546;54&+"#"54>7632;2>32'&'&#"3\J#C*D#R  H H#  ('4  9P   ,! 9$: R/+:' dR R/+:l K/+:l' eK K/+: R/+:' fR R/+: A/+:' jA A/+: A/+:' kA A/+: :'  A/+ ' cA A/+ A/+' cA A/+ JT/+( A/+(' bA A/+( A/+(' gA A/+( R/+(& lgR R/+<r ' @ y! ,+#"3274?54'&&'&#";274&&+"#"&"#"54765654'&#"#"&"#"54765654'"'".7674>327>327>632#"&#"&76=463267654&#"% 4-4"2G +)")+C2 +)")+&%4C30+_'"   FYK\tk%b F #:8 )UC5 p @.5 bF.:=`_ % g >    S8~ >    R9~ >b7# "" +0 4vT_ 2 B  #t@o % 4,+4&5&'&#";2%#"327476'&4+"+"&"+"54765654'&#"+"&"+"54765654'"'".7674>327>3276632#"&#"#"&67>76=4&#"#"&"#"&67>7674654Y2G % 4-4" +)")+C2 +)")+&%4C30+_'" UB3@04  <"7 "4"5" g =`_ % @.5 bF. >    S8~ >    R9~ >b7# "" 8I ??9     %5 #b    .v3 ,+#"3274?54'&7"327>76#"547676=654&54'&#"#"&"#"54765654'&#"#"&#"#"54765"'".7674>327>32#"'& ' 4-4"6E A4< $ 5/ $.3++)")+C2 +*)+,%5C30+Z'])p @.5 bF.+^a $  PK'3> 2g-SA  >    S8~      >b6$ "" =% },+4&5&'&#";2%#"327476'&4+"#"&"#"54765654'&#"#"&"#"54765654'"'".7674>327>32763276?4.'&4323272+&#"#"47>54/.'&#"&"#"&67>767Y2G % 4-4" +)")+C2 +)")+&%4C30+_'"      Q,&o "{2$i '&4 "1"5"g =`_ % @.5 bF. >    S8~ >    R9~ >b7# "" ?' d  X ({0  )4P   FI ,+#"3274?54'&%#".#";2>7632;2+"3276#"&=4.#&#"#"#"&"#"54765654'&#"#"&"#"54765654'"'".7674>327>32% 4-4"L/d     vg +,I#+@ 6+)")+C2 +)")+&%4C30+X#%p @.5 bF.!  -0 . "8) >    S8~ >    R9~ >b7# !#  \D ,+%3267654&#"#"#"&"#"54765654'"'".7674>327>327>632#"&#"&765&'&#"#"&"#"54765654'"'".767676'& #:8 )UC5 o &)")+&%4C30+_'"   FYK\tk%b 2H))")+&"c">  #t@o 0 @.j   R9~ >b7# "" +0 4vT_ 2=`_j!    P6>V eC.8 ,+#"+"&"+"54765654'"'".7674>327>3276632#"&#"#"&67>76=4&#"#"&"#"&67>767&'&#"+"&"+"54765654'"'".767676'& %+)")+&%4C30+_'" UB3@04  <"7 "4"5" 3H*)"))&!"p @.j    R9~ >b7# "" 8I ??9     %5 #c    =`_j    /JE\ ^J.fp1 ,+#"+"&#"+"54765"'".7674>327>32#"'&#"+"&"+"547654&5"'".767676'&#"547676=6=4'&47>76!&*)+,%5C30+Z'])G6D))")+&"d5/ $. p @.j    >b6$ "" =^bj!    K eC.]q'3> 2g!0}C  b6,+#"#"&"#"54765654'"'".7674>327>32763276?4.'&4323272+&#"#"47>54/.'&#"&"#"&67>76745&'&#"#"&"#"54765654'"'".7675476'& %+)")+&%4C30+_'"      Q,&o "{2$i '&4"4"5"3G+)")+&"p @.j    R9~ >b7# "" ?' d  X ({0  )4z  C=`_j    0L YG.BM/,+#"#"&"#"54765654'"'".7674>327632;2+"3276#"&=4.#.767654&5&#"#"&"#"54765654'"'".767676'&&*)")+&%4C30+>M; vg +,I#+@S/A*)")+&"p @.j    R9~ >b7# E !D0 . "8) r$Z__j    M5OI cE.YYXX ,+267632#"&54632"- G2-G!#20B4& "Y,+4632327>32#"&!\ T<6W' "g:O:#E= ,+%4&#"3276.546767>7632#"&#"##"&54676ld%)% G/H) H21D.E(E$#4&+6|l@p]NDv0(OKv44! +=  >  % &;B&]vSEtuBOHC!,+3"#"&'.'&4632?67>?676323262#"76&#'2/.3p   %V m   E"GL(8+ ' 4   ' +8('2 D ,+76?67>?67632+"&"+"547>54/&+"&"+"5476B V m &"  GL  )")-'  %&  "     *@OLC$ ,+%'&#"&"#"547676?67>?676327632#"&"#"547654&74&#"326,SL)") V B%4BOJA "7.$'*1   '  ;90Q =+< h(2EB$ ,+%&#"3!2542#"=4&#!"#"'.543:62>76767>367>32~##f?  13' " xL 6+V7:T+2{.    ?<,+%#"&#"#"47>54'&#"#"&#"#"547>77>3>7>323/$! fD !"!?R!*  7'   H   !#   RWA-,+32654&#""#"47>54'&#"#"&#"#"547>77>3>7>327632#"&#5$&8LWPED !"!?R!*  ^2g]j%7C9&4pW@NP   H   !#    [U*H-  wo ,+.54632#"\J" 'j { }o,+#"5467632+' "J { j` ,+#"546?632#"/&mE - Z EB As B) ,+"5463232632#"&#"G R #D X ( <! ? 26 ,+32+"&546J  2G ,+267632"&5432V/61 E`E 2DD >R ,+4632#"&>2n$,+"&547632#"&547>54&#"F 5(-             g  ,+32654&"62"&54E&>28>2  7)2-` ,+7632#"'&5432|E , Z EB As Bb,+&'&54632#""q &  > l ,+#"547>7632) t"H & )| |/+W W/+3s| |/+3,| |/+,p p/+8(| |/+$(| |/+0| |/+0| |/+2| |/+O1| |/+"Y! ,+46732#"'.'&'#"'&'&54732 0  =: / %21= b  < _ *+ 2=**FRLG,+%2654&#"32762#"&54$32#"&547676'&#"54>327632'"32654&MDk{ͺq0QG &r>;[~3!   A_8k"zAM>~  38*Ċ]i.,Bd+BZ &   jV! B,hL/+ ,+.54632"547>54&7!%.O/%+S1)DC #$     '#,+#"&#"#"543>=4#"&463>32 :> H)D#&  D   3~&" ,+2#"&#"#"5436=4&#"&463>323,( MQ a2")J)&  )&   3-bohc,+"&'&'.'.54632327>7654'&'&54322632?654'&43232632"32>54&.N`9+X GD-˚Zl(=MG:[3h"<t#"&OC+ " kyHo5%)v" 10Jl;EaDwP=->%/ v9  %)     &"09@*mcIw-I*70+% ,+.'.5463232632#"&'&"32>54&vX GD-˚Zl%7JA!%TPL, 9<1P0)ikyHo56 10Jl;EaDtL: .97 !#mcIw--:3.& ,+.'.5463232632#".'."32>54&vX GD-˚Zl6UT)835B](, 7>4o?8WkyHo56 10Jl;EaTR/>)+/* .-,IţmcIw<@)5/*&,+&'.5463232?2#"&"32654&1wma$;3 UH=(8K@|K`eUKT]# Nj{Y;`<" 6 *  H3+NGtN_RX0+0+kwql_S,+%4#"32?6#".'&#"#"&#"".#"&54323254&'&'&#"&4>54'&#"#"&5432326323254&546323254&'&54654#"#"=4>4.546323254&#3262#"&546323262"32>7632&#"#"&#"3254&54#"."3254&54654&54632#"32654&5463232654&"#"&54632#"&546%"32654&Z  ' >  $%    3#  *'3   !  1   ! 6   #"  "(N5"6 !   #      *"   _(- !!- R2K1\$ "4Rh+A .     A 08/;'+9*2 $.  $  &# :     )  ^'  #)#"   $    U   !! ' $ *3!. 4 13Z  Kp(#(%@A!,/|]#/+%,+".54>32#".#"326324#"3265t̄sQ( ,  H y0 zWnlS  " R\md]!,+2#".#";2+"#"&"#"54765&#"#"&"#"54765"'.547674>3276"3275476'&&- %* v^.+"+*=. -+"+." )+8-0+=#=5*-  *B[T         ?a7# DRBS7?G:LQ'r /+b@9,+".#"32+#"&"#"54765"'.54767547#"&546;>32= > o++"++ (4  2]4=nx L!    ! ?EQ b-& ,+".#"#"&"#"54765"'.5476754632= #'++"++ (mE=nK_L!    ! ?i bQ'r /+RY:,+%"'".7675&676'&#"#"&"#"54765"'.547674>327632#".#"#"&"#"5476L")I`-+"+.".+9-0+=A&- %*-+"+*F ?=:l!    ?a7# D *B[M!   b4' ,+&54?54632#".#"7632#"&"#"5476=$ >mE= #'H H+)"++  #ei K_h( (!    !L:0,+";2+"#"&"#"54765"'.5476754632#"&ge++"++ (dD( " &* !     Ff  (dJ,+7#"'&'&54767632E3 SW^c CF] V; @j  fdJ,+764'&'&5432#"5476E3 SW^c CF] V; @j  fd5/#,+7#"'&'&54767632#"'&'&54767632E3 SW^c CE3 SW^c CF] V; @j  f9F] V; @j  fd5/#,+%64'&'&5432#"5476'64'&'&5432#"5476E3 SW^c CE3 SW^c CF] V; @j  f9F] V; @j  f#SN;,+27654&#"32>54.#""5467#"&'"#"&"#"54767654>32>!04C3CB+/ +   3C]@ 9"+!,GH$?T+T,B__0*5&I/,A"  f9[ 3     dXBP6gv  ,+.54632#"U6) k  x ,+&54632#"547654**!(9'/B!:'(9 %x ,+#"&54632N/(8(!B% 9(&;!Y,+#"5462#"'."% :b: (:'%?>&v +< ,+2"&462"&4#&&&&<&&&&xl ,+&5432#"547654&$$/+< 10 *'4 xl,+#"&54632T1 <+/0 4'* v ,+#"547632/ )5  k*,+4767632#".(  )3? + * ,+#"'&'&54632 ?3)  (. +6,+"&#"#"&5463232632 ` # < \ %8 ) ? '=Q,+"547632#"&54654&#" &+/  0      * v AB, ("   1,+2>32#"'.+"#"&"#"47>54&'&543234     `#C*D#G <-" 0# ,+%.;2>"#"&54>7>4767632#"&#7hn 6 t   ?:5 $   ,  ( b <,".; 4/+%,+632#"'&+""4767632;24632#"&"32>54&    D" \ʓ_fudMEXP6FW  L$Q  )]db4rR]zCS-V 3  7,+7"&""547>7>4767632"&""4767>'. (,"'( t  (3":(hA         ? &$De `P1),+"#"54767632;27632#"54&#327632#"&+"#"&54>7627"#"765432;27632#"5&#      +   =5 a       .4 932!2 &27  V  =6$<, X= ,+""&""47>54&'&5423!262#"&#""47>54&#(;&<(#(>;>(#?;( "  "1  #ABBB5 ,+432;27#".'.+"27632#"&+"#"54>76'.%% &83  "  ?!    F 4 ZjkW ?  8M Qas_# :2' ,+754&#"#"54>3267>32#"&#"#"&"#"47>RC63s1^437@[#C*D#OA ?G rY72 = 1,+%>54&.546754'&5423262"&#""47>57HE9IIY~Z.(22(.YY.(38(RF5=WN89RQJM[    RIL\ !  MOC,+%32367>32#"#"&"#"47>=4'.'&#"546326=4&'&5423262QF : +>@ #C*D# @>+ : F(>>( e,; C=3 jj 3=C ;,e  s"  "-gV ,+7.54632;27>32#"&+"5467>54&#"+"#"'4.5432;26?>b^ M) $  !7ZEAV)2 $   RI%R<\xqWvI# D $h7KslEC^'- 1&     ( ) * + ,( -b .<, / 03 1  2 3? 4& 5<, 6X 7 8# 9# :: ;72 <! = M >-g ?L#jH,+75463232#"'&'&543232654&#"#"4?654.#"#"&""547676Uy]-{r 9RYP.  $&$;5  o' %"1(!>ff @7AL !4..?,.:     # 9  ,+.5432#"~W1 Q !j   ,+#"5476325 Q 1W  j ,+#"546762#"'&'&$ C  C 0)$0 }#$| <&G ,+"5463232632#"&#"(G Q #D V ( J" I%<,! ,+32+"&546T ! >O ,+27632"&5432\  :b: :11)AA)9U ,+2#"&46q !!U . !,!#> ,+2"&462"&4-&&&&>&&&&( ,+"547632"&547654&#"@ &+/   W $        ,+3254&#"62#"&4E'% B05"!08%8$-!&32B' ,+#"547632#"5476325 Q 1W] Q 1W  j!  j ,+76762"'&5432*X  X :  >T,+#"54632#".'."^7438 * 854^*&=L('c 8).K +&% ,+"5463232632#"&#"(< R '9 S - H 8)(" ,+32>32#"&54632j   ) ! $ /-%(' wo ,+.54632#"\J" 'j { }o,+#"5467632+' "J { j` ,+#"546?632#"/&mE - Z EB As B) ,+"5463232632#"&#"G R #D X ( <! ? 26 ,+32+"&546J  2G ,+267632"&5432V/61 E`E 2DD >R ,+4632#"&>2n$,+"&547632#"&547>54&#"F 5(-             g  ,+32654&"62"&54E&>28>2  7)2-` ,+7632#"'&5432|E , Z EB As Bv  ,+.54632#"U6) k  x ,+&54632#"547654**!(9'/B!:'(9 %x ,+#"&54632N/(8(!B% 9(&;!Y,+#"5462#"'."% :b: (:'%?>&v +< ,+2"&462"&4#&&&&<&&&&xl ,+&5432#"547654&$$/+< 10 *'4 xl,+#"&54632T1 <+/0 4'* v ,+#"547632/ )5  kv  '2 (2/+'2 ,2/+b' 2 .2/+&2 02/+<,'2 62/+:'2 ;2/+-g',2 ?2/+ 0& 0//+/+-f& h ( 0(/+:f' h( ;(/+:&z ;//+/+  2/+ 2/+b 2/+ 2/+<, 2/+: 2/+-g 2/+-f (/+:f (/+) )  #_,+!2#!"&4>$ 9  _  2'] ,+!2#!"&546J k ] 2'] ,+!2#!"&546J-  ] ) ,+#"5467672' VvU)( < c&VV><  *# q iD ,+%767654&#"'"27654'.%22#"54>7>54&#"3"&#"#"54727676=4#"#"&546322676326 C,!<:RcpE(;b/C  ,-*!=(4+!'XSun=  6 '(>%.k_RZ[nO->-$^8;,I  =-&:$    "gYj  #45 )4<D @ A=951,,+"5436=4'"&63632"#"'&#"#74&#"326&2"&46"264k     # + O  Z?X??X+3H33H###:7,+2"&4****}:,+2"&4f****2,+2"&4P((2**KNf&K::/+c&NDD/+Z&K;;/+b' a'j# #/+\' N/+-"1 .& ,+#"&#"32654">32327.4>32#"&jW*!Zntj],\zWMl,SOn=,h!oF,4gu]bD}b:#>#,+"#"&"#"54765"'.547674>32#"'&#"337&#"(+)"-+ '%4C30+  "I '4.B3#2`     >b7#  % . @.54?& ,+"#"&"#"54765"'".7>74>32#"'&#"327&+ ++"++ 2NM%5M)>5KA4<Wa       U~@"@`_7371,+".#";#"#"&"#"54765"'.547674>32k 3G-+"-+ ,0JL$,4)a__50     R}A #@;+,+%2654&#"4'&547>7372>32#"&#"#"&=>5$8CJB<R 6 #RMgrk%l eMBp?y3@%1>' sR`HC,+632#"&"#"5476=4&#"#"&"#"547>54'&547>7372UB1A)("(';"7 %&"+  62 ?N:    $6     1>]X&,+76767654'&54;2632#"&#"54654/&#"&"#"547>54'&547>7372Z 1H )i $]$.|!,~#!")  62 O"   \ +e"    -/    1>& ,+7"&""54767654'&547>7372 (,",(! 6>     1>((,+2>32;2+"3276#"&=4&+5& r c &2 917"" ,03+ ;< 0QL, ,+%2>54.#">32#"&'"#"&"#"5472>54'&547>7372)+/(0&2c*JZ\> )")   6&I/6L! 53!$/rK\ 3   1>1!,+#"&"#"54765"'.547674>32#"'&#"+)"-+ #%5C30+  #E!(i     >b6$  % . @/,+>32#".#&#"&"#"54765"'.5476Z"2B;,0) 2H+)"-+ EmB,$a^i     0 ,+7#"&"#"54765"'".7>74>32#"'&#"++"++ 2NM%5M)>5KE      U~@"@a^' ,+2#".54>3267%!.#"@d/5W5@d//hE$C(7B Q;%8nS;|pGtNWsLd{$v^> ,+723"&""547676/&'&54767632"&""547>54/&y($"&(*mH E 2) (,",(  e Z >   6+    (    E9,+&'&5422627>32#"&#""&""547654/#"&543232?J!()"&( VU".$  n (0"&( Uw)  zI'    E3!  /D ,+4632#"54654&"   R' /] ,+&54632#"54>7654& : ` -%= D ,+4632#"54654&"   R' / sTb  #@#!   ,+5!53!!#5%553!%!5%'#'!%!si%i&AAA&iiҍuuttt%us*  @  ,+!5!5!5!)5!uuuus;5|o,+3'''777#'///777#57'77'77'77''7''7''7'53'''???I#8%5%8#5#8"-8"8#5#8%5%8#>,L ; 47 48 SS 9 5 74 < L,>"8$5$8#5$9"8-"9$5#8$5$8"Ie ; 47 4 9 HH 9 5 74 < |N+     "H)! ! ! !--! ! ! !)H"     +N7! ! !!!&&!!! ! !s;6<CUZtz    0 8 @ G H O X b j r z   ( / 6 A I Q [ d     $ * 8 D O [ e o |   ) 0 9 C V ^ f r ~    - 8 A K R ^ b j o w  "'18BJM^r}A; yspeMKFCB<520*&#  z s p m k i e ` _ X S P L I D > 9 7 1 + %       z s m g c _ \ W H D ? : 6 1 / - ' #      y r k g b \ Y R M F B : 4 + ) & #       a ^ Z T P L G D < 7 5 1 - ) #     } v s o m f c ^ Y U P NAU K H H D A ; 9 5 1 /        }ywe]WVPEA?;8,+2;"'37&'.#"#'.'&'#'6'2&4""724#75674&57#.'>76'&567&'&'&"#""#"'&47&54736'2>5474375&'>74'672>7>&5<52'4>7&'4'7?>3676'&'26334'267"#4#"2436.'263"263#3#13&'13#254'4&'34'4'&'&'5&#.'3'"&#.'3'#&'35#&'5"/#123"#'"#'"#'"#.'35#'".'74&5267;32>767"'"'"'#'545'"#'675#57&#"#4654""547"&#"547"=#"'7"#"5457+&547&'&5"'./""'34&54323546354637>?367>3763263363736327232726?165'5734/723&5433237'54654&5'7;'&573=43<76;35647633767>?>575>7636573>?>367>7637>76;1767>7>?2>76;32?+;2373#"&#"37+"&+3#"'37+"&#"36324>72636323262'56'73'.#"2#&7465'"##&5676?65#"#"#5&>36323254&'&'&#""+"&#"4'.'#"#"57>75'.+#&54754765&+"'#&54326323237.'&#"#563265&+572;26767>5&'&'#">?63"';2632#'6541'#"'4&#""""'&=4?"+"#&543>54#"#"'2#&5432623.=""543232254'#"&/"&#+"'#54&5+"=.'.#+#"57>7&=4&#"".'"&'#"546321432;'&='56323;54&547'563237>365'734763#&27237>71'767#&'7>77#'67&'7656.'6'4"547>76=#"&#""'#"'"&5#'5#'654'+'&=+54765#"5436=6;326;2&'&"&4;254./&=4+&#"#/32632327#&5464&5476725'&4;25'73276'.'&56'433&7>2&7653&6.3776'6"#5"..'.'&#""#".63236&'32'504&'632'梏'.&'5736323265'526=2632#37.'&#"&'7'672465&7'C.'>&'77'>7''6>3"7.'6&'>76757'&/&'&'2725."#7;57567267"5'"547&"67236'&75"?6'&&'"367'6''6;&#"&73=65324#'".'5&'6'767&'6#'710.'2677>7.'5243%3"&#&'23#&'3#73"&#.'#&/73#&'3"&#'3#&'3#4&&'23#&#23&'&'263&'23'.'33263&/&'263#4&'263'&'63"#263"&#'&'6367#&'.&'677&#27675'67#;#;27'#'"#;2673'"#13"#'"3263&'632>736:35&'&673'&'#"&'67>45"!!'>7"'2677&/45672&'7'67467"&'27#.737'&'627&'65'6726;5#&'>727#67&'674'673&'7267&'677>5'?24#%62254.>'"'&7.&6&74>%>''7>7424674546?3&>"$4#"3"542"54225&'.76'734673254#"3>5&'>5&24#.37&74."3>76&>&"25&7>#"'>&'724#%#"'&"62'2346&#"3736.'654&?273732>7&774+67&5#'27'&5676&'677>7.467&'.'7&'464&'>#.'6''6&'63.'76.'64/&'67'4&'67'&567674&>74&7>74&74&674&674.'>7#&'2767#4&67.>3&67"&>3&&'67'6'>7&74&'6767.7&'&'>7!"&4623.'#&'3%3&#";6367&'676''47"#"547"'3&'73&4776'&"6476/'4547&=465;45&'#'25&'65&'6'77".'6773&'24356767425'4#4'47565"46=657&'7"'#7#"'4.'65''7'&'465'67&'7"'&'7"'.'5'.'7"'3'&/.'6#'''./'&/'3.'6#'.'7"'.'7'&'54645>7632"#'67&'1'"4&'5'&175'&'5./'1".'47#'75546=4674>5'.'67>74&4'472&'>5'&'46#&'6.'267"'&'67&5"#"=76+677&'"+"'67"5%51%54&43254';'5'".'7&'74&'>7&'6767&'>74'7&'>7#'&#+'&+#"''.+3>346354?34&54633&5733235&546531"'#"'"''&5"&'"'#'27&536257265'132'75'334%5&'#'&'&'3           (!         .'      !                                                %                     *                      !  '                  %  0    "                       &       % 1   85  - &  v       ,7+@&      %    $(          :  q     6   9 ec            7  (       3       #~ 8  6         % >               $$    W  %  1w  x .      -,$  * qn   M  *) >                                  #                                            '                                                                                      !4                   1 *  $,     Q 1#        2 j         ^  [B J  2    ,     ("  D          P   (  x                     $        J       V     `$$$S E       / (     ?    *   '                            '0 #                     @ ! *  ;S                    'g>R sA  ,+%677>77&576'&'7>725&4654656/&'276.'76''"#5676''"6?4'"#'#>75654&'&67;>76525654&/5>"./&'4657544?65654&/>'&&"&5764/&#""#"52'.#0'&3&'&#"'7676''"465254#'5"#".'3>23&72677"3:337>3;7367767'"&#'676'"&'&+#+33>36376547'&'&""&#'"'523"&334#!      ( !'                                Oj    .(        *!            &              %   {  <   i #   Q 3  f  <,  <"  Q  :   !  ( H,+73'&6?67>?67632+"&"+"547>54/#+"&"+"5476j. V m &"    )")'  %&  "!&     s<$,+2#"'.#"3267632#"&546RM? >=JelR'O e+k\/"pLX*$ H fg +,+%2654&#"632#"&#"#"47>54&'&542Rdi`"0\M{K>#(8tQad'`yl" Y#,+7;26762#"&#""547>54'&54272632#"'.+";267632".5&'&#" E.  ,!C( %("1    a G * Q. T   ) 6  g 0 &   iY,+7"#"547>54'&543232632#"'.+";267632".5&'&#"3#"&t) %+1    a F )   -   ) 6  k 0 &   b #$~,Q',+4&'&5423262#"&54632326765x(>>( ,.=6 . a!  !f+H//"1*&#>3`R,+%"&#"#"54>7>/&#""&#"#"47>54'&542326227676'.54232632(]  (1D#:(>4(1B0  (65Z7 ?  ~<   &Z&45  <7 Ga f}6<,  ,+74632#"&"32>54&<_eudCOXP6F`[Ď-qL]zCS-Q1,+7#"&"#"47>54&'&54232632#"&5432654&#"#C*D#(8 GHaPD  "%;-,O" <>CO  8'0B<"$/*%,+&'.5463232>32#"."3264&1wic=I&/C*KN3bKW`TJHS# Nix[C9b +#ImN`|{BQ8% ,+72654'.546323#"&'.#"#".'./.'4632*L;G]:<  /!(2-{gD%)5)8;.2;5 !(#(/L;B  @$ :1 ,+#"=4'&5423262326=4&'&5423262$\E8(=6(BE:J(")(2b{BjIΠ=   ! [WQW"   5,+6?654'&5423262#".'.'&5423262QW (")(@  q (36(!  =%-     hH ,+?'&'&54323263276&'.54323263276'&54322632#"/#"'.'&542326324P< 0)+  &=/BA..>' LS  (3 8 r e-  0WW    ( *    *$]     !S3,+&'&5423262?6&'&5423262"&""5476/&"&""5476?6'x)(3@(  BD(,)( dx"(A"H(.NT$(,"'(@*Yr(   Y [   w    m r   4l Q(@*,+73267632#&#"#"&547>.#&#""54676323272:ª,   /7  "*h.  w  "& M.N% K    ( G($@-0K ,+'&547654""&"#"&#"32?262254'.'7>7654#""&#"HUV (&")(!z  )wU (&"0( r # (0 '    '/  '   ?",+'#"&543232?.'&547>327>32#"&#"3276#".2Uw)  z ? VU".$  nw  5#*/  >E3! '""D,+'&54#"#"&#"32?32654&#"&'7>7654#"#"&#"HUV ? z  )wU*#5  wo # +'> /#""' '  G< ,+#"&#"32?32654&#"&'7>7654#"#"&#"'.#"32632Txz 6'gU*#5  wo # + UV !#0  3Pջ#""' '  "" 2,+#"&7'.#"#"546327>323276#"./Q. l   0#*Lm }  5#*^PL """# '""#7,+#"&7'&'&#"#"54>327676323276#"&/q)  +( 22E Z     9"9=-PL$50 xx 7 ''*C&2  2n4-,+&547>327>323276#"./#"&7'& ? 5R  /- 9"! s' Xm C$'4 8X 2 ;*RPX,W.,+&547>327654'&43232632276#"./#"&#"#"5472>7'& ? 9A 1 ' cW& 9"! n 3 3  \m B  ',H 2 ='U      ,9),+2#!"&5463%2#!"&5463   3   M  F   $  ,+2+"&546372+"&5463    JFZ  ,+73254&#"62#"&4'% B05"!0N%8$-!&32Bnj,+73254&54632#".'$#/ 73!.mT %3E>MT18D ,+"#"54767632;26232#"'&'.5463232654&#"#"54?654#5  ,  Onf;>  ;PJNJ;  $" E* ^Sjq   SeG=`  pmu,+"547>54&'.54632'9!$/c 50 7*Ebf,+"547>54&'.54632x'9!$/c 50 7*EbK_< hںhڻ   l!Md5>51%>;(<$T"N2<(!t$g4)=)FN5N2N5d2B.-*%T,H-(&-)B[upu$0(#y##>  # #NC:# yudu#2A#&kd=+dX2+,"N2,,.~J.-yo,:5d))5r(b.TTTT-----Xl1B/###### #y######N2###.y#.y#.y#.y###- - - - *%*%TTTTT,HHHHJ-#-#-#-#NNN)C)C)C)C:#:#_(BB[y[y[yj8  8  .#8-###=-]` --#x)#Sv)C[:#313}[y#[#8`)}((;ZMks#j3.#T-###b #-- -#-##Mks#- %/#b #1#TT-#-#NN)C:#(%*%}#[-#[i#-#-#-#-#BC M#+#.2~&<Cy#v%V' (5"?.-#8s'm#>(### Tn## ##  ##2I#?B?N?)NNC@u::#yyy {#(##b# #y ### ###(I I LLE0>5> ( 026#2###<2   <>>( > .6"2&>>22222,i(",>(a-fy 7>B![*%2T-$ ([#>'T#N-A#<#N-I#-Ag## <T##02##2#7#2##<<#. -)TT,%#%}8B##%#%*%-$(.}(   C8.##boq #y# I#  bb#Ce-#XBBT##b ##o##%#%-#-#-#.}}}Cb#T&- # #0<[;8q h< X&  (bX bB*T,> (?9 F 5AEN  4 #BBB.y######>- *%*%*%*% *%TTHHHH    -#-#-#-#((NNNN)C)C)C)C)C:#:#:#:#  B[y[y[y:# '!############TT-#-#-#-#-#-#-#-#-#-#-#-#11111BBBB #B########N-N-N+N+N+N+y{66....2(###### "L2#2#2#2#2#2#2#2#@B##N-N-3A##2#2#########2#2#2#2#2#2#2#2#@B#######(AHQffyy*%//HTT //H<<77aa2#2#2#2#2#  >>>'Md MM &222d((((((#(-<<<2(<((<dddd82#d=d<dJ/T"P(,,,4,,, ,w {  L,,,/,,4,,,#,w w   5  LF LA Y#-8).^"H)kRV >'>'4 T1v OH.uZe e J y## 2'1'2'/*.+*02'2'22'2'2'2'!<$ $ X2X2-#d|d| F22N2N2N2DDNMN5-v-0;(;:(0((((I(C(;(I(((Q( (((j(d(\(j(@(X$[4)=)&y0|(l(((((8(d(e(4(W(c(g(d(\(p(u((((((&((((6-@--@-+ 7(r<N;(;:(: F2222H H( $r#*%[y)kJ#@#)[c$upu$upu$((cD2 2<(;(;:(: %  -$1suz ##) %R(T00#C _#d% 0<[R<;;8Xh<r<<&#X&  0(7. -9  d(M(j- * -&Cd :-M >g*Wi)C-\7 >%7##D>@-0@->7(0 )" ~( & ( ,,8,,.,,4,,,#, *b b,6(qqF{( j"0SIEE? 9 LF L5A^ E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =7(0 )" ~( & (,,8,,.,,4,,,#, *b b,S(qqF{I j"0SIEE? 9 LF L5Ah E 0 =&=X =U5>51%>;(<$T"N2<(!t$w4)=)FN5N2N5cD2% 0<[R<;;8Xh<r<<&#X&  0(upr$0(% 0<[R<;;8Xh<r<<&#X&  0(udu#2\#&kd+dX2Q5e"N2~J.-5dcD% % % % % % 0<;;;;[Xh<h<h<h<h<Xlh<XXXX\<% % % % % % 0<;;;;[Xh<h<h<h<h<N2h<XXXX% % % % % % 0<0<0<0<0<0<0<0<[[[[R<R<R<R<R<R<R<R<]];;;;;;;;;A::;;88 XXXXXXwwwh<h<h<h<h<h<BB<<<<<<<<&#&#&##&#&#XXXXXXXXXXXX  ((((((u<ZV#D 22>2z2T  !~-Q-&-y<00/C=1C=ddvdvdJA;(% (h<; % X&h<v#&#Ni70X -% (h<; % X&h<v#&#Ni70X <-C _# #<>9(> ( 22>2% ;h<N-; ;NN% ;h<N-;N &22\<#Q5# #}-#  @'swsswsPs0<[s#;8q h<r< X&  0(0<[s#;8q h<r<u X&  0(N-9 n1pf0000<T , ` T $ |`$0$,L` D !"h#$$t%4&'(l)h*D+,d-.D/ 01234X4555647<8`9;0??A|B|CEFGH HJ,KMdNPLQS0TUVXY,[\\]^_aHb$bdXefghj0km`noDoq<rs$twxy{}4~X<X4D 8D(<Xd<$xHˆhTX,8ˤ̰̀`X$4DTdpрѐѠ0@x(P`pӀӐӠӰ4DհּT׼8؈4xڨl(ܜ݈ހ ߸8l`$h$l(d |`h,$dt$|<Ll<\h$4Dt|`p0@ H0Hlt t T d ` pd H4x X!t"#l####$%l%|%%&'(*x*+,-.|//1123355556 7|9;`;x;;<<===>?A(B@CCEF,F<FLF\G@GPG`GpHJ@JPKLL`MNPQR|SUVTVdW X4Y8ZxZ]^|_`bLce ffgggij\kkm,n`oqrt`u`vxyyy{t{||}}0}L~x(@`\llH$<,<x @P`<\| $DT Dd|(Hl(8HXhx,Hd (D`|X0@`<L\l|<X| 0Hh$<Tl0` 8\t $Hl8h@X $<Tl,Ph,\,D\t 4Xp8`$<`x,Ph 8X| 0H`4Ld,D\<tŐŴ(PxƠ Htǔ P|Ȭ 8`Ʉɜɴ0Xʀʨ(P|˜˴4Ld|̨$P|ͨ D\΀Θμ<TxϐϨ 8\tИи $HlфќѴT(d؈ج ,`ٔ٬4\ڄڨ ,Ld|ۜۼ Dd܄ܤ,D\|ݜݼ4X|ޘ޴ Tl߄ߤ0\$<Tt<\|<\0P <X4X|$Hl Hp Hp8p Dh@hX8`8\8Xx$Tl,L|<\|4T4TtDt $<\|@t ,Ld|$x tptl44L $ $  T <   <D$p$t,t`|$@!(#&\'))4)h)x)))*+P++,..4.`/T/d0h0x01H1h1111222(2H2p222222333,3P333344D4h4x4444455t56T6t7 78889h:::;;p< <<<=>D>d>>>>>? ????@@@AA(A8AHAhABBC\DD8D\DlDDDDDDEE<E\E|EEEFF,FTF|FFFGGDGlGGGGGH H$H<HTHlHHHHI I,ILIlIIIIJ J,JLJlJJJJK$KDKdKKKKLL$LDLdLLLLMM$MhNNSHSXT4X(]abDbd d4dde e$eXepefxffffh0i|jkm<np8qrt`ulwLxyz|~TT(H4lt, `DP8<,<L\l| ,<L\l|ʴT t XΘhϤTЌ$xѤT<Dh؀ؘ٬DPݔ ބޜ޴߰x0dDTdt@LL4 \H| 0 @     d pL<D4t$T$80 4 !"L#(#$P$%&x'('(x)*\+X,,-$-\--.0.l/$/0(01X123\34l5,567x78x99:4:;|;<=>H>?T?@ @h@AABBCDDDDEE<E\E|EEEEFF<F\F|FFFFGG<G\G|GGGGHH<H\H|HHHHII<I\I|IIIIJJ<J\J|JJJJKK<K\K|KKKKLL<L\L|LLLLMM<M\M|MMMMNN<N\N|NNNNOO<O\O|OOOOPP<P\P|PPPPQQ<Q\Q|QQQQRR<R\R|RRRRSS<S\S|SSSSTT<T\T|TTTTUU<U\U|UUUUVV<V\V|VVVVWW<W\W|WWWWXX<X\X|XXXXYY<Y\Y|YYYYZZ<Z\Z|ZZZZ[[<[\[|[[[[\\<\\\|\\\\]]<]\]|]]]]^^<^\^|^^^^__<_\_|____``<`\`|````aa<a\a|aaaabb<b\b|bbbbcc<c\c|ccccdd<d\d|ddddee<e\e|eeeeff<f\f|ffffgg<g\g|gggghh<h\h|hhhhii<i\i|iiiijj<j\j|jkPl mPnopopphq qxqqr$rdrsHstu0uv<vwxxLxyyyzt{X{h{x{{{{{{{{|||(|8|H|X|h|x||||||||}L}}~@~~XXP $0,<\((h,l$LX@d <Xt <Xt,Hd 8Tp<\4Xx 0Tx<` <\x4Xt(8Tt4Tp8Tp ,Hhx$@dt 0Lt@\4Xt(@\| <\x@\(Dh D`t\ìpdldθτp8 ӨԨ pո4h(x׼ @`؀ؠ @`ڸ0@P8tp߀0TxpdX4x8(8HXp@P`x<L$t`HXhx(8HXhx(8DxLdP8|\$l,d0@ DTx(Lt4Pl8p   X  0 @ l       $ D d |   d t$|,p`|xH4KPPPPPPPPQQQ$Q4QDQTQdQtQQQQQQQQRRR$RSS|TTUUV VVWWWWX XY@YPYZZ[<\d]X]h^(^8^P^`_8_`ab$bcpddde(epeffg ,;rh VEESAZI ES m xL  u   ,! M ( " 47 7 7 ,7 8 B8)Created by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)EB Garamond 12RegularSorts Mill Tools 2.1.0_alpha1 : EB Garamond 12 Regular : 8-4-2014EB Garamond 12 RegularVersion 0.016 ; ttfautohint (v0.97) -l 8 -r 50 -G 200 -x 0 -f dflt -w gGDEBGaramond12-RegularCopyright 2010-2013, Georg A. Duffner (), 2013 Siva Kalyan This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.http://scripts.sil.org/OFLEB Garamond12 RegularEB Garamond 12 RegularRegularKyrillische alternative de, el und eljCreated by Georg Duffner with FontForge 2.0 (http://fontforge.sf.net)EB Garamond 12RegularSorts Mill Tools 2.1.0_alpha1 : EB Garamond 12 Regular : 8-4-2014EB Garamond 12 RegularVersion 0.016 ; ttfautohint (v0.97) -l 8 -r 50 -G 200 -x 0 -f dflt -w gGDEBGaramond12-RegularCopyright 2010-2013, Georg A. Duffner (<http://www.georgduffner.at/ebgaramond|g.duffner@gmail.com>), 2013 Siva Kalyan This Font Software is licensed under the SIL Open Font License, Version 1.1. This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL ----------------------------------------------------------- SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 ----------------------------------------------------------- PREAMBLE The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. DEFINITIONS "Font Software" refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. "Reserved Font Name" refers to any names specified as such after the copyright statement(s). "Original Version" refers to the collection of Font Software components as distributed by the Copyright Holder(s). "Modified Version" refers to any derivative made by adding to, deleting, or sinftituting -- in part or in whole -- any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. "Author" refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. PERMISSION & CONDITIONS Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. TERMINATION This license becomes null and void if any of the above conditions are not met. DISCLAIMER THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE.http://scripts.sil.org/OFLEB Garamond12 RegularEB Garamond 12 RegularRegularCyrillic alternate de, el and elj2   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " #uni00A0uni00ADuni00B2uni00B3uni00B9AmacronamacronAbreveabreveAogonekaogonek Ccircumflex ccircumflex Cdotaccent cdotaccentDcarondcaronDcroatEmacronemacronEbreveebreve Edotaccent edotaccentEogonekeogonekEcaronecaron Gcircumflex gcircumflex Gdotaccent gdotaccentuni0122uni0123 Hcircumflex hcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonekIJij Jcircumflex jcircumflexuni0136uni0137 kgreenlandicLacutelacuteuni013Buni013CLcaronlcaronLdotldotNacutenacuteuni0145uni0146Ncaronncaron napostropheEngengOmacronomacronObreveobreve Ohungarumlaut ohungarumlautRacuteracuteuni0156uni0157RcaronrcaronSacutesacute Scircumflex scircumflexuni0162uni0163TcarontcaronTbartbarUtildeutildeUmacronumacronUbreveubreveUringuring Uhungarumlaut uhungarumlautUogonekuogonek Wcircumflex wcircumflex Ycircumflex ycircumflexZacutezacute Zdotaccent zdotaccentlongsuni0180uni0181uni0182uni0183uni0184uni0185uni0186uni0187uni0188uni0189uni018Auni018Buni018Cuni018Duni018Euni018Funi0190uni0191uni0193uni0194uni0195uni0196uni0197uni0198uni0199uni019Auni019Buni019Cuni019Duni019Euni019FOhornohornuni01A2uni01A3uni01A4uni01A5uni01A6uni01A7uni01A8uni01A9uni01AAuni01ABuni01ACuni01ADuni01AEUhornuhornuni01B1uni01B2uni01B3uni01B4uni01B5uni01B6uni01B7uni01B8uni01B9uni01BAuni01BBuni01BCuni01BDuni01BEuni01BFuni01C0uni01C1uni01C2uni01C3uni01C4uni01C5uni01C6uni01C7uni01C8uni01C9uni01CAuni01CBuni01CCuni01CDuni01CEuni01CFuni01D0uni01D1uni01D2uni01D3uni01D4uni01D5uni01D6uni01D7uni01D8uni01D9uni01DAuni01DBuni01DCuni01DDuni01DEuni01DFuni01E0uni01E1uni01E2uni01E3uni01E4uni01E5Gcarongcaronuni01E8uni01E9uni01EAuni01EBuni01ECuni01EDuni01EEuni01EFuni01F0uni01F1uni01F2uni01F3uni01F4uni01F5uni01F6uni01F7uni01F8uni01F9 Aringacute aringacuteAEacuteaeacute Oslashacute oslashacuteuni0200uni0201uni0202uni0203uni0204uni0205uni0206uni0207uni0208uni0209uni020Auni020Buni020Cuni020Duni020Euni020Funi0210uni0211uni0212uni0213uni0214uni0215uni0216uni0217uni0218uni0219uni021Auni021Buni021Cuni021Duni021Euni021Funi0220uni0221uni0222uni0223uni0224uni0225uni0226uni0227uni0228uni0229uni022Auni022Buni022Cuni022Duni022Euni022Funi0230uni0231uni0232uni0233uni0234uni0235uni0236uni0237uni0238uni0239uni023Auni023Buni023Cuni023Duni023Euni023Funi0240uni0241uni0242uni0243uni0244uni0245uni0246uni0247uni0248uni0249uni024Auni024Buni024Cuni024Duni024Euni024Funi0250uni0251uni0252uni0253uni0254uni0255uni0256uni0257uni0258uni0259uni025Auni025Buni025Cuni025Duni025Euni025Funi0260uni0261uni0262uni0263uni0264uni0265uni0266uni0267uni0268uni0269uni026Auni026Buni026Cuni026Duni026Euni026Funi0270uni0271uni0272uni0273uni0274uni0275uni0276uni0277uni0278uni0279uni027Auni027Buni027Cuni027Duni027Euni027Funi0280uni0281uni0282uni0283uni0284uni0285uni0286uni0287uni0288uni0289uni028Auni028Buni028Cuni028Duni028Euni028Funi0290uni0291uni0292uni0293uni0294uni0295uni0296uni0297uni0298uni0299uni029Auni029Buni029Cuni029Duni029Euni029Funi02A0uni02A1uni02A2uni02A3uni02A4uni02A5uni02A6uni02A7uni02A8uni02A9uni02AAuni02ABuni02ACuni02ADuni02AEuni02AFuni02B0uni02B1uni02B2uni02B3uni02B4uni02B5uni02B6uni02B7uni02B8uni02B9uni02BAuni02BBuni02BCuni02BDuni02BEuni02BFuni02C4uni02C8uni02C9uni02CAuni02CBuni02CCuni02CDuni02CEuni02CFuni02D0uni02D1uni02DEuni02E0uni02E1uni02E2uni02E3uni02F7 gravecomb acutecombuni0302 tildecombuni0304uni0305uni0306uni0307uni0308 hookabovecombuni030Auni030Buni030Cuni030Duni030Euni030Funi0310uni0311uni0312uni0313uni0314uni0315uni0316uni0317uni0318uni0319uni031Auni031Buni031Cuni031Duni031Euni031Funi0320uni0321uni0322 dotbelowcombuni0324uni0325uni0326uni0327uni0328uni0329uni032Auni032Buni032Cuni032Duni032Euni032Funi0330uni0331uni0332uni0333uni0334uni0335uni0336uni0337uni0338uni0339uni033Auni033Buni033Cuni033Duni033Euni0340uni0341uni0342uni0343uni0344uni0345uni0351uni0353uni0357uni035Duni0361uni0364uni0374uni037Auni037Etonos dieresistonos Alphatonos anoteleia EpsilontonosEtatonos Iotatonos Omicrontonos Upsilontonos OmegatonosiotadieresistonosAlphaBetaGammauni0394EpsilonZetaEtaThetaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonPhiChiPsiuni03A9 IotadieresisUpsilondieresis alphatonos epsilontonosetatonos iotatonosupsilondieresistonosalphabetagammadeltaepsilonzetaetathetaiotakappalambdauni03BCnuxiomicronrhosigma1sigmatauupsilonphichipsiomega iotadieresisupsilondieresis omicrontonos upsilontonos omegatonostheta1Upsilon1uni03D3uni03D4phi1omega1uni03D9uni03DBuni03DCuni03DDuni03E1uni03F0uni03F1uni03F2uni03F9uni03FBuni0400uni0401uni0402uni0403uni0404uni0405uni0406uni0407uni0408uni0409uni040Auni040Buni040Cuni040Duni040Euni040Funi0410uni0411uni0412uni0413uni0414uni0415uni0416uni0417uni0418uni0419uni041Auni041Buni041Cuni041Duni041Euni041Funi0420uni0421uni0422uni0423uni0424uni0425uni0426uni0427uni0428uni0429uni042Auni042Buni042Cuni042Duni042Euni042Funi0430uni0431uni0432uni0433uni0434uni0435uni0436uni0437uni0438uni0439uni043Auni043Buni043Cuni043Duni043Euni043Funi0440uni0441uni0442uni0443uni0444uni0445uni0446uni0447uni0448uni0449uni044Auni044Buni044Cuni044Duni044Euni044Funi0450uni0451uni0452uni0453uni0454uni0455uni0456uni0457uni0458uni0459uni045Auni045Buni045Cuni045Duni045Euni045Funi0462uni0463uni0470uni0472uni0473uni0474uni0475uni0476uni0477uni0490uni0491uni04AEuni04AFuni04B0uni04B1uni04C0uni04C1uni04C2uni04D0uni04D1uni04D2uni04D3uni04D4uni04D5uni04D6uni04D7uni04D8uni04D9uni04DAuni04DBuni04DCuni04DDuni04DEuni04DFuni04E0uni04E1uni04E2uni04E3uni04E4uni04E5uni04E6uni04E7uni04E8uni04E9uni04EAuni04EBuni04ECuni04EDuni04EEuni04EFuni04F0uni04F1uni04F2uni04F3uni04F4uni04F5uni04F8uni04F9uni0510uni0511uni051Auni051Buni051Cuni051Duni1D00uni1D01uni1D02uni1D04uni1D05uni1D06uni1D07uni1D0Auni1D0Buni1D0Cuni1D0Duni1D0Funi1D18uni1D1Buni1D1Cuni1D20uni1D21uni1D22uni1D26uni1D27uni1D28uni1D29uni1D2Auni1D2Cuni1D2Duni1D2Euni1D30uni1D31uni1D33uni1D34uni1D35uni1D36uni1D37uni1D38uni1D39uni1D3Auni1D3Cuni1D3Euni1D3Funi1D40uni1D41uni1D42uni1D43uni1D47uni1D48uni1D49uni1D4Auni1D4Duni1D4Funi1D50uni1D51uni1D52uni1D56uni1D57uni1D58uni1D5Buni1D62uni1D63uni1D64uni1D65uni1D9Cuni1DA0uni1DBBuni1DC4uni1DD3uni1E00uni1E01uni1E02uni1E03uni1E04uni1E05uni1E06uni1E07uni1E08uni1E09uni1E0Auni1E0Buni1E0Cuni1E0Duni1E0Euni1E0Funi1E10uni1E11uni1E12uni1E13uni1E14uni1E15uni1E16uni1E17uni1E18uni1E19uni1E1Auni1E1Buni1E1Cuni1E1Duni1E1Euni1E1Funi1E20uni1E21uni1E22uni1E23uni1E24uni1E25uni1E26uni1E27uni1E28uni1E29uni1E2Auni1E2Buni1E2Cuni1E2Duni1E2Euni1E2Funi1E30uni1E31uni1E32uni1E33uni1E34uni1E35uni1E36uni1E37uni1E38uni1E39uni1E3Auni1E3Buni1E3Cuni1E3Duni1E3Euni1E3Funi1E40uni1E41uni1E42uni1E43uni1E44uni1E45uni1E46uni1E47uni1E48uni1E49uni1E4Auni1E4Buni1E4Cuni1E4Duni1E4Euni1E4Funi1E50uni1E51uni1E52uni1E53uni1E54uni1E55uni1E56uni1E57uni1E58uni1E59uni1E5Auni1E5Buni1E5Cuni1E5Duni1E5Euni1E5Funi1E60uni1E61uni1E62uni1E63uni1E64uni1E65uni1E66uni1E67uni1E68uni1E69uni1E6Auni1E6Buni1E6Cuni1E6Duni1E6Euni1E6Funi1E70uni1E71uni1E72uni1E73uni1E74uni1E75uni1E76uni1E77uni1E78uni1E79uni1E7Auni1E7Buni1E7Cuni1E7Duni1E7Euni1E7FWgravewgraveWacutewacute Wdieresis wdieresisuni1E86uni1E87uni1E88uni1E89uni1E8Auni1E8Buni1E8Cuni1E8Duni1E8Euni1E8Funi1E90uni1E91uni1E92uni1E93uni1E94uni1E95uni1E96uni1E97uni1E98uni1E99uni1E9Auni1E9Buni1E9Cuni1E9Duni1E9Euni1E9Funi1EA0uni1EA1uni1EA2uni1EA3uni1EA4uni1EA5uni1EA6uni1EA7uni1EA8uni1EA9uni1EAAuni1EABuni1EACuni1EADuni1EAEuni1EAFuni1EB0uni1EB1uni1EB2uni1EB3uni1EB4uni1EB5uni1EB6uni1EB7uni1EB8uni1EB9uni1EBAuni1EBBuni1EBCuni1EBDuni1EBEuni1EBFuni1EC0uni1EC1uni1EC2uni1EC3uni1EC4uni1EC5uni1EC6uni1EC7uni1EC8uni1EC9uni1ECAuni1ECBuni1ECCuni1ECDuni1ECEuni1ECFuni1ED0uni1ED1uni1ED2uni1ED3uni1ED4uni1ED5uni1ED6uni1ED7uni1ED8uni1ED9uni1EDAuni1EDBuni1EDCuni1EDDuni1EDEuni1EDFuni1EE0uni1EE1uni1EE2uni1EE3uni1EE4uni1EE5uni1EE6uni1EE7uni1EE8uni1EE9uni1EEAuni1EEBuni1EECuni1EEDuni1EEEuni1EEFuni1EF0uni1EF1Ygraveygraveuni1EF4uni1EF5uni1EF6uni1EF7uni1EF8uni1EF9uni1EFAuni1EFBuni1EFCuni1EFDuni1EFEuni1EFFuni1F00uni1F01uni1F02uni1F03uni1F04uni1F05uni1F06uni1F07uni1F08uni1F09uni1F0Auni1F0Buni1F0Cuni1F0Duni1F0Euni1F0Funi1F10uni1F11uni1F12uni1F13uni1F14uni1F15uni1F18uni1F19uni1F1Auni1F1Buni1F1Cuni1F1Duni1F20uni1F21uni1F22uni1F23uni1F24uni1F25uni1F26uni1F27uni1F28uni1F29uni1F2Auni1F2Buni1F2Cuni1F2Duni1F2Euni1F2Funi1F30uni1F31uni1F32uni1F33uni1F34uni1F35uni1F36uni1F37uni1F38uni1F39uni1F3Auni1F3Buni1F3Cuni1F3Duni1F3Euni1F3Funi1F40uni1F41uni1F42uni1F43uni1F44uni1F45uni1F48uni1F49uni1F4Auni1F4Buni1F4Cuni1F4Duni1F50uni1F51uni1F52uni1F53uni1F54uni1F55uni1F56uni1F57uni1F59uni1F5Buni1F5Duni1F5Funi1F60uni1F61uni1F62uni1F63uni1F64uni1F65uni1F66uni1F67uni1F68uni1F69uni1F6Auni1F6Buni1F6Cuni1F6Duni1F6Euni1F6Funi1F70uni1F71uni1F72uni1F73uni1F74uni1F75uni1F76uni1F77uni1F78uni1F79uni1F7Auni1F7Buni1F7Cuni1F7Duni1F80uni1F81uni1F82uni1F83uni1F84uni1F85uni1F86uni1F87uni1F88uni1F89uni1F8Auni1F8Buni1F8Cuni1F8Duni1F8Euni1F8Funi1F90uni1F91uni1F92uni1F93uni1F94uni1F95uni1F96uni1F97uni1F98uni1F99uni1F9Auni1F9Buni1F9Cuni1F9Duni1F9Euni1F9Funi1FA0uni1FA1uni1FA2uni1FA3uni1FA4uni1FA5uni1FA6uni1FA7uni1FA8uni1FA9uni1FAAuni1FABuni1FACuni1FADuni1FAEuni1FAFuni1FB0uni1FB1uni1FB2uni1FB3uni1FB4uni1FB6uni1FB7uni1FB8uni1FB9uni1FBAuni1FBBuni1FBCuni1FBDuni1FBEuni1FBFuni1FC0uni1FC1uni1FC2uni1FC3uni1FC4uni1FC6uni1FC7uni1FC8uni1FC9uni1FCAuni1FCBuni1FCCuni1FCDuni1FCEuni1FCFuni1FD0uni1FD1uni1FD2uni1FD3uni1FD6uni1FD7uni1FD8uni1FD9uni1FDAuni1FDBuni1FDDuni1FDEuni1FDFuni1FE0uni1FE1uni1FE2uni1FE3uni1FE4uni1FE5uni1FE6uni1FE7uni1FE8uni1FE9uni1FEAuni1FEBuni1FECuni1FEDuni1FEEuni1FEFuni1FF2uni1FF3uni1FF4uni1FF6uni1FF7uni1FF8uni1FF9uni1FFAuni1FFBuni1FFCuni1FFDuni1FFEuni2000uni2001uni2002uni2003uni2004uni2005uni2006uni2007uni2008uni2009uni200Auni200Buni200Cuni200Duni200Euni200Funi2010uni2011 figuredashuni2015uni2016onedotenleadertwodotenleaderuni2027uni202Aminuteseconduni2034uni2035uni2036uni2037 exclamdbluni203Duni203Euni2047uni2048uni2049uni204Buni204Euni2057uni2060uni2070uni2071uni2074uni2075uni2076uni2077uni2078uni2079uni207Auni207Buni207Cuni207Duni207Euni207Funi2080uni2081uni2082uni2083uni2084uni2085uni2086uni2087uni2088uni2089uni208Auni208Buni208Cuni208Duni208Euni2090uni2091uni2092uni2093uni2094uni2095uni2096uni2097uni2098uni2099uni209Auni209Buni209Cuni20A5uni20A8dongEurouni20B2uni20B9uni2100uni2101uni2103uni2105uni2106uni2109uni210Euni2112uni2113uni2116 prescriptionuni211Funi2120uni2123uni2127uni212Auni212Buni2139uni214Buni2150uni2160uni2161uni2162uni2163uni2164uni2165uni2166uni2167uni2168uni2169uni216Auni216Buni216Cuni216Duni216Euni216Funi2170uni2171uni2172uni2173uni2174uni2175uni2176uni2177uni2178uni2179uni217Auni217Buni217Cuni217Duni217Euni217F arrowleftarrowup arrowright arrowdown arrowboth arrowupdnuni2196uni2197uni2198uni2199uni219Euni219Funi21A0uni21A1uni21A2 arrowdblleft arrowdblup arrowdblright arrowdbldownuni21DAuni21DBuni21DCuni21DDgradientuni2210uni2213uni2215uni2216uni2219uni2223uni2224uni2225uni2226uni2236similaruni2241uni226Auni226Buni226Euni226Fdotmathuni22EFuni2303 angleleft anglerightuni2474uni2475uni2476uni2477uni2478uni2479uni247Auni247Buni247Cuni247Duni247Euni247Funi2480uni2481uni2482uni2483uni2484uni2485uni2486uni2487uni2488uni2489uni248Auni248Buni248Cuni248Duni248Euni248Funi2490uni2491uni2492uni2493uni2494uni2495uni2496uni2497uni2498uni2499uni249Auni249Buni249Cuni249Duni249Euni249Funi24A0uni24A1uni24A2uni24A3uni24A4uni24A5uni24A6uni24A7uni24A8uni24A9uni24AAuni24ABuni24ACuni24ADuni24AEuni24AFuni24B0uni24B1uni24B2uni24B3uni24B4uni24B5 openbulletuni2619uni261Cuni261Duni261Euni267Euni270Auni270Buni270Cuni2753uni2757uni2766uni2767uni27E8uni27E9uni27EAuni27EBuni2A74uni2A75uni2A76uni2B45uni2B46uni2C60uni2C61uni2C62uni2C63uni2C64uni2C65uni2C66uni2C67uni2C68uni2C69uni2C6Auni2C6Buni2C6Cuni2C6Duni2C6Euni2C6Funi2C70uni2C71uni2C72uni2C73uni2C74uni2C75uni2C76uni2C77uni2C78uni2C79uni2C7Auni2C7Buni2C7Cuni2C7Duni2C7Euni2C7Funi2E18uni2E22uni2E23uni2E24uni2E25uni2E28uni2E29uni2E2Euni2E3Auni2E3Buni3003uni3008uni3009uni300Auni300BuniA726uniA727uniA728uniA729uniA72AuniA72BuniA72CuniA72DuniA72EuniA72FuniA730uniA731uniA742uniA743uniA749uniA751uniA753uniA757uniA759uniA76BuniA78DuniA78EuniA7AAuniA7FBuniA7FCuniA7FDuniA7FEuniA7FFuniE001uniE002uniE8BFuniF6BEuniFB00uniFB01uniFB02uniFB03uniFB04uniFB05uniFB06uniFEFFuniFFFDu1F1E6u1F1E7u1F1E8u1F1E9u1F1EAu1F1EBu1F1ECu1F1EDu1F1EEu1F1EFu1F1F0u1F1F1u1F1F2u1F1F3u1F1F4u1F1F5u1F1F6u1F1F7u1F1F8u1F1F9u1F1FAu1F1FBu1F1FCu1F1FDu1F1FEu1F1FFu1F44Cu1F44D Adieresis.deu Odieresis.deu Udieresis.deu uni030C.cap uni0302.cap uni0302.flat uni030C.flat acutecomb.cap gravecomb.cap uni030C.alt1 tildecomb.cap uni0306.cap uni0308.cap uni030B.cap uni0304.capquotesingle.alt uni0311.cap uni030A.cap uni0307.cap longs_longs_l longs_longs_ilongs_ilongs_longs.longlongs_lT_hc_hc_kone.lnumtwo.lnum three.lnum four.lnum five.lnumsix.lnum seven.lnum eight.lnum nine.lnum zero.lnumlongs_sgermandbls.altc_t uni0327.cap uni0328.capf_f.longt_tt_z.altL.scriptQ.longi.TRKscf.longzero.taboldstyleone.taboldstyletwo.taboldstylethree.taboldstylefour.taboldstylefive.taboldstylesix.taboldstyleseven.taboldstyleeight.taboldstylenine.taboldstyle one.tablining two.tabliningthree.tabliningfour.tabliningfive.tablining six.tabliningseven.tabliningeight.tabliningnine.tabliningzero.tabliningEuro.tabliningf_hf_kf_bf_tf_jlongs_jlongs_blongs_hlongs_k longs.long longs_longs u.LATmedii.TRKU.LAT bullet.01 bullet.03 bullet.02f.DEU exclam.subs quotedbl.subsnumbersign.subs dollar.subs percent.subsampersand.subsquotesingle.subsparenleft.subsparenright.subs asterisk.subs plus.subs comma.subs hyphen.subs period.subs slash.subs zero.subsone.substwo.subs three.subs four.subs five.subssix.subs seven.subs eight.subs nine.subs colon.subssemicolon.subs less.subs equal.subs greater.subs question.subsat.subsA.subsB.subsC.subsD.subsE.subsF.subsG.subsH.subsI.subsJ.subsK.subsL.subsM.subsN.subsO.subsP.subsQ.subsR.subsS.subsT.subsU.subsV.subsW.subsX.subsY.subsZ.subsbracketleft.subsbackslash.subsbracketright.subsasciicircum.subsunderscore.subs grave.subsa.subsb.subsc.subsd.subse.subsf.subsg.subsh.subsi.subsj.subsk.subsl.subsm.subsn.subso.subsp.subsq.subsr.subss.subst.subsu.subsv.subsw.subsx.subsy.subsz.subsbraceleft.subsbar.subsbraceright.subsasciitilde.subsbrokenbar.subs section.subsparagraph.subs egrave.subs uni2016.subs dagger.subsdaggerdbl.subs exclam.sinf quotedbl.sinfnumbersign.sinf dollar.sinf percent.sinfampersand.sinfquotesingle.sinfparenleft.sinfparenright.sinf asterisk.sinf plus.sinf comma.sinf hyphen.sinf period.sinf slash.sinf zero.sinfone.sinftwo.sinf three.sinf four.sinf five.sinfsix.sinf seven.sinf eight.sinf nine.sinf colon.sinfsemicolon.sinf less.sinf equal.sinf greater.sinf question.sinfat.sinfA.sinfB.sinfC.sinfD.sinfE.sinfF.sinfG.sinfH.sinfI.sinfJ.sinfK.sinfL.sinfM.sinfN.sinfO.sinfP.sinfQ.sinfR.sinfS.sinfT.sinfU.sinfV.sinfW.sinfX.sinfY.sinfZ.sinfbracketleft.sinfbackslash.sinfbracketright.sinfasciicircum.sinfunderscore.sinf grave.sinfa.sinfb.sinfc.sinfd.sinfe.sinff.sinfg.sinfh.sinfi.sinfj.sinfk.sinfl.sinfm.sinfn.sinfo.sinfp.sinfq.sinfr.sinfs.sinft.sinfu.sinfv.sinfw.sinfx.sinfy.sinfz.sinfbraceleft.sinfbar.sinfbraceright.sinfasciitilde.sinfbrokenbar.sinf section.sinfparagraph.sinf egrave.sinf uni2016.sinf dagger.sinfdaggerdbl.sinf exclam.ordn quotedbl.ordnnumbersign.ordn dollar.ordn percent.ordnampersand.ordnquotesingle.ordnparenleft.ordnparenright.ordn asterisk.ordn plus.ordn comma.ordn hyphen.ordn period.ordn slash.ordn zero.ordnone.ordntwo.ordn three.ordn four.ordn five.ordnsix.ordn seven.ordn eight.ordn nine.ordn colon.ordnsemicolon.ordn less.ordn equal.ordn greater.ordn question.ordnat.ordnA.ordnB.ordnC.ordnD.ordnE.ordnF.ordnG.ordnH.ordnI.ordnJ.ordnK.ordnL.ordnM.ordnN.ordnO.ordnP.ordnQ.ordnR.ordnS.ordnT.ordnU.ordnV.ordnW.ordnX.ordnY.ordnZ.ordnbracketleft.ordnbackslash.ordnbracketright.ordnasciicircum.ordnunderscore.ordn grave.ordna.ordnb.ordnc.ordnd.ordne.ordnf.ordng.ordnh.ordni.ordnj.ordnk.ordnl.ordnm.ordnn.ordno.ordnp.ordnq.ordnr.ordns.ordnt.ordnu.ordnv.ordnw.ordnx.ordny.ordnz.ordnbraceleft.ordnbar.ordnbraceright.ordnasciitilde.ordnbrokenbar.ordn section.ordnparagraph.ordn egrave.ordn uni2016.ordn dagger.ordndaggerdbl.ordn exclam.sups quotedbl.supsnumbersign.sups dollar.sups percent.supsampersand.supsquotesingle.supsparenleft.supsparenright.sups asterisk.sups plus.sups comma.sups hyphen.sups period.sups slash.sups zero.supsone.supstwo.sups three.sups four.sups five.supssix.sups seven.sups eight.sups nine.sups colon.supssemicolon.sups less.sups equal.sups greater.sups question.supsat.supsA.supsB.supsC.supsD.supsE.supsF.supsG.supsH.supsI.supsJ.supsK.supsL.supsM.supsN.supsO.supsP.supsQ.supsR.supsS.supsT.supsU.supsV.supsW.supsX.supsY.supsZ.supsbracketleft.supsbackslash.supsbracketright.supsasciicircum.supsunderscore.sups grave.supsa.supsb.supsc.supsd.supse.supsf.supsg.supsh.supsi.supsj.supsk.supsl.supsm.supsn.supso.supsp.supsq.supsr.supss.supst.supsu.supsv.supsw.supsx.supsy.supsz.supsbraceleft.supsbar.supsbraceright.supsasciitilde.supsbrokenbar.sups section.supsparagraph.sups egrave.sups uni2016.sups dagger.supsdaggerdbl.sups exclam.sc quotedbl.sc numbersign.sc dollar.sc percent.sc ampersand.scquotesingle.sc parenleft.sc parenright.sc asterisk.scplus.sccomma.sc hyphen.sc period.scslash.sczero.scone.sctwo.scthree.scfour.scfive.scsix.scseven.sceight.scnine.sccolon.sc semicolon.scless.scequal.sc greater.sc question.scat.scA.scB.scC.scD.scE.scF.scG.scH.scI.scJ.scK.scL.scM.scN.scO.scP.scQ.scR.scS.scT.scU.scV.scW.scX.scY.scZ.scbracketleft.sc backslash.scbracketright.scasciicircum.sc underscore.scgrave.sca.scb.scc.scd.sce.scf.scg.sch.sci.scj.sck.scl.scm.scn.sco.scp.scq.scr.scs.sct.scu.scv.scw.scx.scy.scz.sc braceleft.scbar.sc braceright.sc asciitilde.sc exclamdown.sccent.sc sterling.sc currency.scyen.sc brokenbar.sc section.sc dieresis.sc copyright.scordfeminine.scguillemotleft.sc logicalnot.sc uni00AD.sc registered.sc macron.sc degree.sc plusminus.scacute.sc paragraph.scperiodcentered.sc uni0327.scordmasculine.scguillemotright.scquestiondown.sc Agrave.sc Aacute.scAcircumflex.sc Atilde.sc Adieresis.scAring.scAE.sc Ccedilla.sc Egrave.sc Eacute.scEcircumflex.sc Edieresis.sc Igrave.sc Iacute.scIcircumflex.sc Idieresis.scEth.sc Ntilde.sc Ograve.sc Oacute.scOcircumflex.sc Otilde.sc Odieresis.sc multiply.sc Oslash.sc Ugrave.sc Uacute.scUcircumflex.sc Udieresis.sc Yacute.scThorn.sc germandbls.sc agrave.sc aacute.scacircumflex.sc atilde.sc adieresis.scaring.scae.sc ccedilla.sc egrave.sc eacute.scecircumflex.sc edieresis.sc igrave.sc iacute.scicircumflex.sc idieresis.sceth.sc ntilde.sc ograve.sc oacute.scocircumflex.sc otilde.sc odieresis.sc divide.sc oslash.sc ugrave.sc uacute.scucircumflex.sc udieresis.sc yacute.scthorn.sc ydieresis.sc Amacron.sc amacron.sc Abreve.sc abreve.sc Aogonek.sc aogonek.sc Cacute.sc cacute.scCcircumflex.scccircumflex.sc Cdotaccent.sc cdotaccent.sc Ccaron.sc ccaron.sc Dcaron.sc dcaron.sc Dcroat.sc dcroat.sc Emacron.sc emacron.sc Ebreve.sc ebreve.sc Edotaccent.sc edotaccent.sc Eogonek.sc eogonek.sc Ecaron.sc ecaron.scGcircumflex.scgcircumflex.sc Gbreve.sc gbreve.sc Gdotaccent.sc gdotaccent.sc uni0122.sc uni0123.scHcircumflex.schcircumflex.scHbar.schbar.sc Itilde.sc itilde.sc Imacron.sc imacron.sc Ibreve.sc ibreve.sc Iogonek.sc iogonek.sc Idotaccent.sc dotlessi.scIJ.scij.scJcircumflex.scjcircumflex.sc uni0136.sc uni0137.sckgreenlandic.sc Lacute.sc lacute.sc uni013B.sc uni013C.sc Lcaron.sc lcaron.scLdot.scldot.sc Lslash.sc lslash.sc Nacute.sc nacute.sc uni0145.sc uni0146.sc Ncaron.sc ncaron.scnapostrophe.scEng.sceng.sc Omacron.sc omacron.sc Obreve.sc obreve.scOhungarumlaut.scohungarumlaut.scOE.scoe.sc Racute.sc racute.sc uni0156.sc uni0157.sc Rcaron.sc rcaron.sc Sacute.sc sacute.scScircumflex.scscircumflex.sc Scedilla.sc scedilla.sc Scaron.sc scaron.sc uni0162.sc uni0163.sc Tcaron.sc tcaron.scTbar.sctbar.sc Utilde.sc utilde.sc Umacron.sc umacron.sc Ubreve.sc ubreve.scUring.scuring.scUhungarumlaut.scuhungarumlaut.sc Uogonek.sc uogonek.scWcircumflex.scwcircumflex.scYcircumflex.scycircumflex.sc Ydieresis.sc Zacute.sc zacute.sc Zdotaccent.sc zdotaccent.sc Zcaron.sc zcaron.sclongs.scf_f_bf_f_hf_f_jf_f_kf_f_t longs_longs_b longs_longs_h longs_longs_j longs_longs_k longs_longs_tv.LATu.LAT v.LATmedi uni0306.cyruni0306.cyrcap uni0431.SRB uni0434.alt uni043B.alt uni0459.alt uni0414.alt uni041B.alt uni0409.altgravecomb.stackacutecomb.stack uni0302.stacktildecomb.stack uni0304.stack uni0306.stack uni0307.stackhookabovecomb.stack uni030A.stack uni030C.stackgravecomb.flatacutecomb.flat uni0316.cap uni0317.capdotbelowcomb.cap uni0324.cap uni0325.cap uni032C.cap uni032D.cap uni032E.cap uni032F.cap uni0330.cap uni0331.cap uni030F.capat.01J.histj.hist quoteright.01U.LATscu.LATscone.01one.taboldstyle01Q_yQ.shortQ.lowq.longsc uni2619.01 uni2767.01 paragraph.01 f_f.short uni1E1F.short uni1E9D.short longs.short uni1E9B.shortlongs_longs.short uni1E9C.shortf.shortguilsinglleft.altguilsinglright.altguillemotleft.altguillemotright.altbeta.ipa gravecomb.grk uni0313.grk uni0314.grk uni0342.altgravecomb.grkstackuni0308.grkstackuni0313.grkstackuni0314.grkstack acutecomb.grkacutecomb.capstackgravecomb.capstacktildecomb.capstackhookabovecomb.capacutecomb.grkstack space.stack uni0345.cap1 uni0345.cap2 uni0345.sc1 uni0345.capalpha.scbeta.scgamma.scdelta.sc epsilon.sczeta.sceta.sctheta.sciota.sckappa.sc lambda.sc uni03BC.scnu.scxi.sc omicron.scpi.scrho.scsigma.sctau.sc upsilon.scphi.scchi.scpsi.scomega.scAlpha.scBeta.scGamma.sc uni0394.sc Epsilon.scZeta.scEta.scTheta.scIota.scKappa.sc Lambda.scMu.scNu.scXi.sc Omicron.scPi.scRho.scSigma.scTau.sc Upsilon.scPhi.scChi.scPsi.sc uni03A9.scf_ff_if_lf_f_if_f_llongs_ts_tgermandbls.sc1 sigma1.sc gravecomb.sc acutecomb.sc uni0302.sc tildecomb.sc uni0304.sc uni0306.sc uni0307.sc uni0308.schookabovecomb.sc uni030A.sc uni030B.sc uni030C.sc uni0311.sc uni0312.sc uni0313.sc uni0314.sc uni0315.sc uni0342.sc uni0345.scgravecomb.stackscacutecomb.stackscuni0302.stacksctildecomb.stackscuni0304.stackscuni0306.stackscuni0307.stackschookabovecomb.stackscuni030A.stackscuni030C.stackscgravecomb.grksc uni0313.grksc uni0314.grksc uni0342.altscgravecomb.grkstackscuni0308.grkstackscuni0313.grkstackscuni0314.grkstackscacutecomb.grkscacutecomb.grkstacksc alphatonos.scepsilontonos.sc etatonos.sc iotatonos.scomicrontonos.scupsilontonos.sc omegatonos.sciotadieresistonos.sciotadieresis.scupsilondieresis.scupsilondieresistonos.sc Alphatonos.scEpsilontonos.sc Etatonos.sc Iotatonos.scOmicrontonos.scUpsilontonos.sc Omegatonos.scIotadieresis.scUpsilondieresis.sc uni2010.cap uni2011.capfiguredash.cap endash.cap emdash.cap hyphen.capgermandbls.alt1germandbls.alt2germandbls.sc2 q_uniA76Bregistered.supsa.01g.01periodcentered.CATperiodcentered.CATucperiodcentered.CATsc j.dotless i.dotlessh.01k.01hcircumflex.01 uni01E9.01 uni021F.01 uni1E23.01 uni1E27.01 uni1E31.01 uni019F.alt uni0275.altf._ff._if._ascb.f_h.f_k.f_l.f_t.f_thorn.f_ longs._longs longs._asclongs._i theta.ipa lambda.ipachi.ipa uni030C.altuni030C.altcap1uni030C.altcap u1F1EC_u1F1E7 u1F1EB_u1F1F7 u1F1EA_u1F1F8 u1F1E8_u1F1F3 u1F1F3_u1F1F4A.pcB.pcC.pcD.pcE.pcF.pcG.pcH.pcI.pcJ.pcK.pcL.pcM.pcN.pcO.pcP.pcQ.pcR.pcS.pcT.pcU.pcV.pcW.pcX.pcY.pcZ.pca.pcb.pcc.pcd.pce.pcf.pcg.pch.pci.pcj.pck.pcl.pcm.pcn.pco.pcp.pcq.pcr.pcs.pct.pcu.pcv.pcw.pcx.pcy.pcz.pce.xtex1e.xtex2e.xtex3chi.a1chi.a2chi.a3chi.a4chi.a5chi.a6chi.a7chi.a8 uni2C60.ref1 uni2C61.ref1 uni2C7A.ref1 uni2C7E.ref1 uniA728.ref1 uniA72E.ref1 uniA72F.ref1RR((OORR, UXEY (`f UX%aEc#b!!YC#DC`B-, `f-, d P&Z( CEER[X!#!X PPX!@Y 8PX!8YY CEEad(PX! CEE 0PX!0Y PX f a PX` PX! ` 6PX!6``YYY+YY#PXeYY-, E %ad CPX#B#B!!Y`-,#!#! dbB #B CE CE`E*! C +0%QX`PaRYX#Y! @SX+!@Y#PXeY-,C+C`B-,#B# #Babfc`*-, E Ccb PX@`Yfc`D`-, CEB*!C`B- ,C#DC`B- , E +#C%` E#a d PX!0PX @YY#PXeY%#aDD`- , #B *!- ,EaD- ,` CJPX #BY CJRX #BY-, bfc c#a C` ` #B#-,KTXDY$ e#x-,KQXKSXDY!Y$e#x-,CUXCaB+YC%B %B %B# %PXC`%B #a *!#a #a *!C`%B%a *!Y CG CG`b PX@`Yfc Ccb PX@`Yfc`#DC>C`B-,ETX#B E #B #E`B `a BB`+q+"Y-,+-,+-,+-,+-,+-,+-,+-,+-,+-, +-, +ETX#B E #B #E`B `a BB`+q+"Y-,+-,+- ,+-!,+-",+-#,+-$,+-%,+-&,+-', +-(, <`-), `` C#`C%a`(*!-*,)+)*-+, G Ccb PX@`Yfc`#a8# UX G Ccb PX@`Yfc`#a8!Y-,,ETX+*0"Y--, +ETX+*0"Y-., 5`-/,Ecb PX@`Yfc+ Ccb PX@`Yfc+D>#8.*-0, < G Ccb PX@`Yfc`Ca8-1,.<-2, < G Ccb PX@`Yfc`CaCc8-3,% . G#B%IG#G#a Xb!Y#B2*-4,%%G#G#aE+e.# <8-5,%% .G#G#a #BE+ `PX @QX  &YBB# C #G#G#a#F`Cb PX@`Yfc` + a C`d#CadPXCaC`Y%b PX@`Yfca# &#Fa8#CF%CG#G#a` Cb PX@`Yfc`# +#C`+%a%b PX@`Yfc&a %`d#%`dPX!#!Y# &#Fa8Y-6, & .G#G#a#<8-7, #B F#G+#a8-8,%%G#G#aTX. <#!%%G#G#a %%G#G#a%%I%aEc# Xb!Ycb PX@`Yfc`#.# <8#!Y-9, C .G#G#a ` `fb PX@`Yfc# <8-:,# .F%FRX ,5+ <#B8# .F%FRX +-^,>+-_,>+-`,>+-a,6+.*+-b,6+:+-c,6+;+-d,6+<+-e,7+.*+-f,7+:+-g,7+;+-h,7+<+-i,8+.*+-j,8+:+-k,8+;+-l,8+<+-m,9+.*+-n,9+:+-o,9+;+-p,9+<+-q,+e$Px0-KRXYc #D#pDBE1*B8$*BB.* B9% * B *:& *D$QX@XD&QX@cTXDYYYYDPK!G}$mdc/resources/futura-book-italic.ttfpOS/2`[NPCLTH`+6cmap}@^cvt 2fpgm8 8glyf kjhead ,6hheaOd$hmtxSy0kernl͸loca5pZ maxpTt nameGposth;CprepՆL-8$ !\}8 p : R Bh * p &DFuturaBook ItalicFuturaBT-BookItalicCopyright 1990-1993 Bitstream Inc. All rights reserved.Futura Book Italic, Geometric 211Futura Book Italic BTmfgpctt-v1.54 Tuesday, February 9, 1993 8:11:58 am (EST)Copyright 1990-1993 Bitstream Inc. All rights reserved.Futura Bk BTBook ItalicFutura Book Italic, Geometric 211Futura Book Italic BTmfgpctt-v1.54 Tuesday, February 9, 1993 8:11:58 am (EST)FuturaBT-BookItalicuNu)Rf3h  hJ)!HmjmP5P`XR=sDfhBuwoZs'){'^u)u'y'!L- fu-fw!'bmjPR5sP XZh)Xy-J {}hhZRywfBuoA;.*#SY&Y@&}}kDYG}} !!.&@YG]AYY  @ @k}a.a@.>>D$ |{eA{Szy`&yx wvutsrsrqpoSpoSnmml}kjkkjiYjAji`&iYi@feAffeAd}cbccbaYbba`&aYa@`&\ZYGZZYGXWVUST>PONNLKKGFEDCBA?=<};:k843k0//.--*)*)$#"! ! }K&& A   L}}d++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++@, %Id@QX Y!-,%Id@QX Y!-,  P y PXY%%# P y PXY%-,KPX EDY!-,%E`D-,KSX%%EDY!!-,ED-ff@WXW/10!%!!fsr)} #@ [ Z \  991074632#"&3}C0/A@01B9L/CB01BCFw^q@^]1<20###wu))hP@5 _ _     9122<<22<<220!!!3!!!!#!#!7!!7!_-3+^J++@`+X^b)){{++{{9!w!(/r@D)" * #d*d cf0*)#"  -&&-099991299907&&546773&&'#7&&6654&9:VG\aB,jAD\Am|O>atFky+Mz mcmRVO sOm bKiL} #/3U@/1$!04g*h!g$ g hgf$c43021'-499991990%32654&#"2#"&54632654&#"2#"&5463=@]n=@Zq;@\n;?Zqǀ8d]Y׹[W8^Xع\U95 ;@U<:73 6%&26ll,k6f<:7/&) /  67/%) 3/2 ;7/ )7"<999999999199999076654&#"3267'#"&54677&&54632667B7XAK>GY\ih`;y:=RRbТ;88|1\)i9a1)BX0-E}AoR^oR^ %@p qp    <<1/<<0!!#!5!vu)u'h"@ts 9919901\49y#@ vu9910!!L+^D @ [ Z  1074632#"&^C00CC01B^0CC00BBB@ w\/99103 iRL "@ddcf! !10#"476632%"324&L]UO}[ULRS3EP~wy,iwyәYWwf^=@ dy91/0!!7!ͪ@ V;8@ dcd99991/990!!6676654&#"#6$32!%V Rv yR"[jϲB+Q@+ " +d(xdd c(f, "%,999919990332654&#"732654&#"#6632#"&5B ~np ijФ}z~l}zm~ϼ ,@  dc  91/<290!!533#f+eT-ffJab G@'  dd dyf 999199907732654&#"'!!6632#"&rLT̴NH!n5Z'ٞpPKײ%& bV:@dzd a f 99919906632#"&547"32654&?z=꘬w’|”##"۶Ȕ2dnĘ̝yw#@dy9190'!7!7`/RT  /@@"$ d* ddc*f0$'! !-0991990%2654&#"2654&#"&&54632#"&546~̀mwRdg켼ӗ|o~Zpni}?.a۹Ÿ99@dzd c{ 9991990#"&5432'2654&#"?y>$ꗬnvQÒ}Ôy##ܶ&ɓ:bǘ̜ym! !@[ [| Z 1074632#"&4632#"&mC/0CB10BQC00CC00CL/CC/0CC/BB/0EE! 1@ t [| s  9919904632#"&B00AA00B/BA00CC\4Ly @~}291905fhkgh\@qq<210!5!5RRuuuuLy @~}<919055fg 3\@1!  1* 1l[ l$k Z4 ' . *!'.4999999199990%4632#"&#"&546767654&#"'66323263C00CC01Bet#\NXj"mt-NRCJeL/CC/0CCy"nW yc=JcbWA(toCQcqN[`@7POYL CYS"!YF=%SL%1!PO!"@CV7VI7+\991/<99990733267665!"32$7#"$'&5476$32#"&5465#"&54327&&#"326 :n77-n0Yeysy~eE-wec$f}xETcc3^[}8<nPf^fLy(,.0(L Dhez­cQWa[Bmp]\u6ţ${WQca79NMW[>O?Zdnw )@ \   91/<90##!!`^b qHN4:@#+ !\ ! "+ 4 .( 5991/9032676654&'&&###32676654&'&&###!2#fuig(@G1/ WZ9Jg|-FP74&eh8`879|ZTC?vN<^VCfV'/0S#zs:.&fF5@ llkf    999199990&&#"3267# 476$32goyO[_"al'Xj~}uif]YXT`BG..>7uinOSN/(@ \ 9991/0%3267654&'&&##32!_@x7fFhˠH#ĥ?#RgODN *@ \   91/0%!!!!!s9EJKL $@\  91/03!!!!L9A^K9f ;@llkf  99991990!! 476$32&&# 32$7!jv|wq3yg2,5 oD:slou}N^ '@ \   91/<<033!3#!NKL^`CH+T@\991/033TH-@ lf \  9919990'732673#"&F}S42w"6%\fmBC'4Y>CVN $@ \  91/<290333#NV'foe N!@\91/033!NX +@\   91/<290##FK1L%@\91/99033Li?nhu##@ llkf$ $104#"326766 # 476$~Uag1Y]hKxqЫwuo)4\Vb\X]Q{slu>9qjqN!+@ \!  "9991/032676654&'&&###32###dwpm'CH11!\b5JĠ<@CPN?D?TUAb(03]o<1+}hdq)N@,)&&&ll kf*)##*999199990'# 476$3 7654#"3267TVft~vs.HF{V_j?>y<''>5pmtyi%+Y!.\XaN 8@ \     <9991/<9032676654&##32##dwol)BIN=BERJX+|R|f(04\Z\&K@& l$lk$f'!  ! '9999199990732654&'&&54632&&#"#"& ix.ݤاWWZLRZml)3@ Z  9991990&&#"3267#"&5432hGWʯFQ6W)VMHC೐8A(**.01` 5@ Z  9991/990%2654&#"3#7#"5432􅺑uM͟Bi z.mޥרYU)lm)A@#  Z  99919903267#"&5432'&&#"#Q@nPqwvNRZhg-v|v=!:@"  z  91/<2999903#736632&&#"3#f#{'G$+.86&f ޣ T#H ,R@.# ,#)# z-  , & -99919990%2654&#"3#"&'732677#"&5432u¡\!;>yBh z,yܣԥ))ag]ʪ~YV*kjB8@  ! 99991/<99990336632#67654&#"B̞mFfLHd`~>[[|41 1RV1H !@  z  " 991/04632#"&3A-.??.-AyyD,@?-/@Am B !@  z " 99104632#"&#3A-.??.-A!D,@?-/@A,QB '@ z  91/<903##3% B̞_F@991/03#3̠B,I@,+" ( z ,+"!   %! -99991/<<<2990!6654&#"#366326632#6654&#"yJUSl>zA[\E\uLJUSo}=2*SU1XV[QVV|?1*SU1B8@ z ! 99991/<99990336632#67654&#"BxMdLHd`~>]Y|41 1RV1) #@Z # 10"32654&432#"&%ūĭ|(3߬ޫq/B 9@ Z z   9991990"32654&36632#"&'Nt¡.Cf{,Rݤզ#QZVkl5B 8@Z z  9991990%2654&#"3##"&5432u¡RBg {.mޥا&GZV/lmB.@   z 91/9990&&#"#366326i{:x?M/ P]U 'M@' %%Z(" $"$(9999199990'732654'&'&&54632&&#"#"&f2MVe$V\?`*rFE` \tyQQOCKA ?lR~DCs89O6JI:r\T%J '@ z   91/<203#7333#hg/1gqb<@  Z z !999912999990332673#"&54775f]{p;>!W4ak1JR/ ]7:1 @z9129033k|6 -@ z   912<9033rRPr6c (@ z   91/<290#33##{T49\B#@z9129033 ?dB"/sB!@z91/0#!7!!P)bZ0e@81 %" !/()""!/1 !/' &!%(1<<299991999990"&#"33#"&'&&554&#"#52326554676633ZyVWooWW~'#cy*7-nn-7*xd#F^]}$z{}#?@(10#?~bV0a@6%($( !(*1(+!%&)'$1<2<999919999903263"&#"##5232655467&&554&##5323oo,6'uf)xWWooWX}'#dz*6,X||$}__}#~)@ q q* 1990#"&'&'&#"566323267e]+_59dSyiX8yrWTxsHH HKUIH( :JTZ'$' "T@."   \ # !"+,+ #999991/<9032654&#"4632#"&3#!!}I44II45Hmaba`9>b 5HH54KJ3abbHquf'F'&\N'(s'Lf'1L'huZ'2'}LZ'8'5'D/5'DC/5'D/53'D/5?'D/5 (4W@/(/) )/%zZ(,. 0.2"59999991/99032654&#"4632#"&3#7#"54322654&#"I35JJ54Hm`cc`xBh z.u¡4KK44IH5abamYU)lmޥا)''F))'H)'HC)'H)3'HH1''C7''F3'B?'Q;)'R)'RC)'R)3'R)?'Rb'Xb'XCb'Xb3'XFB )@ \   91<20!7!3!!7oJJoB1ωD7ym  @  121104&#"3262#"&546uTTwwTTuuvvTuuTTvvoutvwR"`@6  #  #9991..9999990%&&54373&&'267###c=j.'1^8pGF'By8-`Eqp *"01i78" u)-K@J<2/ =HK@9 9d@d& ( c@fL)('&" " ,"<=/"K3"L999999999991<29999076676654&'#73&&54326654&#"!66323267#"'&'&'&#")*_3.*& ȿx3{?B#KDpW0`0`ASO 2*YH`5B Lz84rs:о  ] r!AQ$:33oHG150C9? E_@5437 F)2= 7/kF,&) =:4C:4,4&4C42F9991999904&#"326&&54632&&#"#"&55732654&'&&'&&546hf}eqea׬h\_|"%.gnc_ةi^]~"&)ejdlb{+d ajwX)D"L9j1_ůbmvW%D$U:h3! @ 5 104632#"&3{zz{{zzL'@6 691/<20####&&5463!}^`ײyy%!3c@72//)/ &$Z 43%$&2!,499991/<299999903#7376676632#"&'732654&##732654&#"Ph831TѢ&Y3$H%! zqof Ţ316ɨ! ʩt}w3.FO@, /);G  8 75859#7AG299991290#32654&'2###4&'&&#"3267662#"$'&5476$N{hm`j[`Z^놄Y^db\[ꀃ_[aw jfmmhmjinrke)BKOG\ruYwmHL[]a^Z_^\ba]Zdojfejqpkh kglw31II@*   2 2,>J : 78889&7DJ99190&&#"32673#"&546324&'&&#"3267662#"$'&5476$)oSusWu ē״ 3bZ\셄Z]cb\]遁_[_w ifmlgmjjoqjfMWaUv[\`_[_^\bd\Zcnifejqoji  lhmm L@)    <=;< ; <= 9991<<22903#######5R6R}^k66C-C#9@10#3 y#\/ZN3 @  > >1<204632#"&%4632#"&yA),?/)C@,0=>)?@# q q   <291<2<29990!!!!'7!5!!5!^X{;YVssFss@?@( \   91/<90#!!!!!!!!b/%sH#<%^}Cٚm= 7l@<8)$ '*673($l3l$k3f88(*-7 '6 )- 899999999199990&&#"3267654&'7&&5476$327#"&'GrZ]c00LClX`i63JJwt+]TLNwtիVBD_Z]eCXBJdYac>X㊳8qnsSSLX錰qmrVV /D@$ -!' $-'-0 $??*0999919999032654&#"&&#"32676632#"&'#"&546323Xfz[U3Viz[UsC``LG`a/_]nl?__pl튄٤xڣ~)2@ q q    <2<21<<0%!5!!#!5!RvuuuXuX! *@  q  <229190%!55b/buu}e! *@  q   <<29190%!555bb-uueq}CD}=@&    91/<<2<290!!7!'!7!333!!!PNٮ;mEu/ (2@# ) &  BC B)991026732#"&54&#"#"&54632-g  L\>35@ i +)1^I]?4/AKNA0;F9X^rvL;5>:&`!X S@-   k!! DED!999999199990!!73#7#"&54632"32654&ob^X -uI˞Yxnt]`ip/lqN54A2r`wo`u!  9@k  DD EF99102#"&5464&#"326!!ݬ~ck}fkӷ׸fsipdD@#   HGH G 9991/<2990%!5654#"!5!&5! Ly*+yoP4o0Ikυ T3:F@H%($!>4+!  47!(.>DZ.G;A1 :4$%A+:4 1AG9999999912999999903267#"&'#"&546326654&#"566326632'&&#"4&#"326R!Q>nQv6Dˆ۳Z?~JHRZ|!>xwuӈr|}k NRZjgeddc32$?gr))\T[Ys|wM]aWJX^7!+u@?,+"! % %Z,+"!( ( ( #(,.9999999199999990'7&&54327#"&'732654&''&&#"+=(((bJbaWA)toBSd#@[ \Z 9910##"&54632B//CA11@Ry0DE/0A@dZ@ q 10#!5sZ u9o *@    9190##'%w5w  oR}+D\';$Q@.%   $ c%$  %91<2999999990#7376632&&#"3##"&'73267z&J(,2?@\"5"t'%ɲ m޼T$'H@%!$  '!!q$q qq(* (<219999990#"$#"5663232675#"$#"566323267k\bdRjYo}VU}h[ddS}jYo{XW|KGGXIHGWIGHVIHFVV!@91/90%!bDC#JJr#?)/^ :@"    II 991<290+Td:Tb^VDVD/h^ :@"     I I 991<290%'7'7T)dR'c/VDRCcnVDRCc'/''$C'f'$'huf'2'j-Q@1*(!&$ ll&($"\fk*,-,+*)('&%$" ! # .9991/9904#"32676# 476$32!!!!!!zR\f.T^e5\Ƹ~|tq*3H'<:HR3^Wa]Yb[C7sovGӜ)*6^@2 "+ +1 Z%7("4(.79999912<299990&&#"3267#"&'#"&54326632"32654&7yx#Q>nOr7I'߀?F}S¨1{vNRZhggdch,hgfinצۦ@ 9910!!w@ 99107!)ww.@t\99991<290''55\?\2@t\  99991<290% \5@\51@ t\ 991990'13\'@ t\991990\5= ,@[ [ q p JJ <<102#"&546!52#"&546V/DC00CDRX0CC01BDmD//DC00C1uuC/0CC0/C#u"@91990 9%-B3'\sZ'<`'@103mo'V^ /@H&!.$!  -' % !/0/%*&-'*$ OLM.&OL*02299999999912299999999904&#"32666327'#"&''7&&5467'7<}GG.-@yy+f#{'G$+.86&fD-??-/@Am ޣ T=!!N@,  z  99991/<<299990!#3#736632&&#"3#Tˢ^f#{'G$+.86&f ޣ TBB@)   \   991<2<20!7!!7!3!!!!7FoPoEFoPoFB^^B @ P 104632#"&C00CB11B/DD/0AAh"@ts 9919901\47@ts  99991<299990%- \4?\4LJ #/;GKh@:I<9HL3gBh9gd^Vh;wVh'6P'''V{'='B']?@(<210##?~~~  D%@@%\& %&.99991/2203267654&'&&##!#7332!qL^?y7g7VaNEiH$ä?X!ߔE#SgOD)y *`@6( "("Z+    UT%+999999199990"32654&&&''%&&'77!"&5432:9CXLHx1!::t̘ɛ?kHe?EIb1uE9`5~bs'<`'B'\N 1@  \    9991/032676654&###332##;ba$CKJZ+-Bà=@CPNC0Tif(02_n<2,B 9@ Z    9991990"32654&#36632#"&Nu¡$Rm>h{ݤզXXk'@ qp10!5Rww-5 0@   V  <291<290'7ZR%R%#P%PR#%R%RR?#@ 910#7!1o)? ^?3@ 99991990!76676654&#"#6632!u6U6`Nahs]?2Ud7@O``|kPu+)+G@! " +(( , "%,999919990332654&#"732654&#"#6632#"&5+lbWbqmh wTHJ\lwl^TX%NXeWIMT\T@KJAjysdVyaL~{p U@-     29991/<290!7!533#3#7!\65Rnl@@loj'yrPwX$a@/  "" !#!$%2999991/990!!76676654&#"#6632!3#7!Eu&S2\J^clXloj'y999991/<299990!7!533#3332654&#"732654&#"'6632#"&5\65Rnl@@lo)h^U]khe  t|PEGWi|rhYPTrPwuIQ_QEGOTN=FE<bpk]Qr[HuuhL')Uf '*'#H^'JFT`',X'''6''VfF'&`')'FfF'&`')'F1) $H@*$  !Z  $  %9991/22990%2654&#"!7!33##7#"5432􅺑uZ##욟Cj z0mޥا} }yZT*kn9y#@ vu9910!!L+^B @ P 104632#"&C00CB11B/DD/0AAfNNw}N^'h9L51^mN9N^R^BVTwmwqdN^fNNLsfNTNyNLh9Nh`N q}{3 '+wX53)1){=#VBH BFJBVBh)5BHL%bs^fNLh}555555)))))H'VBh)h)h)h)h)bbbbBF7)B93Ld%ww/=huB/f`N%d hbw9L)hj9)NN+VV=)=Z=Z=BNNLNNNTJTThhRqh}}}H)9Pyf5 Hwsh)+9N-   +%%%)Lsf#T H^f)^f)19N  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~D: ~1BSax~ & 0 : !""""+"H"e%  0AR^x}  0 9 !""""+"H"`%^CiTjq_8 (BJbcdefghjikmlnoqprsutvwxzy{}|~!w  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ sfthyphenperiodcentered####Rtc>i$B)~V9\ S  E  L j  e $ O8Zp dG.\ R'_;] P],9F)6CP]jw;3+`~  O  !*!!!"A""#D#$I$%D%t%%&&&&&'-'>'>'K'X'e'(`({((())4)x))))*d**++w++,,5,,,----)-6-C-P-]-j----...7.~...//W/}///0*070D0Q0^001Z1g1t122&2_2~23&33444444445555|55  $&&*K-r2K4K6&79:; hheadT6hhea.$hmtxqvHkern,loca' maxpq4 namehposth}CprepYq8Oi8w  p  7 4? s p FuturaBookFuturaBT-BookCopyright 1990-1993 Bitstream Inc. All rights reserved.Futura Book, Geometric 211Futura Book BTmfgpctt-v1.54 Tuesday, February 9, 1993 8:09:25 am (EST)Copyright 1990-1993 Bitstream Inc. All rights reserved.Futura Bk BTBookFutura Book, Geometric 211Futura Book BTmfgpctt-v1.54 Tuesday, February 9, 1993 8:09:25 am (EST)FuturaBT-BookuP^ZmXuhV`V5f1mh9m V?}!HsuqP5P`XR=sDV^fhBuwZs){'du)uNyL- fu-fw'!bsquPR5P XZh)X-J {}ZRuyfBuuwwsAK]Y&Y@&}}DG}}>!! 77d.  Aa.a@.GG>>"   }  } S>5%k%S~S~S}||{z{}zyxyyxwYxxwv&wYw@v&srAssrAq}popponYoAonm&nYn@m&ihgfeb}a``^]]Y.WVUTRPO}NMkKED ED A@@?>?>9]8>7654)432}10/.-d.-d,}++*S)(&%#"! && 7}],dd%% 7 A6D }  7 } 7 D  d d d++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++@, %Id@QX Y!-,%Id@QX Y!-,  P y PXY%%# P y PXY%-,KPX EDY!-,%E`D-,KSX%%EDY!!-,ED-ff@fgf/10!%!!fsr) @ i h 1074632#"&3F11ED22E'P1FF12EE.s^q@kj1<20###wu))hP@5 l l     9122<<22<<220!!!3!!!!#!#!7!!7!_-3+^J++@`+X^b)){{++{{FB!(/j@;/ " (! )q !qp s0, %,)"%0<<9991<299990#5&&'7&&546753&&''6654&'fھOhOz3bDOWfWfOxtmmJ㭺Z \Hɏcc nf^KRlLUp+ug49 #/3L@*t u tt'ut1-0s430!21$!*4999912<0#"&546322654&#"2654&#"#"&546323JPNLIPP JPNLIPPv}J{Tȳ8ƳV% 9x@E 8510#$4{{*y4s85419-$' #'-09 -' - :99999991/9999032676654&#"'#"&5467'&&54632667d+x[sR@DE^NL`ma~<0.?(V0k+]3!RQtP%*j?K[`J%Fbc渃aC9vElT,qGuAq1^q@ kj10#u)? #@}h  2991990&7kvwuxklghw8#136P? #@ }h  <9919906'7Pkhgljyuwww1fI@, h   <<<29999190'7'737'#524f11fXX}Z}Z} %@   <<1/<<0!!#!5!vu)u'y @991990y!;y`@10!!- @i  1074632#"&F12GF32Eb1FE21CCBV@ h/99103#͉1i`X "@ qqps 10"32'2#"^'capm9./;@ 1/0!!7!/bsVs=@  qp  999991/9990%!6754&#"#4&546325:e榦o$Eq׿q.W@/ % .q+qq p+s/%"((/91999990332654&#"5232654&#"'6632#"&5q~ x {sps}wҳ Я-3 *@     <291/<290!!33#RJT;}^1F@' q qs  99919990'!!6632#"&'732654&#"!\2r?K{1lǦWɖindjʨ5w; D@#  qqsp 9999919999032654&#"6632#"547+u6n= N$" PR @s91907!5!qZ%qJ /A@$$ q*qp*s0$ !''-0991990"32654&2654&#"&&54632#"$546^xx|z-||vBqp~}qq$'Эw#)ʎÒs5 J@' q qp s 999991999904&#"326#"&5432'u6n=#"z (N{ @ ii <2104632#"&4632#"&F11ED22EE21ED22E1FF12EE1DD11EE { 0@  i    9919904632#"&E12ED32D1FF12EE !;Ly @291905fhkgh\@<210!5!5RRuuuuLy @<919055fgs*6U@.*  '{.i4{y47 $*1+1 $ 7999999919903#"&546767654&#"#5463232654632#"&d`QYaoK:LLF11FE22E![d ^ESof[f tg8Gbb1FF12EEqN[`@7POYL CYS"!YF=%SL%1!PO!"@CV7VI7+\991/<99990733267665!"32$7#"$'&5476$32#"&5465#"&54327&&#"326 :n77-n0Yeysy~eE-wec$f}xETcc3^[}8<nPf^fLy(,.0(L Dhez­cQWa[Bmp]\u6ţ${WQca79NMW[>O?Zdnw )@h  91/<90!#!#ľq?%$-9@" &%h #-'$ *  %!.291/903!2#32676654&'&&##32654&#17FMoj@9>ׇ{%-4>;#\a3!(4atX9=2 rEPv!slqmT%-@%""ys& "&2129990&&#"3267#"&'&5476$32TitQTT22Xcmt`qtptZrm^TWׂfH}tsOQEBoD©qlkMQ`*@ h  #!9991/0%3 676654&'&&!#! !#`oEZ^][Eo8`~`?/9K홚L:1?JaaJ? '@h $! 2221/03!!!!!VV\Ϣ !@h! 221/03!!!!V\-m1"?@!!!ys#! "#9991990!!"&'&5476$32&&#"327!\xgOuvc6fOC%^1p,*c]޷'p^`u  &@ h% ! 221/<<033!3#! 3H!`@h!1/033Hw)@  sh /91999903#"&'73265ǰZ@s6\2OAGJs80v &@ h ! 2991/<290333#glum@ h&!1/033!)1 *@ s  91/<290##Z9))9E#@hs!1/99033/nXm/#@ *ys0 ' $"010%2676654&'&&#"#"$'&5476$32{xWVZ[UVyzTVZYWXtooߛopuupn !not}[WVz{UVZZVW{zXXZ\lluulmmkttkl,@h (!299991/0#!2##'32654&##Z38FOOF81XXXo"'2jj2("irms5I@(  5  ,y s65 2' &"6999199906654&'&$#"3267#'#"&'&5476$323^e*(SyTTZ}}G]R<@Wz|_vopov} JZBZTTyZ45 "Ci32IGq=nlsfekݧff:@ h  )  !<991/<<03!2####32654&#X4AH/̊!(3hFF%iqP'K@)!' !ys(' $ $ *(9999919990#"&'732654&''&&54632&&#"ŏԭ) oqr贄61zMb}`e-=ʊNyb2L=pm\USx]Nr,@ h1/20!!5!!bd)@ s h %!1290332653! ʽqq')"@sh9129033R9`\ /@ sh s   912<9033suo5lF *@ h   91/<290#33# \:/a -Bw@ h 91/290!33}{bT#@h+991/0#!5!! 7dd@h2103!!#JDuBV@ h/991033ϾiNd@h<10#5!!5CfX@ 91290##PFFJ-@/10!5vv#@10#3x#\Z 4@ { { 0 /.,2991/9904&#"326#5#"54325\7js4omdi gf9 6@ { {  .2 0 191/99032654&#"36632#"&'#55qj6ŠfgkbT^1@  {{  .,991990%#"5432&&#"326^>Z L@0@sz_WN?DMŝ @9129033;9 +@    /912<9033ihop4Bw "@  /91/<290133#`cGF'b B"@9129033{ B9o?$@9991/03!5!!  bZ0e@81 %" !/()""!/1 !/< ;!:(1<<299991999990"&#"33#"&'&&554&#"#52326554676633ZyVWooWW~'#cy*7-nn-7*xd#F^]}$z{}#?@=10#?~bV0a@6%($( !(*1(+!:;)<$1<2<999919999903263"&#"##5232655467&&554&##5323oo,6'uf)xWWooWX}'#dz*6,X||$}__}#~)@  ? 1990#"&'&'&#"566323267e]+_59dSyiX8yrWTxsHH HKUIH( :JT^'$' "X@/ ! !h# "! ABA  #99999991/<9032654&#"4632#"&3#!#!G45JK43Hueeeeľ5HI43JI4eefL?qm)T'&d'(7'`'1'm^'2{'^'8'Z'DHZ'DCHZ'DHZ7'DHZ9'DHZ(4P@.&, 2{2{ C)B#C/0/. ,591/990#5#"543254&#"32632654&#"4632#"&7js4RG44KK43Hueeeemdi gf.4IJ33JI6ffeT)^'FP'HP'HCP'HP7'Hi''C'7'9'QBV9'RHV9'RCHV9'RHV97'RHV99'RH'X1'XC1'X17'X1ZB %@ h E  <<1<20!5!3!!mlB1ϏJ7ym  @  FGF104&#"3262#"&546uTTwwTTuuvvTuuTTvvoutvw;f!Z@-" !     " ."<<<<2199999990&&'667#5&547532^wi=Sb/ % > ("%/ =)%0%>99999999912<2<99999076676654&'#53&&54$32&&#"!!323267#"&'&'&#"V7|G2$ }-- 0,X13V)8e'S*#@6W-1X\+]2(U+uz:&DbuA#5v4o H' t3! @ H 104632#"&3{zz{{zzL'@I I91/<20####&&5463!}^`ײyy)7!7m@<5/&#!/)&!&/{{%&8&%5,. .25018<991/2999999903#534632#"&'532654&#""#532654&#"ϸkhA0B&$w}vpGk Ѫ| wrx~73MU\w3.FO@, /);G  K J5K5L#JAG299991290#32654&'2###4&'&&#"3267662#"$'&5476$N{hm`j[`Z^놄Y^db\[ꀃ_[aw jfmmhmjinrke)BKOG\ruYwmHL[]a^Z_^\ba]Zdojfejqpkh kglw31II@*   2 2,>J M J8K8L&JDJ99190&&#"32673#"&546324&'&&#"3267662#"$'&5476$)oSusWu ē״ 3bZ\셄Z]cb\]遁_[_w ifmlgmjjoqjfMWaUv[\`_[_^\bd\Zcnifejqoji  lhmm L@)    OPNO N OP 9991<<22903#######5R6R}^k66C-Cq#@103q#\V'7 @  Q Q1<204632#"&%4632#"&FC-.C@10@E..@=12A-CB.1@@1,DB.2?@)?@#     <291<2<29990!!!!'7!5!!5!^X{;YVssFss@R>@' h   91/<90#!!!!!!!!mz}d ľRϢ?V9m 7e@:8*% (+74)%4%y4s8*). (+7  .' "8999999199990&&#"32676654&''7&5476$327#"&'ScyVVZMHTOh{UTZIMPgnupohPhmupp䝀r?@ZVU|wLP?>YUU}l^bRemmtTRPemlsRR /D@$ -!' $-'-0 $RR*0999919999032654&#"&&#"32676632#"&'#"&546323Xfz[U3Viz[UsC``LG`a/_]nl?__pl튄٤xڣ~)2@    <2<21<<0%!5!!#!5!RvuuuXuX! *@    <229190%!55b/buu}e! *@     <<29190%!555bb-uueq}CD}C@# qq    229991/<<2<290!!5!'!5!33!!!!X[uy{wL{yV-&C@)' # $ '&$#  ' %'912<99990326733267#"&'#"&'#j~rg}-y %#  .FE)`W,q<-!D%mv'4@ !}FMFMDEu#)6@'! '!* $$*99919906654&#"#"&54632#"&546324&#"32 OH5-,_͓ٞc ZRqXTo\QN+;]Hզ^uuzw *@    91990!!!!53#1 ?褋-wX@SS120!#!#c-#b@6  " $   #" #T#$99999991/<2299990#3267#"&5467!##"#663!sn092@#nt!TŞ'7; bBa91gc0^>Eu/ (2@# ) &  UV U)991026732#"&54&#"#"&54632-g  L\>35@ i +)1^I]?4/AKNA0;F9X^rvL;5>:&D +@   29919904&#"326#5#"&546325fktwnivss)PU(smynt~{uFIHGxB+ #@  $ $1032654&#"4676632#"&'&&hhhiz754ML558856JM457weeffG~11343/~FD|224312|dD@#   XWX W 9991/<2990%!5654#"!5!&5! Ly*+yoP4o0Ikυ5/ <C@H"A+:7 63%+(!A=./{ 63= /3{:A{/+:D76>.( 0"!>...=0..YD<999991999999999032654&#"#"&546326654&#"566326632!3267#"&!&&#"xqutw})/èO9>IPK.%_3wEՎ/}pZ_gX[cdbg-,{&&k]cg!ebP|~hyL9!+k@:,#"  & {&{,#")  , ). 6).,,<9999999919999999077&&54327#"&'32654&&&#"Lu65VBwIt::^>%Aɰl'H@%!$  '!!$ (? (<219999990#"$#"5663232675#"$#"566323267k\bdRjYo}VU}h[ddS}jYo{XW|KGGXIHGWIGHVIHFVV!@91/90%!bDC#JJr#?D1\ 9@!    Z Z 9991<290%j1i1CHCD1\ =@#      Z Z 9991<2907'7'7bhpdk1HLTCilHLTCi#'''}'$C'`'$'m`'2{'m6J@(#5&2h&s2y!5"  ,"7<<<<21/99032676654&'&&#"!!!!!#"&'&5476$32%[WTyzUUY[UUwxTWYVVsrSvqq"tyWTXZTVzwUU[YUWa\Ϣ52m\КpmrV+7_@3&/%55{%"{/{) 82%&.2.,.,8299991<99999990&&#"#"&'&&54326632!3267#"&32654&#"`}r \5ہB9w$xJ8|-\9yEՎŠ1yss\o""FކecaicdP|~iɑ@/10!!u@/105!uuT'2@h99991<290'''>->V%2@h99991<290%);/;y@ h991990'Ἤ>y@ h991990y;= ,@   [\[ <<102#"&546!52#"&546V/DC00CDRX0CC01BDmD//DC00C1uuC/0CC0/C#u"@91990 9%- B7'\^'<J'@103}}'V^ /@H&!.$!  -' % !/0/%*&-'*$ a^_.&a^*02299999999912299999999904&#"32666327'#"&''7&&5467'7<}GG}}=\\'^?PWStxkLTH ?@? <6# ?  <,)0 0  ,6&  &39,-9 @2<299991/<29999990!5!33#3332654&#"'232654&#"#6632#"&5P/mml}}'n^N[dfc _bYKQZlVNR_~Pho >KTLOQRKH@KGBkpteIe lRpva')Um1R'*B'ZB+'JJd', 'P)'6?)'VmT'&h'T^'F)mT'&h'T^'F)Z $H@' " { { !#0 2.%<2991/<29904&#"3263##5#"5432!5!\6jr4hřscj gfy`@10!!-ZH @  104632#"&F12GG22E1FF12EEf\\N^'h9ZV1^NNPPf\y\V`sq-^wqs+qm+m13mmHPN;NVNNZTZPPZuuVZB?`w sm+3mZZZZZZTPPPPiuVVVVV````3Z7V3o3L)wwqmhuB/jDjB%d5L+9LTDTDm 9mVV{T{V\y\y VVDD333Z\\y{V9+++{mmRqm7B PB?sV -LJJJHHmZPB?mTmTZ\  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~D: ~1BSax~ & 0 : !""""+"H"e%  0AR^x}  0 9 !""""+"H"`%^CiTjq_8 (BJbcdefghjikmlnoqprsutvwxzy{}|~!u  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ sfthyphenperiodcentered####NpWf}$OnfY8"Ei .  x  0 a ) P o 1W|(pBC}N-U6\] -:GTan{ %2?LYfs-dfD_AYHy U !!l!""K"#I#$B$l$$%"%%%&%&6&6&C&P&]&']'r'''((!(e(((()Q)t))*O***+++++++++, ,,$,1,,,,,,,-=-R-x--. .1.Z.y....///9/000(0n0011#1j1223,393F3S3`3m3z33334 4"4A( &&*K-r2K4K6&7D9:; wmĢ%#}$B^ @ff  <21074632#"&4632#"&;++<<++;;++<<++;T+;;++;;+;;++<<^ -@  f  99919904632#"&'-;++<<++;T+;;++<<1='bd @291905f XXX=?@<210!5!5RRRRjOObd @<919055f=XZd 7_@3!"74 $"4-" 4"'f j8!-!#1  *89919999990%4632#"&#54632326553#"&546767654&#"<++;;++7&gm4ILzk>?@-x|/$HX!F '7`ug:<1qP"3@ " jz#"#91990&&# 3267#"$'&5476$32Nm~WYX~klvhknqjg#b^ZߑZX\VTBGrgjgerMM!*@ n   9991/0%3267654'&&###3 !#;B\^_]Fw1\zx_-s3=VR?4 '@n ! 2221/03!!!!!PP}6}} #@n 291/03!!!!:}6} q'"?@!" zj#"#9991990&$# 327!5!! 476$32fY[WXڂ5dhbj >VHۃZYY"stXhqp &@ n"  221/<<033!3#!RH ;@n1/033HX,@   zn # 9199903#"&'7326Ӆ]/^*[4bT'MKV96 &@ n  2991/<290333#J\RD1@ n$1/033!}XR (@ j  91/<290##Ro1Fm9 ^?#@n1/99033 |7`q/#@ *jz0%$010%2676654&'&&#"#"$'&5476$32][a`\[郂]\``\\voq䞞ppuupnnpuP`\]탄^\``\_酄^]_mnssnoompqlo ,@ n & 299991/03!2##32654&'&&## 7EL[&&'["'2jo{Am+,$q5E@&5  ,j z652%&69991999036654&'&&#"3267#'#"$'&5476$32XXa[[끀][__[]jEj慛lpuupnnpuuvX_င\\ba]]酅\\`?:DCqjomlsslm꜠r/3@ n   299991/<<032654&####!2#;nP ˲DwFɫF&J@& $j$z' ! ''99991999907732654&'&&54632&&#"#"&Fr niݒӨn3g uPl.~Ɛ=lwj\u}]]>?Bl g'@ n1/20!!5!!ml;}}*@ z n "1299990332653! ƅDo%){"@n9129033+Ù9X -@  n  912<9033n`k9o? *@ n   91/<2903#33#ylJMlEN V@ n 91/290!33a^b @n991/03!5!!f ?y{d@j)(210!#3!#bPcB9@ j/991033m̾i/dR@j()<10!53#5RݰcbV@ 91290##9}'%}+-m@/10!5mPP d@10#3^^T 0@  { {  -,*291/99032654&#"5#"543253ݛV,lq-{˲bg c` 4@ {{  ,/ .291/9904&#"326#36632#"&'s{{-qk,ǻ˹`cfc\d5@  { {  ,*991990&&#"3267#"5432V>J˞HGAZP7++Ӱ22%% X /@  { {  -,291/99032654&#"5#"54323ᛐT,kq-}˲cf c`9X?@!  {{{,,*991990&&#"!3267#"5432 {p ?b1qDŏ!ztijk> !!@@  {{   <<9991/<2999903#53632&&#"3#d!<-A6i l giZB#/I@)"$*{${*{ 0-" 0 ',-*0291990#"&'3326766555#"54325"32654&.mR!)mi%Պw#-caRT:3!W[/_lmZPŬʫ2@  {  1.991/<99990336632#4&#"u6f}otUU#1L/ @ 3 .1/04632#"&38''97)(7'77'(66WwBL/ @ 3 .104632#"&38''97)(7'77'(665 )@  . 2991/<90333#{%#r5+@.1/0!#3+"C@&" {  44.#291/<<<2990!#366326632#4&#"#4&#"{{,^a%5f{kjwzfkzwTXYVXW'-'~2@  {  1.991/<99990336632#4&#"u6f}otwUU#1Z ##@{ { $,5 ,*$10%2654&#""&'&&54676632;ʓʎ_GCFHCD`bEEIHDFLәқsKFBbaCDHHDD``CFKB 5@ {{  ,/ .2919904&#"32636632#"&'s1w3fk4ſ˿75`ggdZB 5@{{   /,*291990"32654&##"543253w4lg2w'Ŭʫbdgh_2@    .291/999906632&&#"#3DW5(+o{{s` tЛLw?&F@% {${$' !6'99991999907732654'&'&&54632&&#"#"&?unPN\ pl#qbG@SReqCJKOBfG7uVq^W??BK87H+3xjzg $@{ 7 7 <<1/<20#5333##yyiliw*@ {  1.129999032653#"&5svzwEʦNw@9129033hw`P -@   91229033{9RPw "@    /91/<29033##ٖJLwFV3f+Bw"@9129033#+5wJw @{{91/03!5!!3oobP(f@7 )#  $  ')': 98#)<<299999199999990#"33#"&554&#"#5326554633P%^VmmV]'+t s+mg eXZ-@;10#-ZbP(d@7) ## #%)#&89$:)<2<9999919999903263"&#"##532655467&&554&##532!t t+']WnnW^%+LZXe gX)@  =1990#"'&'&'&#"566323267jYc ZSxiZd ]SxJI=9 #9991/<9032654&#"4632#"&!3#!M87NM88Mgdccc!p'T8MM88MM8ddcy%Lq`P'&\'(B?P'1BqH'2BH'8BTd'D+Td'DC+Td'D+T'D+T'D+T (4N@,  &, 2{2 {  9)>#9/ -,*5291/99032654&#"5#"54325332654&#"4632#"&ݛV,lq-{N78MM87Nfdddb˲bg c`8NN88OO8ccc\`d'F!Xd'HXd'HCXd'HX'Hgd'qd'C d'''QZd'R;Zd'RC;Zd'R;Z'R;Z'R;d'Xd'XCd'X'XdB %@ n ?  <<1<20!5!3!!i{hBs?s<?b  @  @A@104&#"3262#"&546'~WY|}XX}prsW~|YY||kqrsr{9f!M@&"!  { {" ,"2<<2219999990&&'667#5&5475327k>Ob/9UPPDJV͏(+ /&## dN8@E2+/5(82! (o5. +o2or2v9 % "% .8(%/%99999999991229999076676654&'#53&&54632&&#"!!3267#"$#"d$a>)'342332[8=g/X7^T<;g/DT9d0,c>ZjNByZ7V#Gs+qEJ;gby>?s9 Bb@5C(-39)B  ?-)%jC*93 0B " )(B<B60B"6 BC99999991999990%2654&#"32654&'&&'&&5467&&54632#&&#"#"&5r{sqohv[|k<:~pkɪoja|g͢lmǜszs~tuqdQa>-56W{(.iz|t[Yn9J)/i3! @ C 104632#"&3{zz{{zzZ'@D D91/<20####&&5463!FFٲyy!#6k@;4%.($!.(!{(.{{(7%$4++ +4.7<991/999999903#534632#"&'532654&#"5232654&#"yyml<"A# ~{vEg i)Ѵt* |?: ^eT{/.FO@, /);G  F E5F5G#EAG299991290#32654&'2###4&'&&#"3267662#"$'&5476$Tm{mo\sb\_[_ed^^`]am hglkhkiinpie5HZNINqxYx wyNN]_cb\a^^ef_\aniffjqojh kgl{/1IJ@+   2 2,>JF H E8 F8G&EDJ190&&#"32673#"&546324&'&&#"3267662#"$'&5476$9wX~{[f ֯ Eb\_[_ed^^`]am hglkhkiinpieQ[ðiX{rŅ]_cb\a^^ef_\aniffjqojh kglT L@)    IL JIJ IL 9991<<22903#######5f;1@( n  91/<90!#!!!!!!!\;j)+)gb}6}}q 7e@:*%8 (+74)%4%j4z8*). (+7 .%8999999199990%32676654&''&&#"'7&5476$327#"&'anZ\`KOA[yZ[_PVAjoupogFaiupp⧌nLIc[\ubDOPa[]{eFfmmt^\CimmpTX /;@ $!- !'0 $NN*0999919032654&#"&&#"32676632#"&'#"&54632y6[k`W4\l`XbBa^GG_b-gfywNffyv닇ԟy՝ˁ;2@      <2<21<<0%!5!!#!5!R/P/RRP`Pb1 *@    <229190%!55ffPPXF1 *@     <<29190%!555ffPPFkX`^X!{C@#     P229991/<<<<290!!5!'!5!33!!!!b%!cwbd\3dbX'+D@*, ("%) ,+)(" , *,912<99990326733267#"&5467#"&'#F{ xr,}y#!  1DA+la wy<'+D~7 \ ` ?@SY[Q)8@'! '!* $$*9919906654&#"#"&54632#"&546324&#"326 LN-m6'zW֗a{^[u_ZrBEU%;VDүb}u} w -@     2912990!!!!5-5%3{y=w/@QQ120!#!#1f'#@@( " " #$91/<229990#3267#"&5467!##"#663!Nw1<-.\k!Xy'7= yx=>b;0l l^/B@Eg- %@ !RR!1032#"&#"#"&5463232AR7/M1 C4@T90!. B4BF7-5,E20;=J?1 '@    29199032654&#"5#"&5463253ulhyxihy"wPU{!]{x|sXpDGEBpD1 #@ $ $102654&#""&'&&54676632nonkH633532IK447635lkkkP32/wEDz0.21/1zCCy/14D@# o  UTU T 99991/<2990%!565#"!5!&5! byyyyfW RfyG=fH07Cz@A$' *#0A{ #1{;5{ {-' D12$#>*82+82,>,VD9999912<<<29999990!3267#"&'#"&546326654&#"766326632%!&&#"4&#"326?g/uEˎ{=%ǣW3LLKR0mH'{opuyptij>lqit,, &(cXYbTz{L\dXU[nX!+i@;,+"! % {%{,+"!(  (,5(,*,99999199999990'7&&54327#"&'732654&''&&#"7o;8UGn>q;:RER3k;""9-h>"$);qIP69q:nIT7:V*(ϟ!4JD9v_Ϫk b_?'H@%!$  '!!$ (= (<219999990#"$#"5663232675#"$#"566323267jYj]SiZj{]Si[j]SjYj{]QJIGY]IHGYIHGY\KIHZB!@91/90%!@PRy/H?-1? ;@#    W W 9991<290%VHV1555-1? ?@%      W W 9991<2907'7'7RVjTV15LX5u}5LX5u'/''$CdBP'$dBqP'2Bq6M@* %1nzj + 7<<<291/990!!!!!#"&'&5476$3232676654&'&&#"??FafSpkl0f'][U}VX]VVY|X[]}6}}743mXԝkmt/#`Z`^Z^킌Y]__[`\ 9\@093 !{ {{60$:  !3, , ,**:999912<2299990%2654&#"!&&#"!3267#"&'#"&'&&546766326632=ʓr'{o?g/uEȆ$9ՈaDDGHCCZ<)Lәқ{٥jk@lq}GDEc`CCKvtm}@/10!!P@/105!PPj'@j91<290''–ÔCCj'@j91<290%ÕlA A{@ jX991990'ÕC{@ jX991990{–A ,@   YZY <<102#"&546!52#"&546V)99))9:~RX)99))99m;*(:9))<RR9*(<;)):#u"@91990 9%-+B'\ VH'</B@r103km'^f} /w@D&!.-'$  % !/0/%*&$ -'^[\.&^[*02299999912299999904&#"32666327'#"&''7&&5467'7Š=D|tt=f @ _ 104632#"&=)*<=))=*>=+*== @ `a` 1032654&#"4632#"&sQ<FG=gnlk2vF ,,.,dOIRRBd@ 91<203!3D^^9Nf@   99991/0!33#"&5467=IF.6TOrlRkAt7.(pPTAxUd@ 91290#37Ւ\d^; 9@  n   $ <2.9991/903'%37!B@OV} -@   b <<.991/907#'73979?kR;{mRF'6B?d'Vb'==Bd']-@;<210##-ZZZ  +'9@  n &' /<2991/<20%32676654'&&###!!#533 !#FB\]_\FtV4Z{|\s3=VQ?4ffXZju^GcmKmvp')Uq'F'*FBZB'J+`N',BF`'6?`'VqP'&jB\dd'F1qP'&jB\dd'F1X\ $H@&   {{" {  ! #/,%<22991/2299032654&#"5#"5432!5!33#ᛐT+lq-h}˲bgc`e ewy=@10!!Lh5 @f  104632#"&;++;;++;+;;++<<fNN{'d'?Vd///VwNyN9fHb=R{}{{{ymqqNXqq9F'h/^ {/9// TTT\TXXTZ+P+wZTTZ?7j/'9+ qqTTTTTTTTTTTT\XXXXg+wZwZwZwZwZ7777d?{ds3Z#!{{{q!F -??ZD1XHwX{57--q q1\mjmjN{N{9+^ V^++dNNymj=uqqRqq-B9XF?{ sT^ 9+T5  / B%%%=qTZF?q\q\\XN  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~D: ~1BSax~ & 0 : !""""+"H"e%  0AR^x}  0 9 !""""+"H"`%^CiTjq_8 (BJbcdefghjikmlnoqprsutvwxzy{}|~!P  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ sfthyphenperiodcentered####OqZh(Sro[14X & z  t  . ] " ; Z AeW+z+dSh&Z|&Wd %2?L)6CP]jwzp7~RO  \ ! !P!!"1"#K##$$B$% %4%q%%%%%%&d&&''?'k'''(($(1(I(())~)**/*N*}++++8+E+R+_+l+y++++,,,*,7,D,Y,w,,,--P----...^.k.x.../////050L0001M12 22222223333)333 $&&*K-r2K4K6&7D9:;````````m`m`m`m``c`````c.\\\\Y Y ```l`l`l`l``.`m`m`m`m`m`l`l`l`l`cc#;-\\\ lM1'c.ccc8t&l`&l`&l` xl`:l?Ll?Jl?Ll??0550*\\\\\\|1 Y EYEYEY!=l?Ltt4%@V]$`X'^] 3BL!8t-t-t-t!! M]|x[B73yY9!|xx)MMMRh?E?EZ\\\l,M\\&/\`@ ~I~ (8    " & 0 : D !"!&""""""""+"H"`"e%  L &8    & 0 9 D !"!&""""""""+"H"`"d%rPON5&UPJIF=5,PMrogfda^R6۸P:DE&'FGe   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdeivhimk|torzn|wk{twva}p`gr{C~uqlfcdfgFG<pqnoj}ehmHNuJKL~OMID,,,,,,,,J`H 8HVn~4P Z< <j:Lh|D  2 F Z j |  D x " D f 8 j  4 H d 4ff&j@ | BRtH0<HT`lxHT`lx&2X<HT`lx(4@r".:FR^jv(fr~&2>JVdp|(4R^jv ".:FR^jv*6BNZfr~&2>JVbnz  " \ !!"!6!N!j!!!!"" "" "*"4">"H"R"\"f"p"z""""""""""##(#@#d##$H$\$p$$$% %P%f%%%%%&&J&~&&' '('B'''(&(6(F(V(f(((((() ) )D)t)))))** *.*<*J*XDdU./<2<2/<2<23!%!!D $hUD 74632#"&3R99R)(:;Pp8RR9:)(P$Pm#!#!B+C+mm*#3#'!'#53#53!!!$;9<9$75'85$(V""ˬWWu![5&#"#5.'7327654'.'&'&54>75vDXXt/.y(qfe1-ADqnJI=y^=a.WQvzmhNG/.?7a-z- .A>GFoc<I+WImH|eJM#.=47632#"'&732654&#"'47632#"'&7327654'&#"MoqnnܛmltSQttRRt3mneoqnnomml9:SR9::9SQtkklkmmTttRQtt&>B:kklkjjllT::::RR::t|!$0B 7>7!'#"'&54?>7&5476323277>7654&#" -P%[?ޚ͏e fh98 43MP`1@RE?++6:[ 1^0(jEۃEbbdQQ c<>bDvvEc0 5!3!!#cHƺPP,!'!N?Q!!BQ 74632#"&R99R)(:;Pp8RR9:)(PZ'dRSW"7632#"'&327654'&#"WۚڜYYZZZZZZq !7!#+t.3@"%!!>7654&#"#!2?Ok9p"8ӏC"da0^Kl膆~y?vW/#+527654'&#"#>32# '&'3327654'&3[BAha53$ˀ8pqJJoA!:c>?/0rxwvqVpwKMvB&{ 3##5! 4'L !>32# 7327654'&#"#!5$L ᐑͱIJJk__^^rM~. |32be^a,q>!>32#"'&5474'&#"3276$* ҞUVyz{xUV> Ԙ̷z{UVyyUVb!5!'d2.u]"%4&547632#"'&532654&#"327654&#"d]56֋CD`___JKkjKKjiLK#xϼ~~~}~2``xcCD__kMLKLjkKKq"#'#"'&547632327654'&#"̫q* ӜmUVyyUVVUzxUV5՗˴}UVUVyyVUUV 74632#"&4632#"'&R99R)(:;PR99R)(::)(p8RR9:)(P,7RR9:)()(,'4632#"'&㘶R99R)(::)(!N?8RR9:)()(n\ 5n \c,5!5!c))pm[75 5 fh|p0>3#"'&5476767654&#"#.547632324632#"'&kQiab=>'(SEER kjmE +nR99R)(9;()ј]ydetFG56!!EEQPE7(iiԟd?;(V+ 98RR9:)(()l#?M327654'&! 32%7! '&'&5! #"'#"'&54763274'&#"3260?>WGF꾽DE|4 ӛWV_Cvw.{nlyyg5?A]e@AhRi5K{y隔Zxw~nS䣥y~wvo~]>>NMxhi !# # DkwiR N*332#32654&+327654'&+\]@A&'{GHM`ixIy|vRJNKIv9;XY[s*ih}Mqspmq>CgdDCl.&&#"327>7# '&7!2.H{V0g9}쩫(D0qI'c3!2#'32767654'&!#D金v}WihhTi.-ln++!#L  !!!!!! YkT- !!!#!-!lQ&$!! '&76!2&!"32767!~)(_Qʬ$3|lIPJJtu% !3#!#3f\/##"'732765uv#!5!c--0327653#"'&5AaaA阫^\Yb ! K[.|uS 3 NsbpSFk ! ! ! !W '6 C' O ! !# ab mieE%!!!5!-fp3!!Yt3Z5sSlf#5!!5/Y$,c#!#0,+!!zd7|nL`>3#5#"'&5432327654'&#"\⋠ʄŪKMu}MMMM{tNM2f$XYVYYWXYl 632#"'#4'&#"3276oŃȩLMt|NMLL|uMNČᓒfGXZWVUWWX`&'&#"32767#"'&5432M= 3#5#"'&547632327654'&#"\ⅨȄūKMu}MMMM{tNMgfڒXYVYYWXY`#!32767#"'&547632'&#"F EElT76E,bpLڄ}|/)H;* xGF((ljKkE 珍/B*El##5347632'&#"3wPP@X<[I/<xLj# %+*x`<!1%#"'&'3325#"'&547632534'&#"3276< F~ FwҸzLMxJCCIKEEi(nOilH'[/ՕnUW_UU]^U3632#4&#"#xcTS\v0/lk]@uiIJ)l#4632#"&o"V<=+++*==V2;V+*==++Vl#4632#"&o"V<=+++*==V ;V+*==++V ! !#o=.Y$;g$o#og 36763263 #4'&#"##"#A.1J`jI"#P]U_WZDq:;  3632#4'&#"#v_R('gp/.Zuk[ 78JI*`o432#"'&732654'&#"`.ژ۔NPOP(۔ܒUVUVl#3632#"'4'&#"3276oᅩɂƫLMu|ML|uLNjےtXYYWXX`> #"'&54763253327654'&#"\łǩLLu|MNMM{tNMޕj XZVWYWXY 367632&#"#>01CYag@=WA:.L&&#"#"'73254'.'&'&547632ĺ,A,|hef()9rX"D#b(3WY(cZ) 87Mn_ZYF&h<4 00=`SS5%3 ##5333v``e3253#"'&'&5oErrF/uUL=cc=LD4 3  # '' 3 {,s m !! ! ! Al N%! 3!J*0 G%!!!5!Cw_Tt%#"37#"&54&'5>5463tZ6RY9GF3232?632#"'&#"#"BggMT=.=MOPmZI"# @-#xF@(LUBAN8Y #"&547632#)(:9R():9R59)(R::()RQ>&.'&#"32767#5.'&'&5%5 zb(G=RQPZ;7#"'&#"'6767654'!53&5476324'&#"- 5z8+ )COPtTC7@(]7@k#a׊"ByNNjf(.q 1:+p:<;@4Te*3 O@EAnjUCONzf '+7&547'76327'#"'4'&#"32762nn株om~圭gfhgghgh-䘭ol⤢omgihgghgh('!533 33!!!#!5]QT^CEi3#3#mQI7G7332654'&'.547&547632#&#"#"'&'&327654'&#"am00Ֆ۴zy`>=fܢ21v]&'|}zde8:DEb`DEEDabCEmd],-DSblzy;:]~:$OwSRI?DGfvw42Z[_DBBB^_BBCBt47632#"'&%47632#"&**;;***,9<*)*+:<)**,9;T:)**);<*)*,::)**);<*)TM(-?'&#"32?#"5432! '&47676!2 ! 764'&'&z~]]]_z}(ӄ|,LMՂML~_^_[\bHCe*PqF]Z~^3#5#"&54632327654'&#"7V_~|iP-.HK////JH..9JNR4425PO5341]     ,),onqonM9j!!5!QQ!!BQM(); ##32'3254+! '&47676!2 ! 764'&'&-Yc55R$,LMՂML~}oEPWJH|z*PqF]Z~?!!C?\2#"'&5476"327654'&}ZZ[Z[Z[[E0/`BD.0/.[Z[ZZ[XZ--BFb11FA-.c0 5!3!!#5!cHH)ƺPo:Mj!!>7654&#"#!2UoR0?#XA$XZ)P?9Q8+=R0RQyJJ$jFfZ%527654&#"#>32# 3327654&u`4L=mOQanXYA**XI7E{~IJq|FD~QP*+CNDd '{Ll#33253#"'o῿Frta/uUL=c3%$#"'&5)###wbb̀=լhk y 4632#"&R99R)(:;P8RR9:)(P'I5j'#73#Xyb^4632#"'&732654.#"^____[]^QQ`.A'(A/ZYZY[[UecT*C0/C|? 7 ' 7 'Ԗ~Օnono# #73#'%3##5!\Xmn.cc*uyb>B䋂pK# $#73#'%!!>7654&#"#!2\XmnVoQ1A"XA$XZ*Q=yb>Bh:S4-;R0RQxLI#jF7~#%)25527654&#"#>32# 3327654&'%3##5!F`4L=mOQanXYA**Xmn.cc+tI7E{~IJq|FD~QP*+CND>B䋂p|q,9#4763232654'3#"&54767654&#"#"&54632Pj>=('TEER ֡mFD2n)(:9RR99RԖ_yʑtGF65!!DEQQE8(ԟd@:'W1D9)(R:9RR2&(2&(K&(&(&(I&(I!#!!!!!! OpaVbi^qLl.&&* 2&, 2&, K&,_ &,e2&02&0K&0z&0.c#3#53!2#'3276765'&!#!!D金v}WihhTiL.-ln++!"LZ&5Ul2&6l2&64lK&6l&6tl&6[@ 7   'IJJJmJ~I~Jl-%7! ''7&76! &#" 3254y&ꦀG:aݩL, ZauR02&< 02&<0K&<0&<2"@9#332#'3 54!#ZaOlWAMeL>,3#53547632#527654'&'52654'&#"PPr~Ɓخgj}PA@hyoz{yp9f^^W6}s`>={`>&HG``>&Hz`>&HH2`>&HN2`>&Hn*`>&HL `*/=!327#"'#"&5476324'&#"5632632'&#"327654&#"B GFje J+ĝzjk{78lh)3j8;SY<<|WRrvJHl=\i[\B45%v9&&'(;4LN`&J~`&LG1`&Lz`&LH`&Lno&_&Q&D&`o%377#"'&547632.''7&/&32654'&#"\CK-OzzޗRK=QI HQ NPOPD.|d瘕ڕmKd$*ڑUVUV&UN`o&VGb`o&Vz`o&VH$`o&VN;`o&Vn$cG5!47632#"'&47632#"'&c)j&)35LL56&&&)35LL56&&ƺ4&&L66L&)4&&L66L&)."&7#"''7&547632&#" 327654fmڸga٢=PhIUPOlؔfhהPA8Y(QRX&\G&\z&\H&\n N"`zl#3632#"'4'&#"3276oᅩɂƫLMu|ML|uLN˅ےtXYYWXX N&`ns&(`>?&Hu0&(`>&HJ- i&(MR` U&HMl.2"*`"Jzl.P&*H4`&JHl.&*K@`&JKl.K"*`"JIcK&+`&K.c#3#53!2#'3276765'&!#!!D金v}WihhTiL.-ln++!"LZ`(327654'&#"3##5#"'&547632#53FKMu}MMMM{tNMⅨȄūXYVYYWXY,ZfڒI+ s&,`?&Lu &,J3`&LJ &,6`&LK B&,M` &LM K&,`&LIlQO&.HM3`<&NHlQ".`<"NJlQ&.KF%`<&NKlQ&&.`<W&NX%H&/H,H&OH,&/gGF`@#&O#8'NZ0f1'NS^s&0?&'J",0?'J#[ &0M% &PM"0o#o2&01lx&PQH&1H,"'H6&2y&R ! !#o=.Y$;g$h2&3518t&SvBh&3r&Sh&3&SK&3KB&SKh'i %!!573*QXbb.5 #5735ᓓ9f gg6:2&5&Uzq&5{&U5K&5&UIt\Y'UGls&6J`o?&Vu'l&6JN,`o&VJl2&6`o&VOl &*!!!!!5# 7!25!327654'&#" EV~$sx?WD﨨榧-Մ76K/ ::𭭩`B$6!327!"'&'#"'&547632632'&#"32>54.#">9JInchpg=Ԙ'1KLElK''JjCNMrJIo23Uە~UU+QtJItP*TS2&9 &YzD&9W &YkK&9: &YIXlJ2&:L&ZzFlJH&:H/,J &ZHhlJ&&:~L'~GZlJO&:?'I]Z&;5%3&[K&;A5&[q&; *%3&[*0&<N&\N0s&<?&\u0&<J3&\J0I&<&\LD2&<lN&\O 0&<MR &\M~uO&>H3 '#&^HI&@H - N&`H&@cE2&A2G&azE&A}G&aKEK&AG&aI=`#3!#"'72767#737>32&#"m" ;1%;K%k+$ɮ>S)9-N'&ж^.Y;5Fa0/lJ&,0&'&#"#"'&'732654./$4763 '"502Oa@@Ƀ (Hm5T:Å k"p\ 76RqE?L۟Ջww44dp-K?7>uvM?L*'&#"#"'73254'.'&'&547632Y%,A,|hef()9rX"D#b(3WYI5cZ) 87Mn_ZYF&h<4 00=`SSt)K'=N<>t)K'aKN?d '_dAwd 77Awg 33273#"'&ݹ_^YXt47632#"&,/<>,--,>?X <,,,,>?+,Xd;47632#"'&732654&#"@@Y[?@@?Z[@?w9**99*$AX?@@@ZZ@@@@[+99**9$ !33267#"'&5476eG-O]nII.._R 1=:]Z=Bt'7>32327#"'&#",46:"Ngh8D`8[-7to)(7#45lj8.%dw ''c^cLlnLl@d'G{Vd=z{]d H{$tYN{`?u{Xg%J{'tUK{^tn{dL{dO{]d I{ ~{ [MZ3uB.sLTW 3#5!##!"zz3Q!!FQ8Q!!8Qt)!'a!N?tK''N<>N<>tK''a}KN?KN?t!''a}!N?JN?f@ 3!!#!5! >> f@3!!!!#!5!!5! >>>>EaBX2#"'&5476 \]]]_]^_X`_^__`^_ (74632#"&%4632#"'&%4632#"'&R99R)(:;PR9:R)(:;()R99R)(9;()p8RR9:)(P<8RR9:)(();8RR9:)(()M #.=M\47632#"'&732654&#"'47632#"'&7327654'&#"47632#"'&7327654'&#"MoqnnܛmltSQttRRt3mneoqnnomml9:SR9::9SQtoqnnomml9:SR9::9SQtkklkmmTttRQtt&>B:kklkjjllT::::RR::tLkklkjjllT::::RR::t]t  H,on| 7 'Ԗno#'@mm#>B& "!!67! '&!!3F)_k %DJIW NDX##5! # `$6%%RSq'ٗ'v@!B.!35!&576! !!5$4'&#"Bp/,˰nugȆwu.>uкˑ͡bӺ7O +7#"'&547632&'.'&"32654&wٚZQHG@>Q4}UUTUxy?CB~nꩨґ KJ%Cecadcʔ333%!3PW}Y !#3!53!3!53#Yǽ[[9#! !3!5 5Fs :Q~(Ol|5!|)ƺ#'@mm#>By 4632#"&R99R)(:;P8RR9:)(P!!#5!367NDբAL6U> l|)".#"'&54632632#"327654'&#"&#"32 ѡffΟ̞ڢdffd,oqF//0.GpmtF.//0Fq|fggfggo02HF2112FG21 7327657632&#"#".M'mF%\7.M&W6Z`f% D >.|p*M3232767#"/&#"'>3232767#"/&#"EqYB=)(/JRSrHw>=fQEq\F;)(/%L*StGw>=d%VF@PNBA91UF@POLm!A91M9;!!!!'7!5!7!5k~Z[xUc\A<GйGйMG9  5!59 ,MG9 5 55!M bVV,^E ZYLME@77h}(52632#"'&#"#"547632>7D)J{`5P%DHF\=+7[XADPV1suLjmZ>?;6'AFB1!F5^ufe>A!#ꕔBB7 )E!#54'&#"!!##5347632#303JI21PPtutu[J8987L\tuutE!#4'&#"!!##534763222II21PPuutu*J8987L\tuutu4632#"'&%4632#"'&T:<)**);<*)T;;TT;<*)4:T**<;***,;:TT<;T*,27@o]Z'M?2 'o1]B27H1o]tD47632#"'&%47632#"'&D*(<;***,9=()j**;;***,9<*):)**);<*)*,::)**);<*)*,d_ '_|Lldg7`|nLdQ 'ROTAw o'7'#53oK}=Q5. 33273#"'&_^ꞞYXK '3_d AwhK '_d Awl'7>32327#"'&#"46:"Ngh8D`8[-7o)(7#45lj8.,I47632#"'&732654&#",@@Y[?@@?Z[@?w9**99*$rX?@@@ZZ@@@@[+99**9$MK 77Aw2 'hoA]Bz 47632#"'&%47632#"&)*;;TT;=()y*+:;TT;;T48,*T<;T*,;:**T<;TT47632#"'&,/<>,--,>?,,;=,,,,>@+,,/|'7'#53|K}=QH5.cxW73#K}=Q5./2 ''hoAhoA]B]Bs!!Cs^s!![s?!!?M#MQ'# 1Q v     0 6D      F  ? Z ~ $  0 0  V  d p |       Copyright 1998, Neufville Digital. ALL RIGHTS RESERVED. This font is licensed, not sold, and may not be reproduced without the written consent of Neufville Digital. Parts Visualogik Technology & Design, 1998. Copyright 1998, Neufville Digital. ALL RIGHTS RESERVED. This font is licensed, not sold, and may not be reproduced without the written consent of Neufville Digital. Parts Visualogik Technology & Design, 1998.FuturaFuturaMediumMediumFutura Medium; 13.0d1e3; 2017-06-07Futura Medium; 13.0d1e3; 2017-06-07Futura MediumFutura Medium13.0d1e313.0d1e3Futura-MediumFutura-MediumFutura is a registered trademark of Bauer Types SA. Unauthorised use prohibited. ALL RIGHTS RESERVED. Neufville Digital is a trademark of Visualogik, used with the permission of Neufville SL.Futura is a registered trademark of Bauer Types SA. Unauthorised use prohibited. ALL RIGHTS RESERVED. Neufville Digital is a trademark of Visualogik, used with the permission of Neufville SL.Paul Renner (1928)Paul Renner (1928)Paul Renner (1878-1956) was a painter, typographer, typeface designer and teacher. Between 1908 and 1917 he designed thousands of books for Munich publishers in a refined traditional style. In the early 1920s he began to support the modern styles of architecture and typography, becoming a leading proponent of the New Typography. Renner is best known for designing the typeface Futura, which became a standard tool for the New Typography, and remains a popular typeface today. Futura does give a restful, almost bland impression, which accords with Renner's objectives. Futura seems classical, not only due to the form of its capitals, but also to the open, wide forms of the geometrical small letters. The typeface relies on notions of classical, yet contemporary form, - harmony and evenness of texture. Thanks to the modern digital technology Futura lives on in a greater variety than ever, offering a wide choice of typographic solutions for contemporary design in the new millennium.Paul Renner (1878-1956) was a painter, typographer, typeface designer and teacher. Between 1908 and 1917 he designed thousands of books for Munich publishers in a refined traditional style. In the early 1920s he began to support the modern styles of architecture and typography, becoming a leading proponent of the New Typography. Renner is best known for designing the typeface Futura, which became a standard tool for the New Typography, and remains a popular typeface today. Futura does give a restful, almost bland impression, which accords with Renner's objectives. Futura seems classical, not only due to the form of its capitals, but also to the open, wide forms of the geometrical small letters. The typeface relies on notions of classical, yet contemporary form, - harmony and evenness of texture. Thanks to the modern digital technology Futura lives on in a greater variety than ever, offering a wide choice of typographic solutions for contemporary design in the new millennium.http://www.neufville.comhttp://www.neufville.comhttp://www.neufville.comhttp://www.neufville.comN-MediumHalbfettMediumMoyenMedio00000̴MediumMediumMdio!@54=89MedelN-{IMedia  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghjikmlnoqprsutvwxzy{}|~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ controlBS controlHT controlCR controlGS softhyphenAmacronamacronAbreveabreveAogonekaogonek Ccircumflex ccircumflex Cdotaccent cdotaccentDcarondcaronDcroatEmacronemacronEbreveebreve Edotaccent edotaccentEogonekeogonekEcaronecaron Gcircumflex gcircumflex Gdotaccent gdotaccentGcedillagcedilla Hcircumflex hcircumflexHbarhbarItildeitildeImacronimacronIbreveibreveIogonekiogonekIJij Jcircumflex jcircumflexKcedillakcedilla kgreenlandicLacutelacuteLcedillalcedillaLcaronlcaron Ldotaccent ldotaccentNacutenacuteNcedillancedillaNcaronncaron quoterightnOmacronomacronObreveobreve Ohungarumlaut ohungarumlautRacuteracuteRcedillarcedillaRcaronrcaronSacutesacute Scircumflex scircumflexTcedillatcedillaTcarontcaronTbartbarUtildeutildeUmacronumacronUbreveubreveUringuring Uhungarumlaut uhungarumlautUogonekuogonek Wcircumflex wcircumflex Ycircumflex ycircumflexZacutezacute Zdotaccent zdotaccent Scommaaccent scommaaccentgravecmbacutecmb circumflexcmbtildecmb macroncmbbrevecmb dotaccentcmb dieresiscmbringcmbhungarumlautcmbcaroncmb commaaccent cedillacmb ogonekcmbsoliduslongoverlaycmb Deltagreek OmegagreekzerowidthjoinerEuro divisionslashbulletoperatorDieresisGravejudgeupoakuniE770uniE773uniE774uniE772ashyeaicesurehungfeeCaronAcuteeatkickuniF6C3uniE784 HungarumlautMacronoozeuniE775dotlessj ) )*+,BCCDEF~ .<DFLTlatnliga PSM .<DFLTlatnkern Tb,:HBx 2\R|*`| 4 > T b l " , > X v @ v | @ Z HHHHHH\\\\\ ***  > > > > > > " b l l l l > X X X X X v v v v Z ZH >H >H > b bB l l l l 2  " " " > > >\ X\ X   RRR| @| @* v* v* v* v 4 4 4 0 V 0 jGg (d;=>@dddX\Ggb ^m^^LBf ZTLd5/!Z\jP"fhL*.68;<=>@yHIJKVX[\]^`qGgn(6=>@  (%/+2+6%%% (1;=>?@;(16HLPQVY\ (;=>@(*.6:;THLV\`)(V*.6:;<=>@}\`VVVNGgD#( *.6HLV\   (;=>?@oR(1HLV*.6;<=>@HLV\` (;=>@[#+!"(*.16:=\>\@dHJLP%Q%VY\]^`qn (TUWY#f!"(*.6:;\HLPVY\`qqqnq#d!"(}*.6:;\HLPVY\`qo}}}}}}o}no B*68HLV\`#!"(s*.6:;dH}L}PVuW\]q`ssssssfqn`]`Q]^`G]^`O5R5[]^_`GHLMDP+Q)S!V[JGR`G;%Q?HLV\]`W]^`;W]^`G;[ ]^_`G[`J\-!"HJKLMDOPQRSTUVWXY[J\]X^^_+`ZaG9 !F"+HLO)VGJG/! "HJLSV1! "HJLSVHJLVX)! "HJLSV (;=u>w@`((ITUWY]^` (f;'=?>?@5fffV (jKVY[]^jjjV (j;'=B>B@5jjjV(\;=w>@T/ (+ -.13579AHJ!LM$OP&RY([`067=>DJV\ajmnopqrstv |""$$&)./27<=??AAFGfhooդ'`^"oPK!D:j j jmdc/resources/icml.bst%% File: `icml2019.bst' %% A modification of `plainnl.bst' for use with natbib package %% %% Copyright 2010 Hal Daum\'e III %% Modified by J. Frnkranz %% - Changed labels from (X and Y, 2000) to (X & Y, 2000) %% - Changed References to last name first and abbreviated first names. %% Modified by Iain Murray 2018 (who suggests adopting a standard .bst in future...) %% - Made it actually use abbreviated first names %% %% Copyright 1993-2007 Patrick W Daly %% Max-Planck-Institut f\"ur Sonnensystemforschung %% Max-Planck-Str. 2 %% D-37191 Katlenburg-Lindau %% Germany %% E-mail: daly@mps.mpg.de %% %% This program can be redistributed and/or modified under the terms %% of the LaTeX Project Public License Distributed from CTAN %% archives in directory macros/latex/base/lppl.txt; either %% version 1 of the License, or any later version. %% % Version and source file information: % \ProvidesFile{icml2010.mbs}[2007/11/26 1.93 (PWD)] % % BibTeX `plainnat' family % version 0.99b for BibTeX versions 0.99a or later, % for LaTeX versions 2.09 and 2e. % % For use with the `natbib.sty' package; emulates the corresponding % member of the `plain' family, but with author-year citations. % % With version 6.0 of `natbib.sty', it may also be used for numerical % citations, while retaining the commands \citeauthor, \citefullauthor, % and \citeyear to print the corresponding information. % % For version 7.0 of `natbib.sty', the KEY field replaces missing % authors/editors, and the date is left blank in \bibitem. % % Includes field EID for the sequence/citation number of electronic journals % which is used instead of page numbers. % % Includes fields ISBN and ISSN. % % Includes field URL for Internet addresses. % % Includes field DOI for Digital Object Idenfifiers. % % Works best with the url.sty package of Donald Arseneau. % % Works with identical authors and year are further sorted by % citation key, to preserve any natural sequence. % ENTRY { address author booktitle chapter doi eid edition editor howpublished institution isbn issn journal key month note number organization pages publisher school series title type url volume year } {} { label extra.label sort.label short.list } INTEGERS { output.state before.all mid.sentence after.sentence after.block } FUNCTION {init.state.consts} { #0 'before.all := #1 'mid.sentence := #2 'after.sentence := #3 'after.block := } STRINGS { s t } FUNCTION {output.nonnull} { 's := output.state mid.sentence = { ", " * write$ } { output.state after.block = { add.period$ write$ newline$ "\newblock " write$ } { output.state before.all = 'write$ { add.period$ " " * write$ } if$ } if$ mid.sentence 'output.state := } if$ s } FUNCTION {output} { duplicate$ empty$ 'pop$ 'output.nonnull if$ } FUNCTION {output.check} { 't := duplicate$ empty$ { pop$ "empty " t * " in " * cite$ * warning$ } 'output.nonnull if$ } FUNCTION {fin.entry} { add.period$ write$ newline$ } FUNCTION {new.block} { output.state before.all = 'skip$ { after.block 'output.state := } if$ } FUNCTION {new.sentence} { output.state after.block = 'skip$ { output.state before.all = 'skip$ { after.sentence 'output.state := } if$ } if$ } FUNCTION {not} { { #0 } { #1 } if$ } FUNCTION {and} { 'skip$ { pop$ #0 } if$ } FUNCTION {or} { { pop$ #1 } 'skip$ if$ } FUNCTION {new.block.checka} { empty$ 'skip$ 'new.block if$ } FUNCTION {new.block.checkb} { empty$ swap$ empty$ and 'skip$ 'new.block if$ } FUNCTION {new.sentence.checka} { empty$ 'skip$ 'new.sentence if$ } FUNCTION {new.sentence.checkb} { empty$ swap$ empty$ and 'skip$ 'new.sentence if$ } FUNCTION {field.or.null} { duplicate$ empty$ { pop$ "" } 'skip$ if$ } FUNCTION {emphasize} { duplicate$ empty$ { pop$ "" } { "\emph{" swap$ * "}" * } if$ } INTEGERS { nameptr namesleft numnames } FUNCTION {format.names} { 's := #1 'nameptr := s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{vv~}{ll}{, jj}{, f.}" format.name$ 't := nameptr #1 > { namesleft #1 > { ", " * t * } { numnames #2 > { "," * } 'skip$ if$ t "others" = { " et~al." * } { " and " * t * } if$ } if$ } 't if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {format.key} { empty$ { key field.or.null } { "" } if$ } FUNCTION {format.authors} { author empty$ { "" } { author format.names } if$ } FUNCTION {format.editors} { editor empty$ { "" } { editor format.names editor num.names$ #1 > { " (eds.)" * } { " (ed.)" * } if$ } if$ } FUNCTION {format.isbn} { isbn empty$ { "" } { new.block "ISBN " isbn * } if$ } FUNCTION {format.issn} { issn empty$ { "" } { new.block "ISSN " issn * } if$ } FUNCTION {format.url} { url empty$ { "" } { new.block "URL \url{" url * "}" * } if$ } FUNCTION {format.doi} { doi empty$ { "" } { new.block "\doi{" doi * "}" * } if$ } FUNCTION {format.title} { title empty$ { "" } { title "t" change.case$ } if$ } FUNCTION {format.full.names} {'s := #1 'nameptr := s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{vv~}{ll}" format.name$ 't := nameptr #1 > { namesleft #1 > { ", " * t * } { numnames #2 > { "," * } 'skip$ if$ t "others" = { " et~al." * } { " and " * t * } if$ } if$ } 't if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {author.editor.full} { author empty$ { editor empty$ { "" } { editor format.full.names } if$ } { author format.full.names } if$ } FUNCTION {author.full} { author empty$ { "" } { author format.full.names } if$ } FUNCTION {editor.full} { editor empty$ { "" } { editor format.full.names } if$ } FUNCTION {make.full.names} { type$ "book" = type$ "inbook" = or 'author.editor.full { type$ "proceedings" = 'editor.full 'author.full if$ } if$ } FUNCTION {output.bibitem} { newline$ "\bibitem[" write$ label write$ ")" make.full.names duplicate$ short.list = { pop$ } { * } if$ "]{" * write$ cite$ write$ "}" write$ newline$ "" before.all 'output.state := } FUNCTION {n.dashify} { 't := "" { t empty$ not } { t #1 #1 substring$ "-" = { t #1 #2 substring$ "--" = not { "--" * t #2 global.max$ substring$ 't := } { { t #1 #1 substring$ "-" = } { "-" * t #2 global.max$ substring$ 't := } while$ } if$ } { t #1 #1 substring$ * t #2 global.max$ substring$ 't := } if$ } while$ } FUNCTION {format.date} { year duplicate$ empty$ { "empty year in " cite$ * warning$ pop$ "" } 'skip$ if$ month empty$ 'skip$ { month " " * swap$ * } if$ extra.label * } FUNCTION {format.btitle} { title emphasize } FUNCTION {tie.or.space.connect} { duplicate$ text.length$ #3 < { "~" } { " " } if$ swap$ * * } FUNCTION {either.or.check} { empty$ 'pop$ { "can't use both " swap$ * " fields in " * cite$ * warning$ } if$ } FUNCTION {format.bvolume} { volume empty$ { "" } { "volume" volume tie.or.space.connect series empty$ 'skip$ { " of " * series emphasize * } if$ "volume and number" number either.or.check } if$ } FUNCTION {format.number.series} { volume empty$ { number empty$ { series field.or.null } { output.state mid.sentence = { "number" } { "Number" } if$ number tie.or.space.connect series empty$ { "there's a number but no series in " cite$ * warning$ } { " in " * series * } if$ } if$ } { "" } if$ } FUNCTION {format.edition} { edition empty$ { "" } { output.state mid.sentence = { edition "l" change.case$ " edition" * } { edition "t" change.case$ " edition" * } if$ } if$ } INTEGERS { multiresult } FUNCTION {multi.page.check} { 't := #0 'multiresult := { multiresult not t empty$ not and } { t #1 #1 substring$ duplicate$ "-" = swap$ duplicate$ "," = swap$ "+" = or or { #1 'multiresult := } { t #2 global.max$ substring$ 't := } if$ } while$ multiresult } FUNCTION {format.pages} { pages empty$ { "" } { pages multi.page.check { "pp.\ " pages n.dashify tie.or.space.connect } { "pp.\ " pages tie.or.space.connect } if$ } if$ } FUNCTION {format.eid} { eid empty$ { "" } { "art." eid tie.or.space.connect } if$ } FUNCTION {format.vol.num.pages} { volume field.or.null number empty$ 'skip$ { "\penalty0 (" number * ")" * * volume empty$ { "there's a number but no volume in " cite$ * warning$ } 'skip$ if$ } if$ pages empty$ 'skip$ { duplicate$ empty$ { pop$ format.pages } { ":\penalty0 " * pages n.dashify * } if$ } if$ } FUNCTION {format.vol.num.eid} { volume field.or.null number empty$ 'skip$ { "\penalty0 (" number * ")" * * volume empty$ { "there's a number but no volume in " cite$ * warning$ } 'skip$ if$ } if$ eid empty$ 'skip$ { duplicate$ empty$ { pop$ format.eid } { ":\penalty0 " * eid * } if$ } if$ } FUNCTION {format.chapter.pages} { chapter empty$ 'format.pages { type empty$ { "chapter" } { type "l" change.case$ } if$ chapter tie.or.space.connect pages empty$ 'skip$ { ", " * format.pages * } if$ } if$ } FUNCTION {format.in.ed.booktitle} { booktitle empty$ { "" } { editor empty$ { "In " booktitle emphasize * } { "In " format.editors * ", " * booktitle emphasize * } if$ } if$ } FUNCTION {empty.misc.check} { author empty$ title empty$ howpublished empty$ month empty$ year empty$ note empty$ and and and and and key empty$ not and { "all relevant fields are empty in " cite$ * warning$ } 'skip$ if$ } FUNCTION {format.thesis.type} { type empty$ 'skip$ { pop$ type "t" change.case$ } if$ } FUNCTION {format.tr.number} { type empty$ { "Technical Report" } 'type if$ number empty$ { "t" change.case$ } { number tie.or.space.connect } if$ } FUNCTION {format.article.crossref} { key empty$ { journal empty$ { "need key or journal for " cite$ * " to crossref " * crossref * warning$ "" } { "In \emph{" journal * "}" * } if$ } { "In " } if$ " \citet{" * crossref * "}" * } FUNCTION {format.book.crossref} { volume empty$ { "empty volume in " cite$ * "'s crossref of " * crossref * warning$ "In " } { "Volume" volume tie.or.space.connect " of " * } if$ editor empty$ editor field.or.null author field.or.null = or { key empty$ { series empty$ { "need editor, key, or series for " cite$ * " to crossref " * crossref * warning$ "" * } { "\emph{" * series * "}" * } if$ } 'skip$ if$ } 'skip$ if$ " \citet{" * crossref * "}" * } FUNCTION {format.incoll.inproc.crossref} { editor empty$ editor field.or.null author field.or.null = or { key empty$ { booktitle empty$ { "need editor, key, or booktitle for " cite$ * " to crossref " * crossref * warning$ "" } { "In \emph{" booktitle * "}" * } if$ } { "In " } if$ } { "In " } if$ " \citet{" * crossref * "}" * } FUNCTION {article} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { journal emphasize "journal" output.check eid empty$ { format.vol.num.pages output } { format.vol.num.eid output } if$ format.date "year" output.check } { format.article.crossref output.nonnull eid empty$ { format.pages output } { format.eid output } if$ } if$ format.issn output format.doi output format.url output new.block note output fin.entry } FUNCTION {book} { output.bibitem author empty$ { format.editors "author and editor" output.check editor format.key output } { format.authors output.nonnull crossref missing$ { "author and editor" editor either.or.check } 'skip$ if$ } if$ new.block format.btitle "title" output.check crossref missing$ { format.bvolume output new.block format.number.series output new.sentence publisher "publisher" output.check address output } { new.block format.book.crossref output.nonnull } if$ format.edition output format.date "year" output.check format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {booklet} { output.bibitem format.authors output author format.key output new.block format.title "title" output.check howpublished address new.block.checkb howpublished output address output format.date output format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {inbook} { output.bibitem author empty$ { format.editors "author and editor" output.check editor format.key output } { format.authors output.nonnull crossref missing$ { "author and editor" editor either.or.check } 'skip$ if$ } if$ new.block format.btitle "title" output.check crossref missing$ { format.bvolume output format.chapter.pages "chapter and pages" output.check new.block format.number.series output new.sentence publisher "publisher" output.check address output } { format.chapter.pages "chapter and pages" output.check new.block format.book.crossref output.nonnull } if$ format.edition output format.date "year" output.check format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {incollection} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { format.in.ed.booktitle "booktitle" output.check format.bvolume output format.number.series output format.chapter.pages output new.sentence publisher "publisher" output.check address output format.edition output format.date "year" output.check } { format.incoll.inproc.crossref output.nonnull format.chapter.pages output } if$ format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {inproceedings} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block crossref missing$ { format.in.ed.booktitle "booktitle" output.check format.bvolume output format.number.series output format.pages output address empty$ { organization publisher new.sentence.checkb organization output publisher output format.date "year" output.check } { address output.nonnull format.date "year" output.check new.sentence organization output publisher output } if$ } { format.incoll.inproc.crossref output.nonnull format.pages output } if$ format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {conference} { inproceedings } FUNCTION {manual} { output.bibitem format.authors output author format.key output new.block format.btitle "title" output.check organization address new.block.checkb organization output address output format.edition output format.date output format.url output new.block note output fin.entry } FUNCTION {mastersthesis} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block "Master's thesis" format.thesis.type output.nonnull school "school" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {misc} { output.bibitem format.authors output author format.key output title howpublished new.block.checkb format.title output howpublished new.block.checka howpublished output format.date output format.issn output format.url output new.block note output fin.entry empty.misc.check } FUNCTION {phdthesis} { output.bibitem format.authors "author" output.check author format.key output new.block format.btitle "title" output.check new.block "PhD thesis" format.thesis.type output.nonnull school "school" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {proceedings} { output.bibitem format.editors output editor format.key output new.block format.btitle "title" output.check format.bvolume output format.number.series output address output format.date "year" output.check new.sentence organization output publisher output format.isbn output format.doi output format.url output new.block note output fin.entry } FUNCTION {techreport} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block format.tr.number output.nonnull institution "institution" output.check address output format.date "year" output.check format.url output new.block note output fin.entry } FUNCTION {unpublished} { output.bibitem format.authors "author" output.check author format.key output new.block format.title "title" output.check new.block note "note" output.check format.date output format.url output fin.entry } FUNCTION {default.type} { misc } MACRO {jan} {"January"} MACRO {feb} {"February"} MACRO {mar} {"March"} MACRO {apr} {"April"} MACRO {may} {"May"} MACRO {jun} {"June"} MACRO {jul} {"July"} MACRO {aug} {"August"} MACRO {sep} {"September"} MACRO {oct} {"October"} MACRO {nov} {"November"} MACRO {dec} {"December"} MACRO {acmcs} {"ACM Computing Surveys"} MACRO {acta} {"Acta Informatica"} MACRO {cacm} {"Communications of the ACM"} MACRO {ibmjrd} {"IBM Journal of Research and Development"} MACRO {ibmsj} {"IBM Systems Journal"} MACRO {ieeese} {"IEEE Transactions on Software Engineering"} MACRO {ieeetc} {"IEEE Transactions on Computers"} MACRO {ieeetcad} {"IEEE Transactions on Computer-Aided Design of Integrated Circuits"} MACRO {ipl} {"Information Processing Letters"} MACRO {jacm} {"Journal of the ACM"} MACRO {jcss} {"Journal of Computer and System Sciences"} MACRO {scp} {"Science of Computer Programming"} MACRO {sicomp} {"SIAM Journal on Computing"} MACRO {tocs} {"ACM Transactions on Computer Systems"} MACRO {tods} {"ACM Transactions on Database Systems"} MACRO {tog} {"ACM Transactions on Graphics"} MACRO {toms} {"ACM Transactions on Mathematical Software"} MACRO {toois} {"ACM Transactions on Office Information Systems"} MACRO {toplas} {"ACM Transactions on Programming Languages and Systems"} MACRO {tcs} {"Theoretical Computer Science"} READ FUNCTION {sortify} { purify$ "l" change.case$ } INTEGERS { len } FUNCTION {chop.word} { 's := 'len := s #1 len substring$ = { s len #1 + global.max$ substring$ } 's if$ } FUNCTION {format.lab.names} { 's := s #1 "{vv~}{ll}" format.name$ s num.names$ duplicate$ #2 > { pop$ " et~al." * } { #2 < 'skip$ { s #2 "{ff }{vv }{ll}{ jj}" format.name$ "others" = { " et~al." * } { " \& " * s #2 "{vv~}{ll}" format.name$ * } if$ } if$ } if$ } FUNCTION {author.key.label} { author empty$ { key empty$ { cite$ #1 #3 substring$ } 'key if$ } { author format.lab.names } if$ } FUNCTION {author.editor.key.label} { author empty$ { editor empty$ { key empty$ { cite$ #1 #3 substring$ } 'key if$ } { editor format.lab.names } if$ } { author format.lab.names } if$ } FUNCTION {author.key.organization.label} { author empty$ { key empty$ { organization empty$ { cite$ #1 #3 substring$ } { "The " #4 organization chop.word #3 text.prefix$ } if$ } 'key if$ } { author format.lab.names } if$ } FUNCTION {editor.key.organization.label} { editor empty$ { key empty$ { organization empty$ { cite$ #1 #3 substring$ } { "The " #4 organization chop.word #3 text.prefix$ } if$ } 'key if$ } { editor format.lab.names } if$ } FUNCTION {calc.short.authors} { type$ "book" = type$ "inbook" = or 'author.editor.key.label { type$ "proceedings" = 'editor.key.organization.label { type$ "manual" = 'author.key.organization.label 'author.key.label if$ } if$ } if$ 'short.list := } FUNCTION {calc.label} { calc.short.authors short.list "(" * year duplicate$ empty$ short.list key field.or.null = or { pop$ "" } 'skip$ if$ * 'label := } FUNCTION {sort.format.names} { 's := #1 'nameptr := "" s num.names$ 'numnames := numnames 'namesleft := { namesleft #0 > } { s nameptr "{vv{ } }{ll{ }}{ f{ }}{ jj{ }}" format.name$ 't := nameptr #1 > { " " * namesleft #1 = t "others" = and { "zzzzz" * } { numnames #2 > nameptr #2 = and { "zz" * year field.or.null * " " * } 'skip$ if$ t sortify * } if$ } { t sortify * } if$ nameptr #1 + 'nameptr := namesleft #1 - 'namesleft := } while$ } FUNCTION {sort.format.title} { 't := "A " #2 "An " #3 "The " #4 t chop.word chop.word chop.word sortify #1 global.max$ substring$ } FUNCTION {author.sort} { author empty$ { key empty$ { "to sort, need author or key in " cite$ * warning$ "" } { key sortify } if$ } { author sort.format.names } if$ } FUNCTION {author.editor.sort} { author empty$ { editor empty$ { key empty$ { "to sort, need author, editor, or key in " cite$ * warning$ "" } { key sortify } if$ } { editor sort.format.names } if$ } { author sort.format.names } if$ } FUNCTION {author.organization.sort} { author empty$ { organization empty$ { key empty$ { "to sort, need author, organization, or key in " cite$ * warning$ "" } { key sortify } if$ } { "The " #4 organization chop.word sortify } if$ } { author sort.format.names } if$ } FUNCTION {editor.organization.sort} { editor empty$ { organization empty$ { key empty$ { "to sort, need editor, organization, or key in " cite$ * warning$ "" } { key sortify } if$ } { "The " #4 organization chop.word sortify } if$ } { editor sort.format.names } if$ } FUNCTION {presort} { calc.label label sortify " " * type$ "book" = type$ "inbook" = or 'author.editor.sort { type$ "proceedings" = 'editor.organization.sort { type$ "manual" = 'author.organization.sort 'author.sort if$ } if$ } if$ " " * year field.or.null sortify * " " * cite$ * #1 entry.max$ substring$ 'sort.label := sort.label * #1 entry.max$ substring$ 'sort.key$ := } ITERATE {presort} SORT STRINGS { longest.label last.label next.extra } INTEGERS { longest.label.width last.extra.num number.label } FUNCTION {initialize.longest.label} { "" 'longest.label := #0 int.to.chr$ 'last.label := "" 'next.extra := #0 'longest.label.width := #0 'last.extra.num := #0 'number.label := } FUNCTION {forward.pass} { last.label label = { last.extra.num #1 + 'last.extra.num := last.extra.num int.to.chr$ 'extra.label := } { "a" chr.to.int$ 'last.extra.num := "" 'extra.label := label 'last.label := } if$ number.label #1 + 'number.label := } FUNCTION {reverse.pass} { next.extra "b" = { "a" 'extra.label := } 'skip$ if$ extra.label 'next.extra := extra.label duplicate$ empty$ 'skip$ { "{\natexlab{" swap$ * "}}" * } if$ 'extra.label := label extra.label * 'label := } EXECUTE {initialize.longest.label} ITERATE {forward.pass} REVERSE {reverse.pass} FUNCTION {bib.sort.order} { sort.label 'sort.key$ := } ITERATE {bib.sort.order} SORT FUNCTION {begin.bib} { preamble$ empty$ 'skip$ { preamble$ write$ newline$ } if$ "\begin{thebibliography}{" number.label int.to.str$ * "}" * write$ newline$ "\providecommand{\natexlab}[1]{#1}" write$ newline$ "\providecommand{\url}[1]{\texttt{#1}}" write$ newline$ "\expandafter\ifx\csname urlstyle\endcsname\relax" write$ newline$ " \providecommand{\doi}[1]{doi: #1}\else" write$ newline$ " \providecommand{\doi}{doi: \begingroup \urlstyle{rm}\Url}\fi" write$ newline$ } EXECUTE {begin.bib} EXECUTE {init.state.consts} ITERATE {call.type$} FUNCTION {end.bib} { newline$ "\end{thebibliography}" write$ newline$ } EXECUTE {end.bib} PK!Liimdc/resources/icml.sty% File: icml2019.sty (LaTeX style file for ICML-2019, version of 2019-01-07) % This file contains the LaTeX formatting parameters for a two-column % conference proceedings that is 8.5 inches wide by 11 inches high. % % Modified by Iain Murray 2018: changed years, location. Remove affiliation notes when anonymous. % Move times dependency from .tex to .sty so fewer people delete it. % % Modified by Daniel Roy 2017: changed byline to use footnotes for affiliations, and removed emails % % Modified by Percy Liang 12/2/2013: changed the year, location from the previous template for ICML 2014 % Modified by Fei Sha 9/2/2013: changed the year, location form the previous template for ICML 2013 % % Modified by Fei Sha 4/24/2013: (1) remove the extra whitespace after the first author's email address (in %the camera-ready version) (2) change the Proceeding ... of ICML 2010 to 2014 so PDF's metadata will show up % correctly % % Modified by Sanjoy Dasgupta, 2013: changed years, location % % Modified by Francesco Figari, 2012: changed years, location % % Modified by Christoph Sawade and Tobias Scheffer, 2011: added line % numbers, changed years % % Modified by Hal Daume III, 2010: changed years, added hyperlinks % % Modified by Kiri Wagstaff, 2009: changed years % % Modified by Sam Roweis, 2008: changed years % % Modified by Ricardo Silva, 2007: update of the ifpdf verification % % Modified by Prasad Tadepalli and Andrew Moore, merely changing years. % % Modified by Kristian Kersting, 2005, based on Jennifer Dy's 2004 version % - running title. If the original title is to long or is breaking a line, % use \icmltitlerunning{...} in the preamble to supply a shorter form. % Added fancyhdr package to get a running head. % - Updated to store the page size because pdflatex does compile the % page size into the pdf. % % Hacked by Terran Lane, 2003: % - Updated to use LaTeX2e style file conventions (ProvidesPackage, % etc.) % - Added an ``appearing in'' block at the base of the first column % (thus keeping the ``appearing in'' note out of the bottom margin % where the printer should strip in the page numbers). % - Added a package option [accepted] that selects between the ``Under % review'' notice (default, when no option is specified) and the % ``Appearing in'' notice (for use when the paper has been accepted % and will appear). % % Originally created as: ml2k.sty (LaTeX style file for ICML-2000) % by P. Langley (12/23/99) %%%%%%%%%%%%%%%%%%%% %% This version of the style file supports both a ``review'' version %% and a ``final/accepted'' version. The difference is only in the %% text that appears in the note at the bottom of the first column of %% the first page. The default behavior is to print a note to the %% effect that the paper is under review and don't distribute it. The %% final/accepted version prints an ``Appearing in'' note. To get the %% latter behavior, in the calling file change the ``usepackage'' line %% from: %% \usepackage{icml2019} %% to %% \usepackage[accepted]{icml2019} %%%%%%%%%%%%%%%%%%%% \NeedsTeXFormat{LaTeX2e} \ProvidesPackage{icml2019}[2019/01/07 v2.0 ICML Conference Style File] % Before 2018, \usepackage{times} was in the example TeX, but inevitably % not everybody did it. \RequirePackage{times} % Use fancyhdr package \RequirePackage{fancyhdr} \RequirePackage{color} \RequirePackage{algorithm} \RequirePackage{algorithmic} \RequirePackage{natbib} \RequirePackage{eso-pic} % used by \AddToShipoutPicture \RequirePackage{forloop} %%%%%%%% Options \DeclareOption{accepted}{% \renewcommand{\Notice@String}{\ICML@appearing} \gdef\isaccepted{1} } \DeclareOption{nohyperref}{% \gdef\nohyperref{1} } \ifdefined\nohyperref\else\ifdefined\hypersetup \definecolor{mydarkblue}{rgb}{0,0.08,0.45} \hypersetup{ % pdftitle={}, pdfauthor={}, pdfsubject={ICML 2019 Workshop on Uncertainty and Robustness in Deep Learning}, pdfkeywords={}, pdfborder=0 0 0, pdfpagemode=UseNone, colorlinks=true, linkcolor=mydarkblue, citecolor=mydarkblue, filecolor=mydarkblue, urlcolor=mydarkblue, pdfview=FitH} \ifdefined\isaccepted \else \hypersetup{pdfauthor={Anonymous Submission}} \fi \fi\fi %%%%%%%%%%%%%%%%%%%% % This string is printed at the bottom of the page for the % final/accepted version of the ``appearing in'' note. Modify it to % change that text. %%%%%%%%%%%%%%%%%%%% \newcommand{\ICML@appearing}{Presented at the ICML 2019 Workshop on Uncertainty and Robustness in Deep Learning. Copyright 2019 by the author(s).} %%%%%%%%%%%%%%%%%%%% % This string is printed at the bottom of the page for the draft/under % review version of the ``appearing in'' note. Modify it to change % that text. %%%%%%%%%%%%%%%%%%%% \newcommand{\Notice@String}{Preliminary work. Under review at the ICML 2019 Workshop on Uncertainty and Robustness in Deep Learning\@. Do not distribute.} % Cause the declared options to actually be parsed and activated \ProcessOptions\relax % Uncomment the following for debugging. It will cause LaTeX to dump % the version of the ``appearing in'' string that will actually appear % in the document. %\typeout{>> Notice string='\Notice@String'} % Change citation commands to be more like old ICML styles \newcommand{\yrcite}[1]{\citeyearpar{#1}} \renewcommand{\cite}[1]{\citep{#1}} %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% % to ensure the letter format is used. pdflatex does compile the % page size into the pdf. This is done using \pdfpagewidth and % \pdfpageheight. As Latex does not know this directives, we first % check whether pdflatex or latex is used. % % Kristian Kersting 2005 % % in order to account for the more recent use of pdfetex as the default % compiler, I have changed the pdf verification. % % Ricardo Silva 2007 %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% \paperwidth=8.5in \paperheight=11in % old PDFLaTex verification, circa 2005 % %\newif\ifpdf\ifx\pdfoutput\undefined % \pdffalse % we are not running PDFLaTeX %\else % \pdfoutput=1 % we are running PDFLaTeX % \pdftrue %\fi \newif\ifpdf %adapted from ifpdf.sty \ifx\pdfoutput\undefined \else \ifx\pdfoutput\relax \else \ifcase\pdfoutput \else \pdftrue \fi \fi \fi \ifpdf % \pdfpagewidth=\paperwidth % \pdfpageheight=\paperheight \setlength{\pdfpagewidth}{8.5in} \setlength{\pdfpageheight}{11in} \fi % Physical page layout \evensidemargin -0.23in \oddsidemargin -0.23in \setlength\textheight{9.0in} \setlength\textwidth{6.75in} \setlength\columnsep{0.25in} \setlength\headheight{10pt} \setlength\headsep{10pt} \addtolength{\topmargin}{-20pt} \addtolength{\topmargin}{-0.29in} % Historically many authors tried to include packages like geometry or fullpage, % which change the page layout. It either makes the proceedings inconsistent, or % wastes organizers' time chasing authors. So let's nip these problems in the % bud here. -- Iain Murray 2018. %\RequirePackage{printlen} \AtBeginDocument{% % To get the numbers below, include printlen package above and see lengths like this: %\printlength\oddsidemargin\\ %\printlength\headheight\\ %\printlength\textheight\\ %\printlength\marginparsep\\ %\printlength\footskip\\ %\printlength\hoffset\\ %\printlength\paperwidth\\ %\printlength\topmargin\\ %\printlength\headsep\\ %\printlength\textwidth\\ %\printlength\marginparwidth\\ %\printlength\marginparpush\\ %\printlength\voffset\\ %\printlength\paperheight\\ % \newif\ifmarginsmessedwith \marginsmessedwithfalse \ifdim\oddsidemargin=-16.62178pt \else oddsidemargin has been altered.\\ \marginsmessedwithtrue\fi \ifdim\headheight=10.0pt \else headheight has been altered.\\ \marginsmessedwithtrue\fi \ifdim\textheight=650.43pt \else textheight has been altered.\\ \marginsmessedwithtrue\fi \ifdim\marginparsep=11.0pt \else marginparsep has been altered.\\ \marginsmessedwithtrue\fi \ifdim\footskip=0.0pt \else footskip has been altered.\\ \marginsmessedwithtrue\fi \ifdim\hoffset=0.0pt \else hoffset has been altered.\\ \marginsmessedwithtrue\fi \ifdim\paperwidth=614.295pt \else paperwidth has been altered.\\ \marginsmessedwithtrue\fi \ifdim\topmargin=-24.95781pt \else topmargin has been altered.\\ \marginsmessedwithtrue\fi \ifdim\headsep=10.0pt \else headsep has been altered.\\ \marginsmessedwithtrue\fi \ifdim\textwidth=487.8225pt \else textwidth has been altered.\\ \marginsmessedwithtrue\fi \ifdim\marginparwidth=65.0pt \else marginparwidth has been altered.\\ \marginsmessedwithtrue\fi \ifdim\marginparpush=5.0pt \else marginparpush has been altered.\\ \marginsmessedwithtrue\fi \ifdim\voffset=0.0pt \else voffset has been altered.\\ \marginsmessedwithtrue\fi \ifdim\paperheight=794.96999pt \else paperheight has been altered.\\ \marginsmessedwithtrue\fi \ifmarginsmessedwith \textbf{\large \em The page layout violates the ICML style.} Please do not change the page layout, or include packages like geometry, savetrees, or fullpage, which change it for you. We're not able to reliably undo arbitrary changes to the style. Please remove the offending package(s), or layout-changing commands and try again. \fi} %% The following is adapted from code in the acmconf.sty conference %% style file. The constants in it are somewhat magical, and appear %% to work well with the two-column format on US letter paper that %% ICML uses, but will break if you change that layout, or if you use %% a longer block of text for the copyright notice string. Fiddle with %% them if necessary to get the block to fit/look right. %% %% -- Terran Lane, 2003 %% %% The following comments are included verbatim from acmconf.sty: %% %%% This section (written by KBT) handles the 1" box in the lower left %%% corner of the left column of the first page by creating a picture, %%% and inserting the predefined string at the bottom (with a negative %%% displacement to offset the space allocated for a non-existent %%% caption). %%% \def\ftype@copyrightbox{8} \def\@copyrightspace{ % Create a float object positioned at the bottom of the column. Note % that because of the mystical nature of floats, this has to be called % before the first column is populated with text (e.g., from the title % or abstract blocks). Otherwise, the text will force the float to % the next column. -- TDRL. \@float{copyrightbox}[b] \begin{center} \setlength{\unitlength}{1pc} \begin{picture}(20,1.5) % Create a line separating the main text from the note block. % 4.818pc==0.8in. \put(0,2.5){\line(1,0){4.818}} % Insert the text string itself. Note that the string has to be % enclosed in a parbox -- the \put call needs a box object to % position. Without the parbox, the text gets splattered across the % bottom of the page semi-randomly. The 19.75pc distance seems to be % the width of the column, though I can't find an appropriate distance % variable to substitute here. -- TDRL. \put(0,0){\parbox[b]{19.75pc}{\small \Notice@String}} \end{picture} \end{center} \end@float} % Note: A few Latex versions need the next line instead of the former. % \addtolength{\topmargin}{0.3in} % \setlength\footheight{0pt} \setlength\footskip{0pt} %\pagestyle{empty} \flushbottom \twocolumn \sloppy % Clear out the addcontentsline command \def\addcontentsline#1#2#3{} %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%% commands for formatting paper title, author names, and addresses. %%start%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%% title as running head -- Kristian Kersting 2005 %%%%%%%%%%%%% %\makeatletter %\newtoks\mytoksa %\newtoks\mytoksb %\newcommand\addtomylist[2]{% % \mytoksa\expandafter{#1}% % \mytoksb{#2}% % \edef#1{\the\mytoksa\the\mytoksb}% %} %\makeatother % box to check the size of the running head \newbox\titrun % general page style \pagestyle{fancy} \fancyhf{} \fancyhead{} \fancyfoot{} % set the width of the head rule to 1 point \renewcommand{\headrulewidth}{1pt} % definition to set the head as running head in the preamble \def\icmltitlerunning#1{\gdef\@icmltitlerunning{#1}} % main definition adapting \icmltitle from 2004 \long\def\icmltitle#1{% %check whether @icmltitlerunning exists % if not \icmltitle is used as running head \ifx\undefined\@icmltitlerunning% \gdef\@icmltitlerunning{#1} \fi %add it to pdf information \ifdefined\nohyperref\else\ifdefined\hypersetup \hypersetup{pdftitle={#1}} \fi\fi %get the dimension of the running title \global\setbox\titrun=\vbox{\small\bf\@icmltitlerunning} % error flag \gdef\@runningtitleerror{0} % running title too long \ifdim\wd\titrun>\textwidth% {\gdef\@runningtitleerror{1}}% % running title breaks a line \else\ifdim\ht\titrun>6.25pt {\gdef\@runningtitleerror{2}}% \fi \fi % if there is somthing wrong with the running title \ifnum\@runningtitleerror>0 \typeout{}% \typeout{}% \typeout{*******************************************************}% \typeout{Title exceeds size limitations for running head.}% \typeout{Please supply a shorter form for the running head} \typeout{with \string\icmltitlerunning{...}\space prior to \string\begin{document}}% \typeout{*******************************************************}% \typeout{}% \typeout{}% % set default running title \chead{\small\bf Title Suppressed Due to Excessive Size}% \else % 'everything' fine, set provided running title \chead{\small\bf\@icmltitlerunning}% \fi % no running title on the first page of the paper \thispagestyle{empty} %%%%%%%%%%%%%%%%%%%% Kristian Kersting %%%%%%%%%%%%%%%%%%%%%%%%% %end%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% {\center\baselineskip 18pt \toptitlebar{\Large\bf #1}\bottomtitlebar} } \gdef\icmlfullauthorlist{} \newcommand\addstringtofullauthorlist{\g@addto@macro\icmlfullauthorlist} \newcommand\addtofullauthorlist[1]{% \ifdefined\icmlanyauthors% \addstringtofullauthorlist{, #1}% \else% \addstringtofullauthorlist{#1}% \gdef\icmlanyauthors{1}% \fi% \ifdefined\nohyperref\else\ifdefined\hypersetup% \hypersetup{pdfauthor=\icmlfullauthorlist}% \fi\fi} \def\toptitlebar{\hrule height1pt \vskip .25in} \def\bottomtitlebar{\vskip .22in \hrule height1pt \vskip .3in} \newenvironment{icmlauthorlist}{% \setlength\topsep{0pt} \setlength\parskip{0pt} \begin{center} }{% \end{center} } \newcounter{@affiliationcounter} \newcommand{\@pa}[1]{% % ``#1'' \ifcsname the@affil#1\endcsname % do nothing \else \ifcsname @icmlsymbol#1\endcsname % nothing \else \stepcounter{@affiliationcounter}% \newcounter{@affil#1}% \setcounter{@affil#1}{\value{@affiliationcounter}}% \fi \fi% \ifcsname @icmlsymbol#1\endcsname \textsuperscript{\csname @icmlsymbol#1\endcsname\,}% \else %\expandafter\footnotemark[\arabic{@affil#1}\,]% \textsuperscript{\arabic{@affil#1}\,}% \fi } %\newcommand{\icmlauthor}[2]{% %\addtofullauthorlist{#1}% %#1\@for\theaffil:=#2\do{\pa{\theaffil}}% %} \newcommand{\icmlauthor}[2]{% \ifdefined\isaccepted \mbox{\bf #1}\,\@for\theaffil:=#2\do{\@pa{\theaffil}} \addtofullauthorlist{#1}% \else \ifdefined\@icmlfirsttime \else \gdef\@icmlfirsttime{1} \mbox{\bf Anonymous Authors}\@pa{@anon} \addtofullauthorlist{Anonymous Authors} \fi \fi } \newcommand{\icmlsetsymbol}[2]{% \expandafter\gdef\csname @icmlsymbol#1\endcsname{#2} } \newcommand{\icmlaffiliation}[2]{% \ifdefined\isaccepted \ifcsname the@affil#1\endcsname \expandafter\gdef\csname @affilname\csname the@affil#1\endcsname\endcsname{#2}% \else {\bf AUTHORERR: Error in use of \textbackslash{}icmlaffiliation command. Label ``#1'' not mentioned in some \textbackslash{}icmlauthor\{author name\}\{labels here\} command beforehand. } \typeout{}% \typeout{}% \typeout{*******************************************************}% \typeout{Affiliation label undefined. }% \typeout{Make sure \string\icmlaffiliation\space follows } \typeout{all of \string\icmlauthor\space commands}% \typeout{*******************************************************}% \typeout{}% \typeout{}% \fi \else % \isaccepted % can be called multiple times... it's idempotent \expandafter\gdef\csname @affilname1\endcsname{Anonymous Institution, Anonymous City, Anonymous Region, Anonymous Country} \fi } \newcommand{\icmlcorrespondingauthor}[2]{ \ifdefined\isaccepted \ifdefined\icmlcorrespondingauthor@text \g@addto@macro\icmlcorrespondingauthor@text{, #1 \textless{}#2\textgreater{}} \else \gdef\icmlcorrespondingauthor@text{#1 \textless{}#2\textgreater{}} \fi \else \gdef\icmlcorrespondingauthor@text{Anonymous Author \textless{}anon.email@domain.com\textgreater{}} \fi } \newcommand{\icmlEqualContribution}{\textsuperscript{*}Equal contribution } \newcounter{@affilnum} \newcommand{\printAffiliationsAndNotice}[1]{% \stepcounter{@affiliationcounter}% {\let\thefootnote\relax\footnotetext{\hspace*{-\footnotesep}\ifdefined\isaccepted #1\fi% \forloop{@affilnum}{1}{\value{@affilnum} < \value{@affiliationcounter}}{ \textsuperscript{\arabic{@affilnum}}\ifcsname @affilname\the@affilnum\endcsname% \csname @affilname\the@affilnum\endcsname% \else {\bf AUTHORERR: Missing \textbackslash{}icmlaffiliation.} \fi }. \ifdefined\icmlcorrespondingauthor@text Correspondence to: \icmlcorrespondingauthor@text. \else {\bf AUTHORERR: Missing \textbackslash{}icmlcorrespondingauthor.} \fi \ \\ \Notice@String } } } %\makeatother \long\def\icmladdress#1{% {\bf The \textbackslash{}icmladdress command is no longer used. See the example\_paper PDF .tex for usage of \textbackslash{}icmlauther and \textbackslash{}icmlaffiliation.} } %% keywords as first class citizens \def\icmlkeywords#1{% % \ifdefined\isaccepted \else % \par {\bf Keywords:} #1% % \fi % \ifdefined\nohyperref\else\ifdefined\hypersetup % \hypersetup{pdfkeywords={#1}} % \fi\fi % \ifdefined\isaccepted \else % \par {\bf Keywords:} #1% % \fi \ifdefined\nohyperref\else\ifdefined\hypersetup \hypersetup{pdfkeywords={#1}} \fi\fi } % modification to natbib citations \setcitestyle{authoryear,round,citesep={;},aysep={,},yysep={;}} % Redefinition of the abstract environment. \renewenvironment{abstract} {% % Insert the ``appearing in'' copyright notice. %\@copyrightspace \centerline{\large\bf Abstract} \vspace{-0.12in}\begin{quote}} {\par\end{quote}\vskip 0.12in} % numbered section headings with different treatment of numbers \def\@startsection#1#2#3#4#5#6{\if@noskipsec \leavevmode \fi \par \@tempskipa #4\relax \@afterindenttrue % Altered the following line to indent a section's first paragraph. % \ifdim \@tempskipa <\z@ \@tempskipa -\@tempskipa \@afterindentfalse\fi \ifdim \@tempskipa <\z@ \@tempskipa -\@tempskipa \fi \if@nobreak \everypar{}\else \addpenalty{\@secpenalty}\addvspace{\@tempskipa}\fi \@ifstar {\@ssect{#3}{#4}{#5}{#6}}{\@dblarg{\@sict{#1}{#2}{#3}{#4}{#5}{#6}}}} \def\@sict#1#2#3#4#5#6[#7]#8{\ifnum #2>\c@secnumdepth \def\@svsec{}\else \refstepcounter{#1}\edef\@svsec{\csname the#1\endcsname}\fi \@tempskipa #5\relax \ifdim \@tempskipa>\z@ \begingroup #6\relax \@hangfrom{\hskip #3\relax\@svsec.~}{\interlinepenalty \@M #8\par} \endgroup \csname #1mark\endcsname{#7}\addcontentsline {toc}{#1}{\ifnum #2>\c@secnumdepth \else \protect\numberline{\csname the#1\endcsname}\fi #7}\else \def\@svsechd{#6\hskip #3\@svsec #8\csname #1mark\endcsname {#7}\addcontentsline {toc}{#1}{\ifnum #2>\c@secnumdepth \else \protect\numberline{\csname the#1\endcsname}\fi #7}}\fi \@xsect{#5}} \def\@sect#1#2#3#4#5#6[#7]#8{\ifnum #2>\c@secnumdepth \def\@svsec{}\else \refstepcounter{#1}\edef\@svsec{\csname the#1\endcsname\hskip 0.4em }\fi \@tempskipa #5\relax \ifdim \@tempskipa>\z@ \begingroup #6\relax \@hangfrom{\hskip #3\relax\@svsec}{\interlinepenalty \@M #8\par} \endgroup \csname #1mark\endcsname{#7}\addcontentsline {toc}{#1}{\ifnum #2>\c@secnumdepth \else \protect\numberline{\csname the#1\endcsname}\fi #7}\else \def\@svsechd{#6\hskip #3\@svsec #8\csname #1mark\endcsname {#7}\addcontentsline {toc}{#1}{\ifnum #2>\c@secnumdepth \else \protect\numberline{\csname the#1\endcsname}\fi #7}}\fi \@xsect{#5}} % section headings with less space above and below them \def\thesection {\arabic{section}} \def\thesubsection {\thesection.\arabic{subsection}} \def\section{\@startsection{section}{1}{\z@}{-0.12in}{0.02in} {\large\bf\raggedright}} \def\subsection{\@startsection{subsection}{2}{\z@}{-0.10in}{0.01in} {\normalsize\bf\raggedright}} \def\subsubsection{\@startsection{subsubsection}{3}{\z@}{-0.08in}{0.01in} {\normalsize\sc\raggedright}} \def\paragraph{\@startsection{paragraph}{4}{\z@}{1.5ex plus 0.5ex minus .2ex}{-1em}{\normalsize\bf}} \def\subparagraph{\@startsection{subparagraph}{5}{\z@}{1.5ex plus 0.5ex minus .2ex}{-1em}{\normalsize\bf}} % Footnotes \footnotesep 6.65pt % \skip\footins 9pt \def\footnoterule{\kern-3pt \hrule width 0.8in \kern 2.6pt } \setcounter{footnote}{0} % Lists and paragraphs \parindent 0pt \topsep 4pt plus 1pt minus 2pt \partopsep 1pt plus 0.5pt minus 0.5pt \itemsep 2pt plus 1pt minus 0.5pt \parsep 2pt plus 1pt minus 0.5pt \parskip 6pt \leftmargin 2em \leftmargini\leftmargin \leftmarginii 2em \leftmarginiii 1.5em \leftmarginiv 1.0em \leftmarginv .5em \leftmarginvi .5em \labelwidth\leftmargini\advance\labelwidth-\labelsep \labelsep 5pt \def\@listi{\leftmargin\leftmargini} \def\@listii{\leftmargin\leftmarginii \labelwidth\leftmarginii\advance\labelwidth-\labelsep \topsep 2pt plus 1pt minus 0.5pt \parsep 1pt plus 0.5pt minus 0.5pt \itemsep \parsep} \def\@listiii{\leftmargin\leftmarginiii \labelwidth\leftmarginiii\advance\labelwidth-\labelsep \topsep 1pt plus 0.5pt minus 0.5pt \parsep \z@ \partopsep 0.5pt plus 0pt minus 0.5pt \itemsep \topsep} \def\@listiv{\leftmargin\leftmarginiv \labelwidth\leftmarginiv\advance\labelwidth-\labelsep} \def\@listv{\leftmargin\leftmarginv \labelwidth\leftmarginv\advance\labelwidth-\labelsep} \def\@listvi{\leftmargin\leftmarginvi \labelwidth\leftmarginvi\advance\labelwidth-\labelsep} \abovedisplayskip 7pt plus2pt minus5pt% \belowdisplayskip \abovedisplayskip \abovedisplayshortskip 0pt plus3pt% \belowdisplayshortskip 4pt plus3pt minus3pt% % Less leading in most fonts (due to the narrow columns) % The choices were between 1-pt and 1.5-pt leading \def\@normalsize{\@setsize\normalsize{11pt}\xpt\@xpt} \def\small{\@setsize\small{10pt}\ixpt\@ixpt} \def\footnotesize{\@setsize\footnotesize{10pt}\ixpt\@ixpt} \def\scriptsize{\@setsize\scriptsize{8pt}\viipt\@viipt} \def\tiny{\@setsize\tiny{7pt}\vipt\@vipt} \def\large{\@setsize\large{14pt}\xiipt\@xiipt} \def\Large{\@setsize\Large{16pt}\xivpt\@xivpt} \def\LARGE{\@setsize\LARGE{20pt}\xviipt\@xviipt} \def\huge{\@setsize\huge{23pt}\xxpt\@xxpt} \def\Huge{\@setsize\Huge{28pt}\xxvpt\@xxvpt} % Revised formatting for figure captions and table titles. \newsavebox\newcaptionbox\newdimen\newcaptionboxwid \long\def\@makecaption#1#2{ \vskip 10pt \baselineskip 11pt \setbox\@tempboxa\hbox{#1. #2} \ifdim \wd\@tempboxa >\hsize \sbox{\newcaptionbox}{\small\sl #1.~} \newcaptionboxwid=\wd\newcaptionbox \usebox\newcaptionbox {\footnotesize #2} % \usebox\newcaptionbox {\small #2} \else \centerline{{\small\sl #1.} {\small #2}} \fi} \def\fnum@figure{Figure \thefigure} \def\fnum@table{Table \thetable} % Strut macros for skipping spaces above and below text in tables. \def\abovestrut#1{\rule[0in]{0in}{#1}\ignorespaces} \def\belowstrut#1{\rule[-#1]{0in}{#1}\ignorespaces} \def\abovespace{\abovestrut{0.20in}} \def\aroundspace{\abovestrut{0.20in}\belowstrut{0.10in}} \def\belowspace{\belowstrut{0.10in}} % Various personal itemization commands. \def\texitem#1{\par\noindent\hangindent 12pt \hbox to 12pt {\hss #1 ~}\ignorespaces} \def\icmlitem{\texitem{$\bullet$}} % To comment out multiple lines of text. \long\def\comment#1{} %% Line counter (not in final version). Adapted from NIPS style file by Christoph Sawade % Vertical Ruler % This code is, largely, from the CVPR 2010 conference style file % ----- define vruler \makeatletter \newbox\icmlrulerbox \newcount\icmlrulercount \newdimen\icmlruleroffset \newdimen\cv@lineheight \newdimen\cv@boxheight \newbox\cv@tmpbox \newcount\cv@refno \newcount\cv@tot % NUMBER with left flushed zeros \fillzeros[] \newcount\cv@tmpc@ \newcount\cv@tmpc \def\fillzeros[#1]#2{\cv@tmpc@=#2\relax\ifnum\cv@tmpc@<0\cv@tmpc@=-\cv@tmpc@\fi \cv@tmpc=1 % \loop\ifnum\cv@tmpc@<10 \else \divide\cv@tmpc@ by 10 \advance\cv@tmpc by 1 \fi \ifnum\cv@tmpc@=10\relax\cv@tmpc@=11\relax\fi \ifnum\cv@tmpc@>10 \repeat \ifnum#2<0\advance\cv@tmpc1\relax-\fi \loop\ifnum\cv@tmpc<#1\relax0\advance\cv@tmpc1\relax\fi \ifnum\cv@tmpc<#1 \repeat \cv@tmpc@=#2\relax\ifnum\cv@tmpc@<0\cv@tmpc@=-\cv@tmpc@\fi \relax\the\cv@tmpc@}% % \makevruler[][][][][] \def\makevruler[#1][#2][#3][#4][#5]{ \begingroup\offinterlineskip \textheight=#5\vbadness=10000\vfuzz=120ex\overfullrule=0pt% \global\setbox\icmlrulerbox=\vbox to \textheight{% { \parskip=0pt\hfuzz=150em\cv@boxheight=\textheight \cv@lineheight=#1\global\icmlrulercount=#2% \cv@tot\cv@boxheight\divide\cv@tot\cv@lineheight\advance\cv@tot2% \cv@refno1\vskip-\cv@lineheight\vskip1ex% \loop\setbox\cv@tmpbox=\hbox to0cm{ % side margin \hfil {\hfil\fillzeros[#4]\icmlrulercount} }% \ht\cv@tmpbox\cv@lineheight\dp\cv@tmpbox0pt\box\cv@tmpbox\break \advance\cv@refno1\global\advance\icmlrulercount#3\relax \ifnum\cv@refno<\cv@tot\repeat } } \endgroup }% \makeatother % ----- end of vruler % \makevruler[][][][][] \def\icmlruler#1{\makevruler[12pt][#1][1][3][\textheight]\usebox{\icmlrulerbox}} \AddToShipoutPicture{% \icmlruleroffset=\textheight \advance\icmlruleroffset by 5.2pt % top margin \color[rgb]{.7,.7,.7} \ifdefined\isaccepted \else \AtTextUpperLeft{% \put(\LenToUnit{-35pt},\LenToUnit{-\icmlruleroffset}){%left ruler \icmlruler{\icmlrulercount}} % \put(\LenToUnit{1.04\textwidth},\LenToUnit{-\icmlruleroffset}){%right ruler % \icmlruler{\icmlrulercount}} } \fi } \endinput PK!U``mdc/resources/lmmono-italic.otfOTTO 0CFF kſ8&GPOSQ7cxGSUBj0$TOS/2iY `cmap lheadX6hheaM$hmtxm` maxpPname4e4+posto S_<i9i9BBP XKXW^E UKWN  "< c  :XQg  m   4  t  S "   Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.Latin Modern Mono10 Italic2.004;UKWN;LMMono10-ItalicLatin Modern Mono 10 ItalicVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853LMMono10-ItalicPlease refer to the Copyright section for the font trademark attribution notices.LM Mono 10 ItalicItalicCopyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LM Mono 10Italic2.004;UKWN;LMMono10-ItalicLMMono10-ItalicVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853Please refer to the Copyright section for the font trademark attribution notices.Latin Modern Mono10 Italic ggg5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%'8{ L]RV/C598bt'~(:;qp)&<=z KQU\.4B(I X~  !#%')+-157:<>@BDFHKMOQSUWY[]_aceikmoqsuxz|  7Y #&2? %'+/9CG]cmo      " & 0 ; = @ F R T !!!!'!.!"""""""##*$#%&j&'6F +/26;@CIMWZgko~8L$   "$&(*,.469;=?ACEGJLNPRTVXZ\^`bdhjlnprtvy{} 7X#&.? $&*.6BDXbln      & 0 9 = ? D R T !!!!&!.!"""""""##)$"%&j&'%8 ).15:@CHLPZckn~8C$?6!676957?KOKRzd_cHJy7K"z")BDRUWg?A9\^`bZ~H&40wޟDއ݁#}|_ G / at T`g5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%''t:~-&;%z \KQU!B.48l#8{ ]LRV"C/59m$q|}deY}~ (I9*HJ)|- "flqk]<=V')&Z    {ELMMono10-Italic:MNOPQ Jb ;  5;7 $.5<CJQXeir} !:OXanx)>KSVaky,4EHKRYbr '18?FK[afkp$6ELR_mu  2HQ_nz *7DQ^ip{ '.9@GNY`kr}   ! , 7 E S ^ i x  # 7 G W ` i r {     % . 7 A K Q W ] c s    # - 7 @ I S ] d k w   ) 4 ? H Q Z c l u { '-39?LR]ht $0<FPYbhntz(1:CLV`jt(.4:@LXajt~ #,5>HR[djpy$.;HR\jx  )28>HRX^djt~",9<EKQ\jv'/48?CFJOQSZ]`cjqx}L[ciacute.capacute.ts1anglearcangleleftanglerightAogonekaogonekuni2193uni2190uni2192uni2191asterisk.mathbahtbigcircleblanksymbolstar.altbreve.capbreve.ts1space_uni0306_uni0301.capspace_uni0306_uni0301space_uni0306_uni0300.capspace_uni0306_uni0300space_uni0306_uni0309.capspace_uni0306_uni0309space_uni0306_uni0303.capspace_uni0306_uni0303caron.capcaron.ts1cent.oldstylecentigradecircumflex.capspace_uni0302_uni0301.capspace_uni0302_uni0301space_uni0302_uni0300.capspace_uni0302_uni0300space_uni0302_uni0309.capspace_uni0302_uni0309space_uni0302_uni0303.capspace_uni0302_uni0303space_uni0326copyleftcwmcwmascendercwmcapitaldblbracketleftdblbracketrightspace_uni030F.capspace_uni030Fdblgrave.ts1dblverticalbardcroatDeltadiameterdieddieresis.capdieresis.ts1discountdivorceddollar.oldstyledongdotaccent.capspace_uni0323dotlessjeight.taboldstyleEngengEogonekeogonekestimatedfive.taboldstylefour.taboldstyleGammagnaborretnigrave.capgrave.ts1guaraniHbarhbarspace_uni0309.capspace_uni0309hungarumlaut.caphungarumlaut.ts1interrobangIogonekiogonekLambdaleafliralongsmacron.capmacron.ts1marrieduni00B5uni266Anairanine.taboldstylenumeroOhornohornOmegaone.taboldstyleone.superiorOogonekoogonekopenbulletparagraph.altperthousandzeropesoPhiPiPsipublishedquillbracketleftquillbracketrightquotedblbase.csquotedblbase.ts1quotedblright.csquotesinglbase.ts1quotesingle.ts1radicalrecipereferencemarkregistered.altring.capspace_uni030A_uni0301.capspace_uni030A_uni0301Scedillascedillaseven.taboldstyleSigmasix.taboldstyleThetathree.taboldstylethree.superiortieaccentcapitaltieaccentcapital.newtieaccentlowercasetieaccentlowercase.newtilde.capasciitilde.lowtwo.taboldstyletwo.superiorUhornuhornUogonekuogonekUpsilondotaccent.altuni2423wonXizero.taboldstyleEuroinfinityringhalfleftringhalfrightmacron.altmacron.cap.altspace_uni0311space_uni0311.capspace_uni032Espace_uni032Fspace_uni0331space_uni0332space_uni0330uni0301.capuni0301uni0306.capuni0306uni032Euni032Funi0311.capuni0311uni030C.capuni030Cuni0302.capuni0302uni0326uni030F.capuni030Funi0308.capuni0308uni0307.capuni0307uni0323uni0300.capuni0300uni0309.capuni0309uni030B.capuni030Buni0332uni0331uni0304.capuni0304uni030A.capuni030Auni0303.capuni0303uni0330space_uni0308_uni0301.capspace_uni0308_uni0301space_uni0308_uni0300.capspace_uni0308_uni0300space_uni0308_uni030C.capspace_uni0308_uni030CAbreveabreveAbreveacuteabreveacuteAbrevedotbelowabrevedotbelowAbrevegraveabrevegraveAbrevehookaboveabrevehookaboveAbrevetildeabrevetildeAcaronacaronAcircumflexacuteacircumflexacuteAcircumflexdotbelowacircumflexdotbelowAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAdblgraveadblgraveAdotbelowadotbelowAEacuteaeacuteAhookaboveahookaboveAmacronamacronAogonekacuteaogonekacuteAringacutearingacuteCacutecacuteCcaronccaronCcircumflexccircumflexCdotaccentcdotaccentDcarondcaronDdotbelowddotbelowDlinebelowdlinebelowEbreveebreveEcaronecaronEcircumflexacuteecircumflexacuteEcircumflexdotbelowecircumflexdotbelowEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEdblgraveedblgraveEdotaccentedotaccentEdotbelowedotbelowEhookaboveehookaboveEmacronemacronEogonekacuteeogonekacuteEreversedereversedEtildeetildeeturnedschwaGacutegacuteGbrevegbreveGcarongcaronGcircumflexgcircumflexGcommaaccentgcommaaccentGdotaccentgdotaccentHbrevebelowhbrevebelowHcircumflexhcircumflexHdieresishdieresisHdotbelowhdotbelowH_uni0303h_uni0303IbreveibreveIcaronicaronIdblgraveidblgraveIdieresisacuteidieresisacuteIdotaccentIdotbelowidotbelowIhookaboveihookaboveImacronimacronImacron.altimacron.altIogonekacuteiogonekacuteItildeitildeJacutejacuteJ_uni030C.capjcaronJcircumflexjcircumflexKcommaaccentkcommaaccentLacutelacuteLcaronlcaronLcommaaccentlcommaaccentLdotldotLdotbelowldotbelowLdotbelowmacronldotbelowmacronL_uni0303l_uni0303MdotbelowmdotbelowNacutenacuteNcaronncaronNcommaaccentncommaaccentNdotaccentndotaccentNdotbelowndotbelowObreveobreveOcaronocaronOcircumflexacuteocircumflexacuteOcircumflexdotbelowocircumflexdotbelowOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOdblgraveodblgraveOdotbelowodotbelowOhookaboveohookaboveOhornacuteohornacuteOhorndotbelowohorndotbelowOhorngraveohorngraveOhornhookaboveohornhookaboveOhorntildeohorntildeOhungarumlautohungarumlautOmacronomacronOogonekacuteoogonekacuteOslashacuteoslashacuteRacuteracuteRcaronrcaronRcommaaccentrcommaaccentRdblgraverdblgraveRdotaccentrdotaccentRdotbelowrdotbelowRdotbelowmacronrdotbelowmacronSacutesacuteScircumflexscircumflexuni0218uni0219SdotbelowsdotbelowTcarontcaronuni021Auni021BTcedillatcedillaT_uni0308tdieresisTdotbelowtdotbelowTlinebelowtlinebelowT_uni0303t_uni0303UbreveubreveU_uni032Fu_uni032FUcaronucaronUdblgraveudblgraveUdieresisacuteudieresisacuteUdieresiscaronudieresiscaronUdieresisgraveudieresisgraveUdotbelowudotbelowUhookaboveuhookaboveUhornacuteuhornacuteUhorndotbelowuhorndotbelowUhorngraveuhorngraveUhornhookaboveuhornhookaboveUhorntildeuhorntildeUhungarumlautuhungarumlautUmacronumacronUringuringUtildeutildeWacutewacuteWcircumflexwcircumflexWdieresiswdieresisWgravewgraveYcircumflexycircumflexYdotbelowydotbelowYgraveygraveYhookaboveyhookaboveYtildeytildeZacutezacuteZdotaccentzdotaccentZdotbelowzdotbelowuni00A0uni2127zero.slashOrogateorogatequotedblbase.cmquotedblleft.cmquotedblright.cmfraction.althyphen.dupuni2010uni2011uni00ADhyphen.althyphendblemdash.althyphendbl.altohmacute.dupae.dupAE.dupcedilla.dupcircumflex.dupdieresis.dupgermandbls.dupmacron.dupoe.dupOE.duposlash.dupOslash.dupquoteleft.dupquoteright.duptilde.dupDcroatuni0237GcedillagcedillaKcedillakcedillaLcedillalcedillaNcedillancedillaRcedillarcedillaAlphaBetaEpsilonZetaEtaIotaKappaMuNuOmicronRhoTauChiuni2040uni203Funi20542.004Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LMMono10-ItalicLMMono10Normal~ $oIs-2@BJ  ( 9 M Z ^ T ]   X d } NTIx qv} &s| #'.y #(^glpt CY]agy*?JO]ai,6:>ELQWfn| #(-|wrp\Yp]^vep`zW loizIu~ynoY o & G f+ ho}tw|Ox}w~oo`Atg%@i fc.bvwǜze!{U]8gĭwt‘ & 7.t=GKȖ4} ku.F pw~rHZ^irmrwwBՋ `e~Ujh jОFq}~sn~u{gذO*L+}Tzj̚lq}d{~^}}?ԭFMEI,C ܪ_a ~t R Pzckm||ۣ`U%R jw֣z8b~wVh   zuv|~ Php}yZ}vgueN_cyff|fshqvjy{l}SwȜzE ףj^a |ay|v\i J & G +C&on . p~! mOGc+G k& y mu| []W'_[߸8{n$uz_Oo $-(#tzNFAA4KG͐ yyb4y |p0 M ~z}a Y^g^a +}TzvRvg = ^tlw: oG P& A4_o o x}]it|zgaUdtn}z|0 R omx|Sww ] M ~ p~{qhoPy%&\Sf|i\,%g0atqvw~Ɓez}kiyxgbn~Tpm|hW  noizIo|6+G _&  I cmdg}e_ ot R sy\v_a_|v M ~=|ynpf*.RH %xlp y Oy"փ@fvZMwn ej#hpU~`jV M ~ Y]QE nwʧs|1e_4E{rptulM܉ӝ \MUbr}z) v{8 uq 'xc]5ysv~ %"sM;Rݒ( 17Rwn !  ~|^^RXУ;ݽlRehu|yx!d/0RRa8PAb«sf}ĪhB-JӦ}sUs-}Rgq`bqmnr{r  L tx}2Jy}t y}t !  5 XWΏz~}ys{Ƥv]^ZrIM]Xtxu~4\ M ~:+  J J& %.P|MlVdt}ppswbQeМ? ~n0 }o~Xc{tڍ[JEr}x>۱ {]Ϗ k& 4 xt f|ѠyI u^+Ry2o)o{wzj[em֬6ZǗ~Wr}exz^a|scborzuvrJhwyh\`jo wЋzi-N<`|m6dnw ! 0 hp~xV|pku ptV j`sjw쳑ܥƚ \Qѵ 5 z¡ʽba\fqinxTcmw}zxuwc6puIno™uyujt?}tFno™uyuj~^j-z\ty?Ƌ x> PL P d~|^^RXУ;ݽlRZ[h\fxL(,<.YÿdiXĪhB-JӦ}slb<Xl؋>< qypsvj{zpyts6#|q~}o $Ό m@}]it |zgaUdtn}@z| @0 o 蕿R Pzckm||ۣ`U%R jw֣z8b~wcm\idZ nx~`eXt{uzes_rXttz<'}}諽|l{`KbM_1Ln}r2] V  sj@=u|#~njo&b&p~ Pu[n+ M  VVmtjoP ,  xuaNQd  t R } _Y^̟`,}& G i|pjoPxXT=#$^JYCHI1vەMq35  $0x 4 "y \ t 3 K1@+[}}̢䞻бg_UH<e}pknPg$dCAxm``p:[5 dz⵶xi`%uZ̮Ģ Lla|& G f+CtL CyGD;%"ڬ\Z|pjo / g-9qqlr .Cꄕ}rx|swz!msyx , $ O _vҽSc pIF48~ l {}xZh ~ ~ w~ @<U%ī a#(*sx}plwsd4,G G n+ .7s7NzFP gR+C^We* F7O_Ϡ ǰ^^}  ] r  t fw wi#%Swd{k cw >  h}vord0+e   M ~.R  x; zz}zz} Ӎ t~wz~{zsrw~}  V[  C)u{}| hBe B 4 ~Ц {|f nttnnrtn z V p~:{qhoP:{  &cv _pIF4 7s @ ^ w~ h;e ۶ +h j  x{y χx a |pjo  3 6 rmfhifnr tf.u~ J KH  svooslm| d l vw k⫠zW v{ <|pj xw {}} }  y~ 2Ѕb    p} ȋL q cs۪Ѯx L  zy}zz} LS-:Mn ċ u j ` 8"# sw  y~ wz~ krbo~ y|  _ v vzw v7J kT=e[s g "B?_ !#C=]\^<>$D %E&F'G(H|)I*J+K,L-M.N/O0P1Q  2R h3S4T5U6V@7W8X9Y:Z;[U c }-moqsuy0/3t{5}a~7,8gp:<> yo`ec AjxkCE  FGI}|  srz{viwAu K!*,fb2649  NM<@DFHPR ` lndpx,'.&%2469OS;Q=@BD*$#)HJ+Lw B8>  ~!,.5<MOQS^$-/t *e(23m    " 3 < V [ x }  } * r  D 1 *nz|xBGT]f+CWMYgt1KVam{#5IP]iz+Ct{U / .;HTDN"  U!p!"5";"H"V""###,#k#$A$H$R$$%%%&&&&&&'''5'J'^'j''''''(((#(;([(t((((((())),)F)Z)y)))))**++$+,B,,,-l---.o....../ //9/F/`/n///////0%0q0|00131I1g1r111111112 22/2C2M2\2g2w222222223 33/3?3S3c3t34444455'555K5P5\55566606;6R6b6w66666778[8999*94:::-:::;~;;< <<<<<<= ==-=9=K=Z=m=r>>>>>>>???+?@@@W@i@|@~@@@@@AA A9AWAqAAAAAABBBBBBCCCeCDDbDsDDDDDE9EJEF*FFGGHHaHIIIIIIIIIJkJtJJJJJJJJJJKKL'LLLLMNMMMNN+NTN}NNNNNOOQQQQRR!R>RSS)SnSSSSSSTTsTTTTTTUU&U=UJUfUwUUUUVVV9VKVlV|VVVWX)X=XYYYZ(Z^O^j_a`#`3`K`V`j`x```a=aMaeauaaabb"b0b=bPbcbtbbbbbbbbbbc cc)c;cGcSc_cmc{ccccccccccccdd dddd-d!M }A|)sa>{K=Epkoapzpyxxwm*%8 nx(,p}njodr|}Syxxyr~^sQr{fmpp]r[*c{{zVɠ͏Ĝэ8#dOlYM ~%8#34Iu~nDSIn 8#OVDUM ~I+$7#3+I ? jD IkXк?yekdo`gy vj!em]pblvkoW_wnxvt}N  B?d}X~tvfmlr{e~8?xAsv4lQ|`gwwf]v8>f{rZWT_ų̕~XR\In~^~Xq ! } # i Wz f,i~lhhvJwuY{mbZ@{ol1j^& G c+.4_j|zunZ o_ 5|r ]vw~yywy~vo{T}|Qa;k_t| E2{zz}~|*l Yoyx~ye/| w~4푳 + Ћ5=4 (y(vwe}yz|wzFMr~{qc /Y@{P *J' _3( Qx|? ,( C   N{sMi 7m7 vw}FMv}cy~ze F Uē] ,4)9+J4?<" v7&6wZhT&ho ' 7ihhT&ThhhIT&'& %  ,  Wp~8o|G+Toxy~{$1+|pjoPsr/L  D\dorot^~aroq}xk}Vwr|Nvw=Uq;'#MQq_TPIPbONvw N-}hrUnw}}~~Q:7!8NS|{}}T=i -jiePaXy³ v-UcSvC kҢ vRRwTƎiyz.* v zDY &cv _pIF48~ }n퇚EJb,r|v}xqs*j(Og}Xr/L QM ~S~|w|e{umX #%Qҫ[UDRZJh2FX|űѲePTW'.<)VwwϜwecZm?dvuciuWŮu|wqo}oҲS |8 SytbffX}y&v{-  7s-\ዛ6+Ɍ vw]jYh>kt`nei`s_jum~|xv v-cj  '}vyN~yzL 1 d9X_iАuq8zyxyEvZa[jhuCiǤ 92/ X}}cC2=aRQr^tPM^ZrF{y}{~!  /J #3";Hhhhhh!J $ J% ! *;u wp >J%9 JwL%%9 \u p" >J%(  p! *;K( u " >J: ! %:u wp >J%O JwL%%O u ^ " >J%@2JT́ ! %%@$   u " ;&A ! =g: u p << JL~M\u p" G(  p! J( ȵ_,FIȵ_ލ,F Zt I4U~ u " )B( ! 0(u " A J ! 0 u " u p }G5JLh5vVwJ߱ 7fxx{x~}}i f-Rl~mzn2_nmlMv ,[WV{>r}xxy}҄}{}()(uqMv F>rz|{wvxWVX|||yz֑}Au Q` [ !ٸ" DpiwpqzO Q J¸ٸ.w ! ;piwpqzO Q vwCwZZw_m5|s{{{MlaY}}}ʀ_N}ӻ՗,v !wCыh{w|~uimu~|mwossxyЗsqp|xw,v wErgqgpzzztwmltki\gyvwH~L_}_HC[@}|~#6txMhsvBwwu|dzz}}s}t|s}}demmnm{zz{vuxvxm[h6y_}ijiz|}|u " xh2J́ ! a$ _Y^̟`, yz}z{M;& G i|pjoP-|M x\\D1]J[L^CHI1vەMqqLvj tT=if}sjϒ cm ~V 2 ͽ[U ˼w$ g˼w $ Rv?E ˼w$ vE l}vorAy~$/}xww~yLyz  ? 0 D 0 A A? < D AX *}T {vg(yk9e?EĮbLwn wjow8᝜}sp~[CQclr|{T Ѧ? % D i;?  :( J D  Sy( { zmr1sp~kW zy}z}Q {Qclv|N k |lgդ y~}y~~wwpN^R\lG'dHϠv{o`{c}mQbgױ<i{{{{xxopusortge; ;trn zy}z~W2~+]W.{}U  {vq;QkafVwnHl.3 u0* UK &yvq35JUڽѨOxVz_vͩuj|1Iwѝv g-sqqlruzxsnoo~r}}rx|swzjxt|qoopuemmsyx}@yZ-`_g_`pg`WvwBfsfrls̛dckhQs]kn~uvv rwrhC~Ve+n<~,}ʫҊ LvVVwqfsfqktcpgwnhboq~uuw mzi}{jycoh [rtuejpÐr~hr}n`ilmq^hwn{w~|yosyapSth9F $tyZw{pAEu{uV Bj)藲9i<4xy{pvv}}3Jpwuxz%0 : \z fz l N <JNBnuhwlt {svdj|u}{zc Jɨp {On|Mkjx!*+QĹb“8"7O_Ϡ ǰ^^ pN ( xB J( ,eܟZ:;9J:w;wI۟Eaaiaariawlftujyz@oXboc] + n]`hXb r| {R;w:K<otxYvqpcZ۞~Y  3\vIw({xxy| }}}yx{FXorvư p !<yekdo`gy_v00wEabc5 ~4 C9 % qo) ~5* E4-Iyzwwz3~w >[!5ZڻاYgr?e1Ai~^Įؐ dmNipN ,5N L xBI5M;kpny}Vxx{{p>|rlpPp{z}{{~|Pmly$&#0T¶dZZz ;Rb˟Į``R( <( \,( 'x|?q !  }vw #  q ˼w! {$}˼w # $q ! I<} # ~Aq ! V%} # f;q wHV%9 }w # h%9 \q p! V%( \~ |# f;K( q ! V:} # h:q wHV%O }w # h%O q V ! V%@2}T́̃ # h%@2q ! 2A } # 8: q H H< }܃ # :vMq HwW( } # v( \q p! ;( \~ |# Gy( q ! N(}vw # W(q !  }vzw #  p;Ң C C q HS5}ʃ # $v5P P >iP1t3XXwj``&+}Tzϧ mt-oXlsrws ;* 4yeN_cyff|fshqvjy{l}SwȜzE ףjHcFzGla>eôѪѡϮ}Aq ! };~ Ч&> w9ɔڭʠXB%Qbq]`pha ϰѦ9D"5mٮӻzqq ! q p|foq| ~oo}v7sX_ono}s(rSuol~yn| }9%JBA^PnvsLizłrU9wx{oxz{jp}]m5(үĻ[=epw{owvvrtl}iGs˪xE}~%?jeec4 ׭DZul•Lb\Px /c JGw mFʹzBhf`[ry}z{~n}|}}{ҭvpmxvu !.EƭO0?XtžR`q !  t2}́̃ # 2m 43l{||}e}codcv$0KFoe}{}~vplLM_U]kerax`go_bdU_hvJw r|so+wr_  +  Ћ5=n ^ +G _& 6 M ~[o o˼w + $˼wЋ5=n@$ + f<Ћ5=4 (yA + s%Ћ5=4 (y;  >+ * W + Et( Ћ5=4 $y( U s(6.7s7NzFP 6CN~vz-7r7zvPvVwAvVwq  M ~z l|Ng|Nk0TzvRvg fw<gJɨ Y\MUbr}z d nr$0 (Nus\^j{g˼w 8/#3$g˼w$Y:@${/$/D%Y@{%/6< Y@{8< \p/M( \HYt@H{( a K "Kl ލ*0mS ~Ц'0Q l ˼w*0C$J˼w'0L$l *u<';Al *s%'#;l *A ': * _v J'(k *8_b [ J ~Ц':k[ l * "( *s( |'_3' F[( l ލ*0^( ~Ц'0(l *0v~ Jvzw'0K l * 5J' 35KKs@yb;KVҝӝ]\>OByp:M_}՞w7Ey-^gobo~k[0W"qpaowrmqqnk~SiDspah~F6Ws{_VnzoxwhjrZ߾Ů~u|w|cYӳٶKbdtOk+xo}AiJ & G +[jdY B .C&on  U' xwb * *<$ J́'K$ x|?A Q%x|?; C  C `* ( 6N({sMi* l ލ70Y ލm7 0 wҋrsszuyhzt+ sl%(PN@pn. vN7w vNm7 -w 7U!* m87 G* gQ7( mQm7 D( 7u;( mp7 g( 7u;' 5 m7 g' 5 N+5Ѻѫ$xw{xbw_h\lm F ǚȽtfH+(':(r|xxyNwx }}}~|yKDhP|W~bˤlgڞXrzcg}z,wxx{x n x{xi9$G[j}QL oRwj*alzn}qn^oո٨utz D noizIK5*|6+Wf.L ZU_& mst R r}vwE`Zz,*IM ~R_F6 ϸb7{Ep5 N+5 51A0Q-jk}n|ztrq |2?鴽p}:vO~uRpi]tTPyzz61> .vyzZ[vbzn{g F s( \Uēx]M( ϥM ~$ow'qwFrPf-C:RSٹM ~$x}rg|~x^tj[HXEN44K 2J||~ư  F hvww#M usk}Tu}<{yoswxB qe+-Wvwn'{zu[5wvvxv w^Hv{xuyxLq$f``)Y.iSOMG|{}w}Ǫl ލ,0:S 4)0fQ p~!kx/Gc+jrzz}z q$rjk& y /u|5 r r8_"$I~F}l ,B< 4)};A ,6* L 48)* , 3( J4) 3( , s( 4p)( ,z<$ J 4)K$ ,Ë Y 0*x~t&uwmpWf4i FzMy}}Dw~~xt)bmIgDuxnvsp^vȚxR~w ̯{{zpjitfŧe_}jv}l % 0 , 0 ˼w% 0P$J˼w , 0($% < , A% % , ;w%  %9 Jwf%9 \x% %(  x, ;K( % : , : w% (%O Jwf%O Ḱ̟% %@$ JT́ , %@$ % -A , q: ܟ%  W< JfDM\x% A(  x, =@( S _} ǺʢKQkUP % 0( , 0(Z vzw% 0 Jvzw , 0 wQ Ex w= @ vwwQ Ex () vww= @ ( \ wlQ zEx "( wz= l@ 4 ( vwwQ Ex (8(vww= @ ((vwiwQ Ex (I vw4w= @ ( ̩́Q Ex 6$ ̣́= @ $ % d , UKʟ%  R5Jf.5Z % }~]{^Ϗ|  {zgyƣ şwg^dvFon~tnltr~iɫќS| A}a}i[p}Xc[~{} h  I@ !BPuZjaX\[B  &G0?XtžR` Dxddlddtld5swv~d}}K}ut}@@"*HbnF1zJzzJ^;P:al޵lk]W79(*JZ4zz{?K=Vg{׿dlKv՟ wD vwGKv՟ vwwD vvwwG ̟́% M$ J́ , '$ Av16{e "ld1D)}x`}x'΢ 7_ȹ]Ë@ D Rjivx{yxyzDPaXyڀ³ v UcSv  UcSvF ȋɋla|& 0a|Nf+Cty, CyGD;%"ڬ\Z W&{'yqjys."x57AYM~t-]{o='|Y ^G]Xε֖xursvo~dmKvVXeɭء v{o|*Ufv=`:QM,4(SvlS||kO钪wS0}Pc}wstj|}|qo~OvzV}Qu4ssr1}9#mH \u}w{~kinsmunxgi{mhVQh mniw{neix|ywܘ|uh8 |8 |8 h̟I & vȘ{- 0L vJzs&d}^kwr gOh{~{Yc}|z|rsroi&<- c{A&F* 8- ?* &qA - l5: &( v{-  s( &f( \p- |( &f' 5\v{- |' [5jОFky=PgذO*L+}Tzj̚lq}d{}:Oz}[ԭ⠧q}~sn~u{듑'MEI,C ܪ_a!vV rxN ' |ssrxr }rsrxr űٰK =}~{xkW(}Jz}z||{}vsbfXjfhXdttsٸ_^ ٸvI^ unZz}}tx?}UƔ}sfT+-'$`msmun`@{slduqekUuq|zD@HCPzyrywmbj 7s-\ዛ0 KH6+Ɍ0P -\ዛ< 6+Ɍ:A 7s-nywT   6:~|}T m -\ዛ% 6+Ɍ"; <-\ዛo* <6+ɌM* \x-\ዛ( \ x6+Ɍm( VUC-`Zϣqsw5+(S0tquwcvkeaw;Pph{y]V~GsN^Z~|ssrws6vaEqutrxuu,]b~hylXP {nr}RIn>v o~njkˋ-rcxmm}~smvfhsoc4a ™_s~vvx[`AEA;wke& v8qpuz|Tdceqsgˬ@ 1l 1Xt<vd9X_e* gai0^tlw: oG P& zvT 04_o og[<9_ezyT ߦ 1* <9X_V* d9X_)< 1( \x9X_v( rrY &cv _zQAnlx..|ERlqLmslRtz~q}RylvʍM)}Tz/ EyGD;%"ڬ\Zr/L J Sif}sj; F[Sd yupjcRx}{}myXKwgf uv} yupicRx~{}myXKwgf vv}v2 k 2 2 Ni`1c5N x9X_;5{ zzgzƣ Şwg^dvFon~umlur~iɫќ ލ /J #0"S 3"0fQ ˼w/J #0eC$J˼w3"0L$ /J #*< 3"};A /J #(% 3"s#; /J #BA 3": /J # ` J3" f  /J #8` [ J 3"8f [ /J # ` <J3" f < /J #8` (J 3"8f (\ p/J ##s( 3p"( ލ /J #0 ( 3"0W( /J #0+~ J 3"0cK  w )Dttluop{~%#~}~Ez~rjfzpo~~{|iK /J # g5J3" 35r˺w+!zys}|sZ4_`]coks~}wb~є&]v OP P \%A?} z}g /J } .t=GKȖ4} ku@Ow^jg[`[B n  3 ‘R o}tw|Ox}w~oo`Atg%@i fc.bvwǜze!{U]8gĭVi]UZ[mRVXf%d?0Q jvp`\cpOa+Co>uv}v ٸ$/J #6CpiwpqzxJ¸ٸ3"6-L^ ́/J #b<$ J 3"K$ ލ8 0*S wvw9 r0v 8 0%w9 rH;8  v w9 r 6XMލ8 0(wvw9 r0p9(v\'p~<+YCx}{}{z}$xy6~rȩ|"qz9 y||}z}xygyeT9v]vZv9c$U9`ȍƺw^LvM ~{{vczznv`m{rusM rh;i|}n}R;nl ލ1 01S vw. g l 1 7% . g; 1  v . gCM 1 s( xj. g@)  p~ ,4op~#te5xw|w jV x d ~l ލ1 0"( vw. g (l 1 0:~  vzw. g  1 q<$ ́. g&x}]it|zgaUdtn}z|0 l ލ; 0 И6 0~? l ; <6 )Al ;  k( 6  8!( p; ( \`6 ( ;  F ˼w$_w$j) _w$j) g˼w,$Rv ?E <˼w$˼wU ˼wU w$n? w$n? vE vE QvdE a a< A%vw%9 {w%9 h;::w%O w%O %@2 %@2 0* A : :: vuv u`[ Y `[ vu<Y < LxMv u`( Y `(vK( Hix( ( FY( a   d *KN2+55 èN2+5 Ux5NٸSpiwpqzxNٸ.wSpiwpqzO Q ٸ.w`piwpqzO Q 5ٸIv^ v2 k+2 82 v v}~bv=sjxxװ}Au Q` 8 [  UK vw}~~>]ÖĘwtpyj zOYXY}~}}{pyw~YY[U[W}藗*{xY˜ȣɟ˾w|tx|x|`jkqU~zz|?Ϥv u%V|pdw|zt|v}|}UK Xl3qrypw;|̦-/]^uaa_zZǖo}E̫   vw 'vLPw uP~}~ |wxvg%k =yt~~uy~w<]Ny})@xrrwwr@rx?vrputprw\,( }Aq ލ!  };~ Ч&> w9ɔڭʠXB%Qbq]`pha ϰѦ9D"5mٮӻzq $ H >xursvo~uodxcV xovCcfv=`:[X{uwr(sb+itƫv Xƃz~{zjpt3 p~ |pjoPl4SMQъCqun)u{{m^ yz}z|RgVI(vȎ2cj SiАqIyzmu|mzizkZ[ZU%D09FP@qso\']/:ptkakt~hʰ˦ Zݷ Q4\[tf`s8L7_"(O=?p4dEįQ2 ilhuiMpݤݯlɐloSQQL|aYV^pL{M|ML^a|ʚʛF_x]fimj`dcfyvmi]_I=EF Ì +_ X^vE0MNQ  Z 2 c $ , n s w  + 0  ($-t| kosz}_go<@`d&,2_mr%,4LQUZbgou  &+39LPWinu $'.38=INRV\bmx{z)O|yl*$ b“8"7O_Ϡ ǰ^^ qqypsvj{zpyts6#|q~}o U$Ό > w9ɔڭʠXB%Qbq]9D"5mٮӻzq x }]it|zgaUdtn} z| 0 Y &cv _z^*ium7s_ݧRALns P ) ' xupurtxu nuhwlt{svdj|u}{zp~ |pjoP-iMJLElEHғBqun)u{ygT/.l]/¸gI I@ !.E &G0?XtžR` DByRQU~j^+r&wo|G|ԧurs{ J~w~or|xB ng#2Xba+]rwrf'}[^/kķ'vF6F{ zwrxtvzwGzwrxtvzw wv p~ 'tktkzi^hp~#t]KV KtƖ x}]it@|zgaUdtn}z|@0 ~}~Ez~rjfzpo~~{| w8᝜}sp~[CQclc ,EOAag~}wu΋|t"J [zsmy#FiQylyeu}Po~njoG x|pjoPx o{w1\y b ly|pjoPx\  s {z mcde^ o M ~ $ $% $% %$ %e&&&& o +h j\4(fYDz*G+} pÓb^DPV\flǽ 0he ԶME*ium7s_ݦRAMnsu_ i Yq YpW {u|ozHu M ~ |~*}sowpa ct=)Uj@4`&$qng5qҤ|s{m{ZJ $[xlp y OyTy  C)u{}|id[86d^ \ Х{x}jN8) 2(J`lGhdl~K{uy~o{屢~ư-i?EV=]Hsh7Xs ŵ“ ~QkUP'Z7O_Ϡ ǰ^^ }  piwpqzxxi9$~G[jQH& Rwp*[sznvqn^oյ٨4=~tzb C / ji Vimzz}zy~Vjn+\4(fYDz*G+ zQi O ihh Ok l& n Y &cv _pIF4Fv܆bjj_b[B ^*ium7s_ݧRALns ]қo}aXUϝK"$9Qg~3r,F(3Ol) }M:S:OVȾmVS>2B-@\V]9gGSmvo}|lu,+0PDO 0i[F),0.9ۭʢԻ9~Ѧ i Twp^^ehX}_{Epjzx݋rxjEMzeV} $ !w b nuhwlt`{svdj|u}{z 4z ?A}vor@Eyz d(/JnpyykZ}a}i[p|Wc[~{} & 7  yekdo`gy $0nNUr^ FDFLTcyrl*latn@"* #+"AZE 4CRT FMOL XROM lTRK  $, %- &.  '/!(0)12aalt.aalt6aalt>aaltFaaltNaaltVaalt^aaltfdligndligtdligzdligdligdligdligdligfracfracfracfracfracfracfracfraclnumlnumlnumlnumlnumlnumlnumlnumloclloclonum onumonumonumonum"onum(onum.onum4zero:zero@zeroFzeroLzeroRzeroXzero^zerod"*2:BJ @06x 4 "f9fk)9)k%f9%)9      0389NRdejky  '<' <    0389NRdejk y  Rj 0389NRdejky     5\y0389NRdejk      y DFLTcyrl latn,"AZE *CRT 2MOL :ROM BTRK Jsize2size6size:size>sizeBsizeFsizeJsizeN" d2PK! " mdc/resources/lmmono-regular.otfOTTO 0CFF ;2HbGPOSPc@GSUBj0pTOS/2iT `cmap lhead 6hheaK$hmtx\` maxpPname%x:9post~F( D_<i4i4==2P XKX^E UKWN@  "< c  :![Qk  s  6   t   _ " # Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.Latin Modern Mono10 Regular2.004;UKWN;LMMono10-RegularLatin Modern Mono 10 RegularVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853LMMono10-RegularPlease refer to the Copyright section for the font trademark attribution notices.LM Mono 10 RegularRegularCopyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LM Mono 10Regular2.004;UKWN;LMMono10-RegularLMMono10-RegularVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853Please refer to the Copyright section for the font trademark attribution notices.Latin Modern Mono10 Regular ggg5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%'8{ L]RV/C598bt'~(:;qp)&<=z KQU\.4B(I X~  !#%')+-157:<>@BDFHKMOQSUWY[]_aceikmoqsuxz|  7Y #&2? %'+/9CG]cmo      " & 0 ; = @ F R T !!!!'!.!"""""""##*$#%&j&'6F +/26;@CIMWZgko~8L$   "$&(*,.469;=?ACEGJLNPRTVXZ\^`bdhjlnprtvy{} 7X#&.? $&*.6BDXbln      & 0 9 = ? D R T !!!!&!.!"""""""##)$"%&j&'%8 ).15:@CHLPZckn~8C$?6!676957?KOKRzd_cHJy7K"z")BDRUWg?A9\^`bZ~H&40wޟDއ݁#}|_ G / at T`g5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%''t:~-&;%z \KQU!B.48l#8{ ]LRV"C/59m$q|}deY}~ (I9*HJ)|- "flqk]<=V')&Z    {ELMMono10-Regular2MNOPQ ;  Wo5;~7 $.5<CJQXeir} !:OXanx)>KSVaky,4EHKRYbr '18?FK[afkp$6ELR_mu  2HQ_nz *7DQ^ip{ '.9@GNY`kr}   ! , 7 E S ^ i x  # 7 G W ` i r {     % . 7 A K Q W ] c s    # - 7 @ I S ] d k w   ) 4 ? H Q Z c l u { '-39?LR]ht $0<FPYbhntz(1:CLV`jt(.4:@LXajt~ #,5>HR[djpy$.;HR\jx  )28>HRX^djt~",9<EKQ\jv'/48?CFJOQSZ]`cjqx}L\djacute.capacute.ts1anglearcangleleftanglerightAogonekaogonekuni2193uni2190uni2192uni2191asterisk.mathbahtbigcircleblanksymbolstar.altbreve.capbreve.ts1space_uni0306_uni0301.capspace_uni0306_uni0301space_uni0306_uni0300.capspace_uni0306_uni0300space_uni0306_uni0309.capspace_uni0306_uni0309space_uni0306_uni0303.capspace_uni0306_uni0303caron.capcaron.ts1cent.oldstylecentigradecircumflex.capspace_uni0302_uni0301.capspace_uni0302_uni0301space_uni0302_uni0300.capspace_uni0302_uni0300space_uni0302_uni0309.capspace_uni0302_uni0309space_uni0302_uni0303.capspace_uni0302_uni0303space_uni0326copyleftcwmcwmascendercwmcapitaldblbracketleftdblbracketrightspace_uni030F.capspace_uni030Fdblgrave.ts1dblverticalbardcroatDeltadiameterdieddieresis.capdieresis.ts1discountdivorceddollar.oldstyledongdotaccent.capspace_uni0323dotlessjeight.taboldstyleEngengEogonekeogonekestimatedfive.taboldstylefour.taboldstyleGammagnaborretnigrave.capgrave.ts1guaraniHbarhbarspace_uni0309.capspace_uni0309hungarumlaut.caphungarumlaut.ts1interrobangIogonekiogonekLambdaleafliralongsmacron.capmacron.ts1marrieduni00B5uni266Anairanine.taboldstylenumeroOhornohornOmegaone.taboldstyleone.superiorOogonekoogonekopenbulletparagraph.altperthousandzeropesoPhiPiPsipublishedquillbracketleftquillbracketrightquotedblbase.csquotedblbase.ts1quotedblright.csquotesinglbase.ts1quotesingle.ts1radicalrecipereferencemarkregistered.altring.capspace_uni030A_uni0301.capspace_uni030A_uni0301Scedillascedillaseven.taboldstyleSigmasix.taboldstyleThetathree.taboldstylethree.superiortieaccentcapitaltieaccentcapital.newtieaccentlowercasetieaccentlowercase.newtilde.capasciitilde.lowtwo.taboldstyletwo.superiorUhornuhornUogonekuogonekUpsilondotaccent.altuni2423wonXizero.taboldstyleEuroinfinityringhalfleftringhalfrightmacron.altmacron.cap.altspace_uni0311space_uni0311.capspace_uni032Espace_uni032Fspace_uni0331space_uni0332space_uni0330uni0301.capuni0301uni0306.capuni0306uni032Euni032Funi0311.capuni0311uni030C.capuni030Cuni0302.capuni0302uni0326uni030F.capuni030Funi0308.capuni0308uni0307.capuni0307uni0323uni0300.capuni0300uni0309.capuni0309uni030B.capuni030Buni0332uni0331uni0304.capuni0304uni030A.capuni030Auni0303.capuni0303uni0330space_uni0308_uni0301.capspace_uni0308_uni0301space_uni0308_uni0300.capspace_uni0308_uni0300space_uni0308_uni030C.capspace_uni0308_uni030CAbreveabreveAbreveacuteabreveacuteAbrevedotbelowabrevedotbelowAbrevegraveabrevegraveAbrevehookaboveabrevehookaboveAbrevetildeabrevetildeAcaronacaronAcircumflexacuteacircumflexacuteAcircumflexdotbelowacircumflexdotbelowAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAdblgraveadblgraveAdotbelowadotbelowAEacuteaeacuteAhookaboveahookaboveAmacronamacronAogonekacuteaogonekacuteAringacutearingacuteCacutecacuteCcaronccaronCcircumflexccircumflexCdotaccentcdotaccentDcarondcaronDdotbelowddotbelowDlinebelowdlinebelowEbreveebreveEcaronecaronEcircumflexacuteecircumflexacuteEcircumflexdotbelowecircumflexdotbelowEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEdblgraveedblgraveEdotaccentedotaccentEdotbelowedotbelowEhookaboveehookaboveEmacronemacronEogonekacuteeogonekacuteEreversedereversedEtildeetildeeturnedschwaGacutegacuteGbrevegbreveGcarongcaronGcircumflexgcircumflexGcommaaccentgcommaaccentGdotaccentgdotaccentHbrevebelowhbrevebelowHcircumflexhcircumflexHdieresishdieresisHdotbelowhdotbelowH_uni0303h_uni0303IbreveibreveIcaronicaronIdblgraveidblgraveIdieresisacuteidieresisacuteIdotaccentIdotbelowidotbelowIhookaboveihookaboveImacronimacronImacron.altimacron.altIogonekacuteiogonekacuteItildeitildeJacutejacuteJ_uni030C.capjcaronJcircumflexjcircumflexKcommaaccentkcommaaccentLacutelacuteLcaronlcaronLcommaaccentlcommaaccentLdotldotLdotbelowldotbelowLdotbelowmacronldotbelowmacronL_uni0303l_uni0303MdotbelowmdotbelowNacutenacuteNcaronncaronNcommaaccentncommaaccentNdotaccentndotaccentNdotbelowndotbelowObreveobreveOcaronocaronOcircumflexacuteocircumflexacuteOcircumflexdotbelowocircumflexdotbelowOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOdblgraveodblgraveOdotbelowodotbelowOhookaboveohookaboveOhornacuteohornacuteOhorndotbelowohorndotbelowOhorngraveohorngraveOhornhookaboveohornhookaboveOhorntildeohorntildeOhungarumlautohungarumlautOmacronomacronOogonekacuteoogonekacuteOslashacuteoslashacuteRacuteracuteRcaronrcaronRcommaaccentrcommaaccentRdblgraverdblgraveRdotaccentrdotaccentRdotbelowrdotbelowRdotbelowmacronrdotbelowmacronSacutesacuteScircumflexscircumflexuni0218uni0219SdotbelowsdotbelowTcarontcaronuni021Auni021BTcedillatcedillaT_uni0308tdieresisTdotbelowtdotbelowTlinebelowtlinebelowT_uni0303t_uni0303UbreveubreveU_uni032Fu_uni032FUcaronucaronUdblgraveudblgraveUdieresisacuteudieresisacuteUdieresiscaronudieresiscaronUdieresisgraveudieresisgraveUdotbelowudotbelowUhookaboveuhookaboveUhornacuteuhornacuteUhorndotbelowuhorndotbelowUhorngraveuhorngraveUhornhookaboveuhornhookaboveUhorntildeuhorntildeUhungarumlautuhungarumlautUmacronumacronUringuringUtildeutildeWacutewacuteWcircumflexwcircumflexWdieresiswdieresisWgravewgraveYcircumflexycircumflexYdotbelowydotbelowYgraveygraveYhookaboveyhookaboveYtildeytildeZacutezacuteZdotaccentzdotaccentZdotbelowzdotbelowuni00A0uni2127zero.slashOrogateorogatequotedblbase.cmquotedblleft.cmquotedblright.cmfraction.althyphen.dupuni2010uni2011uni00ADhyphen.althyphendblemdash.althyphendbl.altohmacute.dupae.dupAE.dupcedilla.dupcircumflex.dupdieresis.dupgermandbls.dupmacron.dupoe.dupOE.duposlash.dupOslash.dupquoteleft.dupquoteright.duptilde.dupDcroatuni0237GcedillagcedillaKcedillakcedillaLcedillalcedillaNcedillancedillaRcedillarcedillaAlphaBetaEpsilonZetaEtaIotaKappaMuNuOmicronRhoTauChiuni2040uni203Funi20542.004Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LMMono10-RegularLMMono10Normalm+~'I ps%+/3R-z06>kt = A E J O   ' R V P   $ o   ( 3 ^ c h =Cu x 5>KOS@OZ^p{ !(=DLz  DINQV[_d /3;Rimw{ %+0ARcs%1=BIMRX^dinyvvsq\`k[cukm_y|~u| }ln{e }t~mwg6#=X   `g~Ujh D FMDUSqv23rɋϖƘ֮T\@N pdnyxXuUo@@{K +'&D"ԙr$ wrrwxqrw } w||w~P}>|u~|~}u~E~V}>|u~|~}u~E~njmyusnx\g}|~شR}u q|& }& i j IaПstmfzoʋt}Ͱȴ? EO}r/ XjovuaJmkm{ʣͱ2Z^Q0CjP[ h oL|pG }XoLh sZ\V:?'-ٮtzvi|hca $IL ĵuw< ! ["\ "&  >i {s8 ~wipo{ztw|nuy s{#R"}:8 #1 (Krs{rK'Ƶ tzk xUZi]{h]-D@6`jx@{umhrA^G5N@HyX~a1E~| t0zpHR__WUa$ķ\V_@`''@5 q s{ R l kq sOy`Wʱu{tvwyq I U W & b F.a@h@n @Z @ b UhjvzMRt>8894{r8 omq{}~ /  _NWo\Ztwu\\MW 4 <|qI  x<stn):sb05*)]:z{y~rj]XJ l:gbp=:ae -luzmbU^@<6HIsp O N{}ZC ljw$M$jl[v ? b F.eM"W L 0W Z @b tn4,Tp}3|qg '| }u| u u } i i xu w Hg  @^  @{." z TWrbfc`wSPQSacrÿF`~`pjmsixefisp~ xs|tts|xbSSbhffh haJkvz~|]qvtMvp^J[=`uzXo SN;~[Ozb<q2{{|_'2{vv_ȋۘǜ j aПstmfzoʋt}Ͱȴ? EO}r/ XjovuaJmkm{ʣͱ2Z^Q0Cj q}^\ B _F -zeqhepltn|tvtuzn / qR VG |rR uw{@zoc +%QJXIyw| lZQ1BD3px2fZg .4_㧑 xW  U ) 4 r B9 oE . jjBy -Ћ0F $ ~{Semwsqyz F h~^yr ckx v 9``vk}' 5r|Sb}qH^gnn3r}S|rml}kvlm Ϊvkq]T~teqkv8 Y YE Zr oop}Fu_ V}p2snz.bwJ|VW::LNl@9 ${x\_U| Jô* M W u  pzyqac/[ ȵ+Ë+g[ oop}Fue Tr _(^ ){{  {)|~{|  [2[ES[1l)V>. 6,_J1 }Z1 .4 Z  up _93 _ %9% z@wx nkiI!  } 1 FS}}uwgzvu`a؄/ZGWh_`v|eL]4V'{r8&& u q|& fkxgdmwtq p w@ ~  9DWkU3WWzb^!yswg* ^B F5IRCJdwǽHA]TT,tBJAۦ6 7<:RYq@vKP@*38RM_BBMÿû[WFIS8R8ILN{ 8XKyLT и\ D I~y~ c , c DO˼ST s{r fbjyqsptxC<]{y} lb.kF. q}^ B F26 2jb`+,*õ YHFY T m "@A w \r |w~  {~| {x[dzzzu _xpxp_ i fv   z~qisz{{wxg ALip}j-B}z { F \7 \7 F vg2mb~do|ojkm}us  q| w  a 6 Ëؕ˜zJXGU v^ G ΋d xȋp Sv F.M@AAMJ0   U{{{ \  , ww ́ %}ID7TGF9R t Jк Gz {yz  sr s _xoxmb i9Dk Љ lUy|w  p  jj _$NjUǡ w /gw8  ݉    hvw } iosw~x 5l drsi y~  Q     x{   \ i j ϱk 8"# cmgz    ϱ.w ]vw6 j O[YO r  I    U T h _ vzw t  I r   t w y~ {x "B?_ !#C=]\^<>$D %E&F'G(H|)I*J+K,L-M.N/O0P1Q  2R h3S4T5U6V@7W8X9Y:Z;[U c }-moqsuy0/3t{5}a~7,8gp:<> yo`ec AjxkCE  FGI}|  srz{viwAu K!*,fb2649  NM<@DFHPR ` lndpx,'.&%2469OS;Q=@BD*$#)HJ+Lw B8>  ~%'.;M  "$+HT]jGnb&@L\KX_ 2>Zg   ? I \ g   B  E W   : ; Z q x -8 *=F5N\+L[h{)6Ik:N[o}MF@~TV4?_qw~On=  !'" """""#G#I###$"$r%% %)%%&&&'t'~''''''(((8(C(_(k((((())&)8)})))***@*R******+ +&+3+>+I++,#,z,,-U---.m...////000=0e0y0000001"1:2222f22233/3G3_3p33334 444&464F4U4d4s44444445 5,5@5U55555556R67 7F7P7_7n777777788b8p8888889909^9h::-:3:::::;<<=n=y={==>q>>?6?7?F?`?q?????@ @)@3ASAeAwAAAAAAAABB2B>BEB\BwBBBBCC7CMCfChCjCCCCCCDDDDjDqDDE EE6ELEoEEEEEEEFGMGYGdGGH:H|HHHHHHI+I4IIJQJuJKKsKLZLLMMMMM#M,MMMMMMMNNN"NGNXNyNNOoOP2P4P?PIPPQQ Q8QTR R9R;RSRpRRRRSSTTTTTUUPUUUVV2VWW.XSXXXXXY"YDYYYYYYZZZZ$Z+Z:Z_ZyZZZZZZ[N[c[u[[[\\,\4\\\]]])]]]]]^^a^j^u^^___``>`Q`````aa,aIa`b^bc c*c:cccycccdlddddde*e@eUefeveeeeeeeffHfffffg,g>gPg\ghgtggggggggggggh$hUh^hdhjhph}hhhhhhhhi ii!i-i9iFiLiSi]igiqi{iiiiiiiiij-jjjkklOlllllm,mkmumnnnoaouoooop0pHp]pvqzqqqrMrcrtrss0sBsTssttuBuVuuuuuvv$v+v>vQvdvww^wwwxyzzz zDzPzzzzz{U{|>A kȠȿ X   !7 n  ,?(s>b9]nurp3i ha U1E>(m@K(  8 7)( x> "(X2  +?D( .O 4H C O(etK S *d( -Ћ 6F ɀ w(@J.  ! x" E БÃëJËSd~$s{/5pDj5pV~bwƢvDYU^'`SLQKxs{h]@?C׿xXͨϻoqq_x~{fe0 nygYS|ťH Vfg}^ʦ{jtdsI7ڄ7f{r~PRVɕ>X^\Kn~^X( ) r  ' Wz ,jjhhwrbbV~ qA j и~%>}j>.4 Wjb{ih{bjQy4 R &[s{= M/H4 Ma Brr ,; &he}{xtxII~xtc 0  Bha x) iB[0" F_ EjN   U1E :[SS[l)Vu q|. 6,_J1 }Z1 .4 Z 8  x> h~IIx{}c~x~ed   l u vgG  + O H C ̋ xDv7&6w}ZI& e $ >vy&Zv:Iy&$&# * wNs{0mxe6Wx{vor:0{s8a r/ з  eYob  AIUy]qn` 1YBS ]hV@srw|85J'f0||w`e x wz #h#"D  wyιFew}u|[w}yx2k1wr/Ts{ZihzepbR%,*ϹkZ, ;a 2RZ99AJָ>Iȋ brM!ZISk|klqux%;2cd~9O : 8`: tsrwwrwT{v*]elAQ  2 g2޻Imegqoioh~Uex|}{|zvts{ xu~f'|wu|~F{yzF 8%}Wo  -2<+gܶ B rnlihxoƾֶù & <96f]3EZQITqN}lr   # T |M6 i1:k<{+sԴ\b;harL#LL% >~Vx?`*`q|P%? e v YY$s{ 1 4 /in! ?` 5 m ZTZZLZc5(q| RA&? |q (5c|q vlou8  x1 3 nTg|@yrj @  K  nN%'JNJF(J ==J (&)' vw !| vV   w !Ek-V  Pw !Ek! E*|w O}ykPwaP E E*|w O}yk\ OO~!Ek!  \ 2r|alU$`%Bm{׿lDEY+@FJɒ l=tvdyNE o  wPˮ !Ek! EkqsOywP˺aP E EkqsOy w !Ek! >I V >I  ̮́ !Ek =0{{= - ̺́c" E  =0 {{= - !<9 x" E C !I" x" E 7  w !Il 7 w}l 7 \OOz!I"= x 7 7H !I6 x" E 6 w !I"V  w}"V  ^̮́ !I  `g~Ujh@G Q̺́f" E ۪=~wipo{ztw|nuyT  0 !%' x" E ' O-OJ!W<%W% Лci" E N \OOz!F x f kȠȿ X  ȵމ+Ë+g[ o op}Fu@e Q r _( r Ƞȿvw @X 〗  " vw !A& vV & vzw !  zw~ 0   ! ʮ !RB2 }2vVwыzA|հ(Bfx{{x|}}|f RlmnGG nmlMvww U\uEܼ|xrrXzo$rypmisxtxMzuMvww s(,6vz{{y}}M~kb{si}wvrxI_)OgOzu| }ln{e }t~mwg6#drqg"=X_#>?`̱֓ѽ?F"x[ pW2I% b F.* W \ @ V32Ml@zs}a}{\kE|snnp!{~}{{~!Kldb#00 /i~0~y@z}}zz}@&V`rPLы~1L3[axljhjY}oϓ -`lswwssw;*ZЋb|X,?(s>b9]nurp3,Kx  ￙ {h]-D@6`jx{umhrA^G5N@yX~a1E~|! t1zpHR__WUa$ķ\V_@`''@5@4 i 1&r 6P7P7kNznPq6kNvzP7P7zvnPvVw! vVw!vmȤ4 sNhȤ4 ONm r/ Xvhv hh ɨO * Y "ZC b˼w$h>0 L.-b˼w# T>BB.-$h0 G"# TB G" gf0 :%W% ]\O N{}_93  _EC :%W%\$z0 QH \# zB[H a 8 {< < | vwT0>z vwY 05 | ˼wT0i- ˼wY 0{-| x)S:9 .QC| x)TG" .Q7 | x u#' .lg' )4:%W% Ђ.4zN }ȿН)=:%W%ga Ђ.=z%9%vm | i6W0J i6h)H iBt."uoouuoouU | vwT0=?& vwY 04&| vzwT86  vzwY 0- @2 . 2KKeuA}:KOҋǹ_ZMOC9O]kԘNj8Dm/\loawvf\/m! 纪anͽ$ OjjVkKw+k|!pt{d~Fpx~w~z~}}}a_)rxR}u q|& }& iqmca7_)$ &c "\ "&  >iqnca7 x)| ́Te% ́Y z% 6xN C F_ "6xN 7  U1E U1(m@K(| މ 8 0o | މx> 0)z qRRvg wvwvigvI Vu vߖȏoqkv| $ 8 m $ x> <8 7)( x8> "(bKFf8 kuoHouuooubKxF>  Юt8 CS i6h> .H Ю8 CS$ 2i6> .Huoouuoou2 IB*2Ѣeѫhuu ~(E (  |x{{x9w|xxyN }}}|{y ! 4zz,(x{{x y5 | ihwvF^=>q|6 mG\ ]f xgs{%F$ @/ W a X2 IB*2 B2͏J0\B\)]g{vbw{qln,7 'x I5CK:uNzšJ=vA;Do܍ygjgegj ruuswq\9`Z`Pvk}' @r|Sb}qH^gnn3r}S|rmTl}kvlHm fvkq]T~teqkv8@@ VH  c6 X$ hl DiYvgG_H j$xvhJESHTQ1CJ::CƢux$jkq}pZ{hkHnLoMF- mml}vqzƨ dr/TT4ryagF gvmkqqji}<gF a .rya: l0wvxv wFP)X}u opvde`4$`*(X lKK@r`| މ +0T T TO H C # {h R0|pG s $s 4r0h+ssa 5_ "B3$Hee` |  +!9 O H C C  <+?D( .O 4H *C O(| +(K TкO H C [ t+Kn  кZO hH RC [H |  +Q?% TO H C AG   +YV$ȽɩV/ʫGNYTT z\U}Gn`UôF~rr}yy@<=T]\epji~za`^_ysLu~zy|\C7d utswxrXuԥ@HC?J-b? V+u q|bF\SiMG΂f`O1C\ϔ }4 $O}r/ X}h}  Rwwz" "  "v zXqDAdTADu߮ >DJqlsip@! v,h+ u h -8U 2cM }{z{~z{}{ʲfntfWRfoxȋȋ;$ 9QsvvtzoMii8{w)ʦߋ s'FJ4ȋ)F%Rwu\:>$|tY8!፶~sB!,bZy[nh\/b9 *[%v\6Pw{uy~݋O-W6^z}wo}}ތE!S7_{rxw^: 8`: : 8`: : 8`:  ^ǰ: * T-Ћ$F !  h v{pq~swVCcD`wy~ztwdnv|{prqQOR} ɞ*9 ]1TC*d( -Ћ 6F  w(*']L'LP[X T-ЂЋ(F ! BH LP[X  -GЋjF  } LP[X$ 2 T-GЋeF  }$ ZU2j paПstmfzx JSt}Ͱȴ? EO}r/ Xjovuaf9Ez}m{ʣͱ2Z^Q0CjP[    uU @~{w|bL+~{z}~z{~~|th{y{6QpslZdlqϱ f fsq(.q|z~l[QZɬ瘣m=h^&I2?֘sq(.E-!r@~qż[Mjx=/~s{vwy}rSىJкeKAQ 0$ 2 g2޻01b elAQ 99 2 g2޻MNColЩde$l:gbp=:aeH -luamszmbU^@<6HIsp@w4W`P[T~uw/2òdshvlQw\wvmvȶxpL ryyrmw}Wtomujy E\dI(1vE`r/#  J{[ob wn~oh|w "tfROhsizyt@|z}{~yn||@inmok]we~{_n͵dDz} Ul{|@~@ FpC"sgQOhsizyt|z~{~~yo||inmok^wd~~{_n̶vw6@J. f@4. @4. "on*t\}Wno !Q]2I -2x<+gܶ2zy} XNPdbaxt_hsnjo.{> vw # 0+S vw;# ˼w # 0:B-˼w;B- # 9 DC #  "D7  # +'D3f' # , a h L (W  Z @b@ vwĀ# ; ga b vm # , |!9 a h L (W  Z @b@-9 vwĀ# ; f&&b u2&\t# co \T Gb F.1@M{rl@miU1:k< W T@Z  b[I vw # 0,&vw;$& vzw # 03 vzw;+  ow ^g .^ .N{..k . Y^ ){{  {)|~{w@  oȽvwHM ` @ \ow ы(g @a@^  {.b k h \ w h,,@^){{Q@  {)|~{R@w [F oȽvwHN&` A& oȾvwiH8H  w4 Xl+  oȞ́ @g  ^ !@{.$@z A =0{{= - ́Pl$A =0{{= - # p< D< #  G2ʹ b F.bM!W L (W Z @@bO2"roz~~y}ighggh}z|rt}zHҒ Siaiat*& & m_: IWWVJq|:5}nqtgf7ߝ_#T $u{tvwyqq}^i^1:k<{+sԴniqmca`WʱUii8zaBPf_)}cTC`DQkՋ6Wh+ u h5԰`jj ϱС齟# 6ffȱϱ b. F.`M @W n Z @b ^f ́ # 9>% ́;AA =0{{= - nvw! ?`0$T ى 5 0N n! ?`!" 5 !7 nȿ4X[4W4?`*%W%[;:[5 ,.N nvw! ?`0%&ى 5 0 & 44yzz4 <|qI }~|z}$z 9h;-r9rz}ᖦ}ku0T}9\^s9}$Sw剑9YasyaJЎ<ЎJo{_xxuuwChsr<shwwZww<rihxohiuxsj | މx10T vw3 j O | x1!" 3 nTg|@yrj$"7  14%W% YHݕ4Y@3 @j /N i6h1Tn xN)][ȧ0 3 jS | xxs{#RQ1M #1 e 5x{|wrs{r{xP(d w{{h| މx10& vw3 j &|  x18$  vzw3 j R | x1H?% ̧́3 jMKA =0{{= - | މ@ 0o ىK 0! | @ 0/9 K =C| @ (I wK! >I vKM vKM Qv5[M KuKu9 C"vwl 7 {wl 7 g7 66w"V w"V @  `g~Ujh@. @  `g~Ujh@. (<'<' &:'v  v hga n`vm v  |!9 n`-9 G" tN v pf&&n`u2&v  Bht & F1Y&  a    8 {< < IX*2X2  IX*2 UBt2Nϱ fN JôS  JôS 5}fv@J. f@J. 8@4. vww ,|w~~ay.qjuxۮ_)OgOru| }ln{e }t~mwg6#drqg =X | _#vw3s CE   U vwxQ{~}3\`ŇqopyD3}~|}{~}}q`kcpayvxv|vpkq̽w_u||gk<lTzz}|>v!wSu9brtB}|{s~ubͩU 6OEpr|y{~@R;:]RZt`~~y[[   vwCvQwwwyz0zxnzv+zywpy{ty1ynn}tuwm_ymrzwrtp\ * _) vws@( Ҁ) drqg@@  o ЉcdnyxXuUo@@{K +'@ &ܣȟD"ԙr$s !Ћۇ@;B$ 9Qsvvtzouu`k! u5}jVʐ8Ih`5X~|}z{{nfs!^[Zq&zvi|kgf}zy~}zP)k@ /1 kPz}uw<BP^ ĭvwC Hh!cJaH!;vJ _)rމxR}u q|& }& iqmca7i>z _)و["\ "&  >iqnca7i5 vNF_ 8^ މF_ 0sS ى6fN  vlab}ajܶ{y|ԔX^[{bC(YweE{{|;O^xX+kZ k ha;.o2 lfJ?ؒ)X_Z3EbvwvAH?^!_RI 7gxy{{t { 0m^ _ЋLgl..(3{kqpdc70n qIyr<dgwiCcd9:}G~}Vq{xs9qVI8"D S^: 8`: ^: R`: Jvww6< owqԄrvtD=EzD xuHrur}}}-[lo: 8`: : 8`: 8: R`: Jvwwm? ǶwrPu|yu~}~#mfvwm?`yttzztLJKsf hԢ8ZD54DE44Dt@OOA@OOA^HreQ3Ѥ}vX{}xmtѢw|dvEq,~BGy_O|vpqw}Ţӣ{_zqEo83:?N3w|g\zovʌw 6v9[`DyS{|wJA =0{{= - Mv <# :M MvT b F.@MW +@L  W *@Z  bBbM 0 KeG BAeG 9@ . 0 |  8 =Z% | x> ne% hx0 0xcc0 ' 0FMDUSqv23rɋϖƘ֮T\@Ngl?) ){?/2|'F.M@AAMJ0 o{Н{n@H\}Wʀo @@Q%g%W%| onE\}Wo @QOA  =0 {{= !- B-2<+gܶ5% k  QPȉtMɋfn{w~x\A@h}@U\|w|}V~P5S65>f{DwyRIbp!OOKˮH5lMˍlK q]`Q@u rxveGsu{tT[x]VTJ^mxxtzpqwvmH>Qw} d@vx0ʚVUet||tuHIGT0>pphqnox<xwcu~ ~w}z6xN X I &s{= M/H4 M a BrrS kQwO}s.xw{~tolufsqkz~-rxrCvNțw@ts{ @xu~ S NDlnrwb=ʬ"H },px㋓{DZep_tz|uo xMŸN%bdyljo:kTwC:NZTY|a\)'Lpntozn=J (nlbcOPPO}`cb^LMML^`}ǙF^^nimqbccbqnmi^^C=EF +X$)-Uio>Cd<H PbKOv| V  a 0 ; ` d l p t  {  YdmAEIMx|/4auz6=KW^y}&O_dotz&*;DHLPVZcmx  %*/9@H[nsw|$(/39HVZahuy  +0;@|w O}ykwszwGa`Hsxx9 r|alU$`%Bm{׿lDEY+FJɒ@l=tvdy : IWWVJq|:/ uoouuoou A  =0 {{=  - V $ Fub{ih{b_ Qi :}d gl..(,F.M@AAMJ0 6 5 ~vA =@0{{@= - + }4 s^h^4 O}r/ Xvhv , _kGnGޙmqzz}__x;t9g/z}~Vffj0\Srq*{r $s{ 1 Ci~fyl.4 /"r7~r 4 %syysR Y~yhxucwWtxysR t|ȝ㌙W z' {rI  ׂ @jvZMwj | ihwvF}q|6 }f ygjgyU~ `i~xn__|v   {h]-D@6`jx{umhrA^G5NA yX~a1E~|"t2@zpHR__WUa̐ķ\V_@`''@5 ~u|~>E}~u}|~V~u|~>E}~u}|~ gs{}9a |P uCyuxy|i |{ emwsrvxeSXJ@YkjX/0XY֋Ջۋu ձoOwd{r- hvMMvppM zg^Mb% F1 :1 u q| j T cYZ lm w' oeux]y vwzi i1:k< II9xϋ΋wz%9% _|X}u>b 5F Q+} ݾ >!vadwY^^Zwuы롱e {adsmpun{lmnus rI& .69x[nxrtu|kL\4 vw T@^ ){{  {)|~{@|  vw`HM W HL "W Z @b  m> 4 _V}p1 (}qu8ҁ tt} V vwwz@wx nkiI  emwsrxz7 s{!O Щ?c{C|*а:+Kt.EU{s8U/ކ YɺrsunX%{trT>N`V~vw|pfeA =0 {SVadr "u | MBMWMAM0Mt!tu q|#RD&>& #&  uu{s8stVVtu8L $W , A4 W} iY  r|alU$`%Bm{׿lDEY+FJɒdrf^ =tvdy _  ooqvKʧ& &-DJJJi^Koop}qjmrosJ1PtUlCv[kBJhmkerllfq \:r|alU$`%Bm{׿lDEY+@FJɒ l=tvdyJE G k   hvMMvpb-orugg78FMDUSqv23rɋϖƘ֮T\@N r |[v;[:ˡNv} }p9t1bkI*$^MjZdP4vB^l" E {s8 sw q r ji ioz}}zy~ju>b 5F Q+j}zPi\IïB E[Fj}ҋϽg^m|hpukqrgR|nlHQNSL0c>qxrtu|k2Q r / | onT\}Wo BQ  > h_ubRjkytݸBJ;DO7oKotv|md8E,&8 2=(+gvyqrwzmkDZ=TUR8:VӶtwd x njmyus`nx\g}|~ش|~sY[cNkw| _B f%W%  ypmdc dlЩ@! ihuwp c(e@eul!tzk  1  k+iM|nxvuyxtobtͣڎ aF+EJE=h L P7P7kNznP xRH ) c(eeult  g}x.7 ! 3A  Kz}s!F>fwmڹOO * dryl ]|xaq}~g]{ xN_[ u f}}fhh  wsswwssw |~ P r|  ?hhh?h z}}zz}  |wsxEG ?틴%  a %W% KMhPWbĤlgҵXreg}   ) .F   CvC  3 y45*b> uoouuoouǼȸtfsw7,';:(  {sl r{ r xR "#hhh#"hhh" ? |l2![^yli So  w   ;v B4}zz}}z  oD ZO cnt $|wx{{xb_h[fe [ ~ttuirbo~v s|ln|  : yw q  d[ZeQ@=S n }r  F. ы ыы fYYfPAAP fshsmt  Ӊ vwv;;wd }z zP x{{xw| S  8xg HqŇQ {}} T t ,v w   Н a F, |  v ~wj yiuxa \  ˼wPK  gv wyk|qm kI9TzaoQ [[ T ۮl}o T ~y}~ |   44  ˼w h z}  4   vN T uvzz     !  r  &   8    : J     8 +     X  2  F X D ,   :  9 9  ) ( I    $ :  7 , &   * 4  &   8   8 O N G 0    : 8     5 # 8 9 i    X #  & 8 ( >     4 H  , 5 :    , 4   8         0 ! 2  2  2  2  2  2  2  2  2  2  2  2  2  2  2   2  2  2  !  !  2  2   2 &  K  2  2  2 ;   ; E  2    WJJJJ  } ( I re ( I ( I ( I ( I  I   re (  \ B B  N {  $  $  $ u " & z : & 0  $ "  N 0  7  7  7  7  7  7  7  7  7  7  7  7  7  7  7   7 8 8  /  7   7    9  7 7 >  * F@ &   &  &  &  &  &   / .             \O O N O N O N O N O N O N O N O O N O N O N J J ' 0 O N O O N 0 G 0     :   :  :  :  :  =  & *  : J==    " &   \(                 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9    8 9  8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9 8 9  8    8 9 } b w 8 + 8 + 8 9 0  -  (  & &  >  |                       \    s s 4 H 4 H 4 H 7 4 H 4 H 4 H $ 8 (            8     XKK                                            9 9 ,   &              !                0 ! 0 ! 0 ! 0 ! 0  W W W W WJ W W W W W WJ W W te t t te t t t t X X  [ [N x x  t tz x      \O J J   J=    X XK   2   A L  Wo7>t&q8ONGG0989>Ki[X  ON:89 I/0,45i,5,/(2 FDFLTcyrl*latn@"* #+"AZE 4CRT FMOL XROM lTRK  $, %- &.  '/!(0)12aalt.aalt6aalt>aaltFaaltNaaltVaalt^aaltfdligndligtdligzdligdligdligdligdligfracfracfracfracfracfracfracfraclnumlnumlnumlnumlnumlnumlnumlnumloclloclonum onumonumonumonum"onum(onum.onum4zero:zero@zeroFzeroLzeroRzeroXzero^zerod"*2:BJ @06x 4 "f9fk)9)k%f9%)9      0389NRdejky  '<' <    0389NRdejk y  Rj 0389NRdejky     5\y0389NRdejk      y DFLTcyrl latn,"AZE *CRT 2MOL :ROM BTRK Jsize2size6size:size>sizeBsizeFsizeJsizeN" d_nPK!$mdc/resources/lmmonocaps-regular.otfOTTO 0CFF |сGPOSQ7cGSUBiTOS/2i_ `cmap{B  fhead }6hhea$hmtxe maxpPname4otpost~F\ 7_<hh==2P XKX^E UKWN@  "< c  !:/iQ}    > ( t (  ,2 ^ Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.Latin Modern Mono Caps10 Regular2.004;UKWN;LMMonoCaps10-RegularLatin Modern Mono Caps 10 RegularVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853LMMonoCaps10-RegularPlease refer to the Copyright section for the font trademark attribution notices.LM Mono Caps 10 RegularRegularCopyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LM Mono Caps 10Regular2.004;UKWN;LMMonoCaps10-RegularLMMonoCaps10-RegularVersion 2.004;PS 2.004;hotconv 1.0.49;makeotf.lib2.0.14853Please refer to the Copyright section for the font trademark attribution notices.Latin Modern Mono Caps10 Regular ggg5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%'7{ L]RV.B488bs'~(:;po)&<=z KQU\-3A'I R~  !#%')+-157:<>@BDFHKMOQSUWY[]_aceikmoqsuxz|~  7Y #&2? %'+/9CG]cmo      " & 0 ; = @ F R T !!!!'!.!"""""""##*$#%&j&'6F +/26;@CIMWZgko~8L$   "$&(*,.469;=?ACEGJLNPRTVXZ\^`bdhjlnprtvy{} 7X#&.? $&*.6BDXbln      & 0 9 = ? D R T !!!!&!.!"""""""##)$"%&j&'%8 ).15:@CHLPZckn~8C$?6!676957>JNJQyc^bHJy7K!z")BCQUWg?A9[]_aY}G&4/vޟDއ݁"|{^ F . `t NZg5]O0W^UV Y-@XfyRkj98ed3N,cI4=\!"*.16:>ACEGJLPSZ_ahloqsuw($)n<#+/27;?BDFHKMQT[`bimprtvx&%''s:~,%;$z \KQU!A-37k"8{ ]LRV"B.48l#p|}deY 'I9)HJ(|- !flqj\<=U&)&Y    {ELMMonoCaps10-Regular2LMNOP ;  Wam496 $.5<CJQXeir} !:OXanx)>KSVaky,4EHKRYbr ",3:AFV\afkz1@GMZhp-CLZiuz%2?LYdkv}")4;BIT[fmx    ' 2 @ N Y d s  2 B R [ d m v }   ) 2 < F L R X ^ n ~   ( 2 ; D N X _ f r ~    $ / : C L U ^ g p v |  "(.4:GMXco{ +7AKT]ciou#,5>GQ[eo| #)/5;GS\eoy '09CMV_ekt} )6CMWes}$-39CMSY_eoy '47@FLWeq "*/3:>AEJLNUX[^elsxG[gmacute.capacute.ts1anglearcangleleftanglerightAogonekaogonekuni2193uni2190uni2192uni2191asterisk.mathbahtbigcircleblanksymbolstar.altbreve.capbreve.ts1space_uni0306_uni0301.capspace_uni0306_uni0301space_uni0306_uni0300.capspace_uni0306_uni0300space_uni0306_uni0309.capspace_uni0306_uni0309space_uni0306_uni0303.capspace_uni0306_uni0303caron.capcaron.ts1cent.oldstylecentigradecircumflex.capspace_uni0302_uni0301.capspace_uni0302_uni0301space_uni0302_uni0300.capspace_uni0302_uni0300space_uni0302_uni0309.capspace_uni0302_uni0309space_uni0302_uni0303.capspace_uni0302_uni0303space_uni0326copyleftcwmcwmascendercwmcapitaldblbracketleftdblbracketrightspace_uni030F.capspace_uni030Fdblgrave.ts1dblverticalbardcroatDeltadiameterdieddieresis.capdieresis.ts1discountdivorceddollar.oldstyledongdotaccent.capspace_uni0323dotlessjeight.taboldstyleEngengEogonekeogonekestimatedfive.taboldstylefour.taboldstyleGammagnaborretnigrave.capgrave.ts1guaraniHbarhbarspace_uni0309.capspace_uni0309hungarumlaut.caphungarumlaut.ts1interrobangIogonekiogonekLambdaleafliramacron.capmacron.ts1marrieduni00B5uni266Anairanine.taboldstylenumeroOhornohornOmegaone.taboldstyleone.superiorOogonekoogonekopenbulletparagraph.altperthousandzeropesoPhiPiPsipublishedquillbracketleftquillbracketrightquotedblbase.csquotedblbase.ts1quotedblright.csquotesinglbase.ts1quotesingle.ts1radicalrecipereferencemarkregistered.altring.capspace_uni030A_uni0301.capspace_uni030A_uni0301Scedillascedillaseven.taboldstyleSigmasix.taboldstyleThetathree.taboldstylethree.superiortieaccentcapitaltieaccentcapital.newtieaccentlowercasetieaccentlowercase.newtilde.capasciitilde.lowtwo.taboldstyletwo.superiorUhornuhornUogonekuogonekUpsilondotaccent.altuni2423wonXizero.taboldstyleEuroinfinityringhalfleftringhalfrightmacron.altmacron.cap.altspace_uni0311space_uni0311.capspace_uni032Espace_uni032Fspace_uni0331space_uni0332space_uni0330uni0301.capuni0301uni0306.capuni0306uni032Euni032Funi0311.capuni0311uni030C.capuni030Cuni0302.capuni0302uni0326uni030F.capuni030Funi0308.capuni0308uni0307.capuni0307uni0323uni0300.capuni0300uni0309.capuni0309uni030B.capuni030Buni0332uni0331uni0304.capuni0304uni030A.capuni030Auni0303.capuni0303uni0330space_uni0308_uni0301.capspace_uni0308_uni0301space_uni0308_uni0300.capspace_uni0308_uni0300space_uni0308_uni030C.capspace_uni0308_uni030CAbreveabreveAbreveacuteabreveacuteAbrevedotbelowabrevedotbelowAbrevegraveabrevegraveAbrevehookaboveabrevehookaboveAbrevetildeabrevetildeAcaronacaronAcircumflexacuteacircumflexacuteAcircumflexdotbelowacircumflexdotbelowAcircumflexgraveacircumflexgraveAcircumflexhookaboveacircumflexhookaboveAcircumflextildeacircumflextildeAdblgraveadblgraveAdotbelowadotbelowAEacuteaeacuteAhookaboveahookaboveAmacronamacronAogonekacuteaogonekacuteAringacutearingacuteCacutecacuteCcaronccaronCcircumflexccircumflexCdotaccentcdotaccentDcarondcaronDdotbelowddotbelowDlinebelowdlinebelowEbreveebreveEcaronecaronEcircumflexacuteecircumflexacuteEcircumflexdotbelowecircumflexdotbelowEcircumflexgraveecircumflexgraveEcircumflexhookaboveecircumflexhookaboveEcircumflextildeecircumflextildeEdblgraveedblgraveEdotaccentedotaccentEdotbelowedotbelowEhookaboveehookaboveEmacronemacronEogonekacuteeogonekacuteEreversedereversedEtildeetildeeturnedschwaGacutegacuteGbrevegbreveGcarongcaronGcircumflexgcircumflexGcommaaccentgcommaaccentGdotaccentgdotaccentHbrevebelowhbrevebelowHcircumflexhcircumflexHdieresishdieresisHdotbelowhdotbelowH_uni0303h_uni0303IbreveibreveIcaronicaronIdblgraveidblgraveIdieresisacuteidieresisacuteIdotaccentIdotbelowidotbelowIhookaboveihookaboveImacronimacronImacron.altimacron.altIogonekacuteiogonekacuteItildeitildeJacutejacuteJ_uni030C.capjcaronJcircumflexjcircumflexKcommaaccentkcommaaccentLacutelacuteLcaronlcaronLcommaaccentlcommaaccentLdotldotLdotbelowldotbelowLdotbelowmacronldotbelowmacronL_uni0303l_uni0303MdotbelowmdotbelowNacutenacuteNcaronncaronNcommaaccentncommaaccentNdotaccentndotaccentNdotbelowndotbelowObreveobreveOcaronocaronOcircumflexacuteocircumflexacuteOcircumflexdotbelowocircumflexdotbelowOcircumflexgraveocircumflexgraveOcircumflexhookaboveocircumflexhookaboveOcircumflextildeocircumflextildeOdblgraveodblgraveOdotbelowodotbelowOhookaboveohookaboveOhornacuteohornacuteOhorndotbelowohorndotbelowOhorngraveohorngraveOhornhookaboveohornhookaboveOhorntildeohorntildeOhungarumlautohungarumlautOmacronomacronOogonekacuteoogonekacuteOslashacuteoslashacuteRacuteracuteRcaronrcaronRcommaaccentrcommaaccentRdblgraverdblgraveRdotaccentrdotaccentRdotbelowrdotbelowRdotbelowmacronrdotbelowmacronSacutesacuteScircumflexscircumflexuni0218uni0219SdotbelowsdotbelowTcarontcaronuni021Auni021BTcedillatcedillaT_uni0308tdieresisTdotbelowtdotbelowTlinebelowtlinebelowT_uni0303t_uni0303UbreveubreveU_uni032Fu_uni032FUcaronucaronUdblgraveudblgraveUdieresisacuteudieresisacuteUdieresiscaronudieresiscaronUdieresisgraveudieresisgraveUdotbelowudotbelowUhookaboveuhookaboveUhornacuteuhornacuteUhorndotbelowuhorndotbelowUhorngraveuhorngraveUhornhookaboveuhornhookaboveUhorntildeuhorntildeUhungarumlautuhungarumlautUmacronumacronUringuringUtildeutildeWacutewacuteWcircumflexwcircumflexWdieresiswdieresisWgravewgraveYcircumflexycircumflexYdotbelowydotbelowYgraveygraveYhookaboveyhookaboveYtildeytildeZacutezacuteZdotaccentzdotaccentZdotbelowzdotbelowuni00A0uni2127zero.slashOrogateorogatequotedblbase.cmquotedblleft.cmquotedblright.cmfraction.althyphen.dupuni2010uni2011uni00ADhyphen.althyphendblemdash.althyphendbl.altohmacute.dupae.dupAE.dupcedilla.dupcircumflex.dupdieresis.dupgermandbls.dupmacron.dupoe.dupOE.duposlash.dupOslash.dupquoteleft.dupquoteright.duptilde.dupDcroatuni0237GcedillagcedillaKcedillakcedillaLcedillalcedillaNcedillancedillaRcedillarcedillaAlphaBetaEpsilonZetaEtaIotaKappaMuNuOmicronRhoTauChiuni2040uni203Funi20542.004Copyright 2003, 2009 B. Jackowski and J. M. Nowacki (on behalf of TeX users groups). This work is released under the GUST Font License -- see http://tug.org/fonts/licenses/GUST-FONT-LICENSE.txt for details.LMMonoCaps10-RegularLMMonoCaps10Normal,x);fI,3~OVw'fM PV[_    _ j  : ? ] e o z  ( 3 ; G 8 @ '/04 [fuz %)04<DIbms58Zdhnrz&*06;RWmrv}  '/5;@FKZk| *7DOVZfrx~|wO}yk|vusp]ZvY{~axhu^}{~wszwGa`Hsxx9 = FMDUSqv23rɋϖƘ֮T\@N |{ omq{}~~wipo{ztw|nuy {{ -wrqxwrrw }w||w~Pnjmyusnx\g}|~شaqxHHwurqtIHqFA}z }B3 {4 R } q| O } O  wtffIwfzKxVrr lz~~zcTdHJI_mxs{ y !PoL|pG }rYMroLh * Ga}oQG}oQa ~v }{ =^h^{ P}rP Mrvhvh oN DI :{rxXf Ҕ :h w |{omq{}~~wipo{ztw|nuy{{- <P_NWo\Ztwu\\MW M<|qLh~^yr | @ ihsy2  ~m i F@ w!  ׂ @jvZMwi |ihwvF}q|6P}fo i~xn__|vR`i~xn__|v= ljw$M$jk[v ?2 @~@m i uihvwCyuxy|i emwsrvxeSXJ@YkjX/0XY֋Ջۋu |rO tn4,Tp}3|qLg {'|}u| {u }֑  wH\  @T @{." k  ȤȤm X nmn~a-$m~nis l},nm mHmplBx',r 0 haJkvz~|]qvtMvp^J[=`uzXo02{vv_ȋۘǜN;~[Ozb<q2{{|_ xu  azn~ itB  mihsy^syjiZ h ] @ Z ]`B/7 %N ڻgg `W  4 P l z~ppvxwvnlmnvv @}{{~~{  lm H {py1g$ ~RzplyZQM |J| pwAyxl M {sU L y45*b{rLO }u{rLO b 5F Q+} jjBC {adsmpun{lmnus l bSSbhffhô M~ MFqxrtu|k2Qg  TS}WcBH Ⱥw |{omq{}~~wipo{ztw|nuy{{-~w}vxy{sXpw de~s ԓ lG > h_ubR jkytݸBJ;DO7oKotv|md8E u| }ln{e }t~mwg6#gwL f%W% x l S 9'r%rsrr'&&srrrrs&&'rrsr%r uxЋ V Y j f L kNvzP7P7zvnP p| |O ) t r , fbjyqsptxC<]{y}{zyJNeOU^ħhdֱUnf|e| \*ѲF w trB {sl Ev" i qM  {~| ?hhh?h Vȟ$ |wsxE G  #| d ]nxlhus2!} n } z}}zz} ) i  Ch C  rrB q2njdc=# i  µ~orx4/.4U6 }z  0h a  F`\^6%C[d  vw  rt ;h r n)  x{{xw| u oD o} 1|wx{|w]WcZff ^  uU l ́ {yz l ԥfrlf_hB. x u l GYy}~ d[ZeQ@=S  F5IRCJdw  ы ыы ` lO y|w fshsmt v ~ m nPQ   ݛ g    :  O  {}} iosw~x y~ drsi ,v w w ww   v rM 9` ~~{ z~ yiuxa z jad\î i i j cmgz 8"#  ǽHAx q ]vw6 ۮl}o כ   wpQ \ v  h P y~ uvzz g  . nM  "B?_ !#C=]\^<>$D %E&F'G(H|)I*J+K,L-M.N/O0P1Q  2R h3S4T5U6V@7W8X9Y:Z;[T b },lnprtx/.2tz4|~a~6,7gp9;= yo`ec @jxkBD EFH|{  srz{viwAu J )+fb1538  ML;?CEGOQ _ kmdow+&-%$1358NR:P<?AC)#"(GI*Kv A~7= }(:O~   WcjpGnG.;"Pr*}'1>HQZfs{  ( z  K T O W  = w x !*3;]foz8z?LY$1:M_{ %-?Pf}.@P+Jf^egDNnsR%> 7 !!!!f!|!!""""#A#b$4$L$_$$$%% %%:%J%m%~%%%%%%&1&A&\&f&&&&&&'+'k'''((&(6(Y(j((((()/)))**++p+z+|++,,,-----0-R-|------...6.v.../@/K/V//00"020E0^0y0000000111(161D1S1`1n1|1111222(2;2P2e2l2s23b333444,4=4Q4Y4i4y445 5J5555606F6h666747`77777899:J:U:W::;K;^;r<<<<*<:>>+>?>O>V>f>n>>>>>>???3?L?[?b?{?????@@@(@*@=@P@k@@@@A%AKAUA{AAAAABBBB BCCCCCD:DDDDEdEwEEEF1FGG7G_GH)HIIIIIIIIIJ$JJJJJJKKKSKaKKLLLMyM{MMMNENaNNNNOOO7OSOtOOOPPQQRQUQ`QmQRR8RHRcRRS SeSTUU!U-U9UEUpUUUV VV2V@VLVZVgVrVVVVVVW W#W@WZWvWWWWWXX/XWXYY)YQYcYYYYZZZ(ZwZZZZ[,[[\\\0\C\U\g\t\\\\\]^h^|^^^^^^^_q______```(`8`P`h`}`````aaOa\ahauaabbbb+b7bbbbccc c(c.c4cCcRccctc}ccccccccccddd!d,d8dDdPd]dcdjdtd~dddddddddeeeMeeefgfggugwgyg{ggh2hjIj\jwjkkXkmkllllm2mHmRm\mmnn n]nobooppNppppppppq q/qqr+rrrsctttttuuZuuuuv8vw!A  ^@ !5 a  + ?' >: D 6'C c8d*T@ ^ *B@ ѵX>>'N6' 67)' r .DҬ/*'X0 +?D'/*'[ V Kv՜wBc * d' @ (Z @`B/7 %/N @ڻggjS'@J-  x! БÃëJe~$W /=pDj5pV~bwƢvDYU^'`SLQKxs{h]ƀ?C׿xXͨϻoqq_x~{fe0 nygYS|ťH Vfg}^ʦ{jtdsI7ڄ7f{r~PRVɕ>X^\Kn~^Xp( ) f3nWTz ,jjhh bbV~ qA& jи~{rLO }j{rLO .MWjb{ih{bjH q R{ [W = MPHMMٌ Brr+ : D  &vwe}{xtxII~xtc  . _5 ѵXx) w,FU Щ> > N 6Hr DH vw~IIx{}c~x~e[ n + /9k| jX{v7&6wZ}Z I&e $ >h y&Zh :Iy&$&v# (wN 0mxe6Wx{vor:0 z C~mE[ ]soNvwAIUy]qn` 1YBSNvw ]hV@srw|85J'f0||w`ex  vRRz #h#" v=  wyιFew}u|[w}yx2k1w 6v 'ncsaqxHHwurqtHwYyyz˟.F-xq{yzu|zxqrp +: z:vȋbrM!ZISk|klqux%;2cd~9O% n7mtsrwwrwT{v* Gv , m{ 8d*T@  vImegqoioh~Uex|}{|zvty xu 9W  8G,f'|wu|~F{yzF8}WcH  89 ^ Btrnlihxoƾֶù & <96f]3EZQITqN}lf#  $ ,ѵOXry)yssy)yhv5NH{olro{H|Zm2v53 j sroR4 pzH{om}L*Ho{G{oM 4RorQw{tlx.  w1 ; EvnN%'JNJF(J ==J (&)' vA xvI|  A I P0 E*|wO}ykP4E*|wO}yk\ ˼wi| %  w˼wi|! % !w  EkqsOyȺw ! EkqsOy A A2!IA2!   3|{omq{}~~wipo{ztw|nuy{{-! 3|{omq{}~~wipo{ztw|nuy{{-  6 X h9  " X O5 0 7 x4R 7 \ ip " =%  wip! O57w%   4 X R4 0" ?!x 4R" ?! ^ " @1xk! R" @1   0   ' X "'  DG x! f\A \ ip %  wip! % ^@ȵ ޛ +Ë+g[ o op}Fu@\Q f_( r @s  vA&xvIA& v[A!xv[Ix!    ?0 x! R\0 vVwыzA|հ{xBfx{{x|}}| f RlmnGG nmlMvww U\uEܼ|xrrXzo$rypmisxtxMzuMvww s(,6vz{{y}}M~kb{si}wvrx I_) OgOz}u "=X z!ϱ R S xԱϱ.w! `R S  <~wY]uejByyzytBe]Yw~~|}}]KŹЗouzyiowfwlpp}uvuxvuwoyxi|~iyzweajvnjlxjyaew A~FQqqJQ]F~}}|~BtBjuvBwyM [m~{pssq~w}mxlzmxPr x}~u~~~j|||mlm}w~x{z|~{qs{s~p|{~z{x|||j~~~u~ xzx  11x! Dx1 N[&v;[:ˡN}zy~}zM4}}p{rL5Mz}1epQ<]ߡMj< K^QZdP4vB^QKvm ȋm #R* .< Jkdjz}Uo˼wK" b˼w5" Mv5CF ˼w5" v5F Mv hhhy~.{xx{~yh  ; K03 C 0; !9 9 ; KH6 C Wx9 8Ћdq; G~1Щipplw~SCw^+BwG{j{ozz^L${wwywc(eeult ڜ¾ ; KI" C W_5v; K($% C (l%  7"pplw~``ucsY ~ma T 0" Tz}n@9OژJȋOY/Z@zyw|mjy9QVmϺ{}ڗӊi|'wvyzssl=\HKpsQIL##Vve gzlqPqhUj !5 5)x<stn@Zkb|aJz{ my~rskh W |(?@ |Vz}v;Fڞ \' K @~~{W`~tZ]ۺĻs_{}yrpEOC)(Cʹ0w2ѡv19'rs}rsrruttqonp}ussrrrrss~upooputtrrsr}sr;3`hg`_hg`WvwVXP]BhdckhQs]kn  rwrzCV+<,}ʑ{P LvVVwVXڰ(]q4cpgwnhboq  mi}jcohj [}rtvglqĘËq~hr}n`ilmp[fwnw~|yosa~SthJ9ьw%\o7 r@q~rQoQ/9'\Vnqyzx{8o{xzyE/ &' MvwUgfR2+6 WC9s  M x{{x  MF>?`̱֓ѽ?FI g xRpW0  xWz0 MY>Doomy||yy|xqmoD }zJ@X4%3|xW1;%  h%  \h*%  w,Щ> vwp( ) fo |ߟ /  ˼wp( ) fL^"|˼w/ T"p( ) f/6 3*9p( ) f<" 3*5wp( )  < 7 |wJ $ 7 \w к{и\z( Y) f<" =% d *57w% p( ) f<4 3$4 wp( )  <" ?!|wJ $" ?!V́p( ) f<" @Y |`́/ $" @yp( ) f=' 3E' ]X\@( ) @f/G |hL[@ ihsy2  ~ b @@к{и\( ) fQ?% |жxд[@ ihsy:kI% \w к{и\z( Y) fQS% d IT% vwp( ) f4&|ߟ / & p( ) f!| / !p*əCi Cp( )  Y50 |J a0 ѵXѵX>g PVы~1L3W]wihh-}rP MrД -`lswwssw;*>PRы~: []|rhh@7 ƪݼ50F>bsswwssw _)w p}( ) u AKx Zl   ihsyS2  ~ @]humja?   p( ) f\иr{m}q| ilBwv_hiux.xuuhiux2k |[дso  ijZys~hirzL -DhirzNievv{nvw{mp`d;O./6AI @8ױD 4  .s ) L )usM  wqB LE6S4#0 q}#));́p( ) fKZY |́/ Sye ɋɋg{g~{|}ejoebnv{# 0K Foe}~{~rmlMX_Ujte}a`go_bdU_h % t~phcAWTVVq[ U vw +   כ *ѲF: D  Q  | P}fP6q|S}H ˼w + R" ˼w*ѲF: D [K" + !h6 : D 1=9 + "u" : D 1$5 >+ ?' >: =D 6'+ Kx%  YѲF: D B1uoouuoouC c8d*T@ ^ *B@  1&r 6P7P7kNznPq6kNvzP7P7zvnPvVw! vVw!   m{ =Nh{ PNmrP Mrvhvhhhɥ_t~mq_t q~trB ܔ ._.~  __b˼w  >.L."b˼w _>5 b."  .G"  _5 p5 gf.:G Ў5 A \ z.QH% \ 6_v5 H%  v 4!{8 8 uޛ x)0>z  ޛ w,0f u˼wx)0i" ˼ww,0"x)S:6 w,9x)TG"  w,5xu#' w' )4:G Џ,4IA }ȿН)=:%W%ga  Џ,=I%9%vh ui6)0J% i6h)H%  i5h,.H% uޛ x)0=?& ޛ w,0e&u x)0:!  w,8b!@0 0 KKeuA}:KOҋǹ_ZMOC9O]kԘNj8Dm/\loawvf\/m! 纪anͽ% OjjVkKw+k|!pt{d~Fpx~w~z~}}}aKg xR } q| O } O oszhe?  Kw* Ga}oQG}oQpszhe? x)ux)e$ w,$Щ> ?9FU " Щ> &5>8>>' 8N6'uޛ 60o x zBr DBv wfvg wvwvigvLO  {vߖȏoqkv| vN 6mnjmyus`nx\g}|~شxTvNzBr DJLnjmyus0nx\g}|~ش <67)' r .D/*'bKFf6kuoHouuooux8F[Br Dbvuo$ouuoouЮt6CS% \ "r ZD";T%  }Ю6CS% 0 \ Ы!r UD;T% 0 IB*0 ыɆѡѓO^_aUы@   Rq ttut@ SA4zz,{xx{{x    |ihwvF^= @q|6Pj`fo Hr az!>#n~ M-itB H X0 IB*0 B0 ͏J0\B\)]g{vbw{qln,7 'x I5CK:uNzšJ=vA;Do܍ygjgegj ruuswq\Z`Pvk}@r|Sb}qH^gnn3r}S|rmTl}kvlH݌ fvkq]T~teqkvU@@݌ VH%  tn CI% j$xvhJESHTQ1CJ::CƢux$jkq}pZ{hkHnLoMF- mml}vqzƖ [r/TT4ryagF gvmkqqji}<gF a . ya: l0wvxv wFP)X}u opvde`4$`*(X lKK@r`uޛ +0T  /0!T {y !PR0|pG s$srYHr0h+ss 5_ "B3$Hee` +!6 /=@9<+?D' (7&W/~}|0.{.lr}z/z}/zw :9ޔKv՜wBc Kv՜vwwBYf Jv٭ vwwƊa3Gy~v|zz\i~Hwur3SywhxbHr9KeK2KKz2,` v́̾ #I$́̾($Av6{e ,"1"D}x}xö_ɵ2fYwy{}}ywYfPAAP{  # ȋɋt@At O cNm{rLO  q|m*FV`F+!FVG x< q|+ O ->HC?J-b|qM O + q|b2C\ϔO2\SiMG΂f`  }M$P}rP Mr}h}h Rz " " "h zXqDAdTADu߮ {{rLO DJqlsip@! v,  -8K 2cM }{z{~z{}{ʲfntfWRfoxȋȋgw; % 9QsvvtzoVii8{w)ʦߋ s'FJ4ȋ)F%Rwu\:>$|tY8!፶~sB!,bZy[nh\/b9 *[%v\6Pw{uy~݋O-W6^z}wo}}ތE!S7_{rxwTn7n7n7 TǺi~xn__|v*  ߟ @ Z Y@`B/7 %  v{pq~swVCcD`wy~ztwdnv|{prqQOR} ɞ* 6 G9* d' @ (Z @`B/7 %/ jS'* ' Ga' E  X%  Z Z@`B/7 % ^% E  X% \ PZ .@`B/7 %^ ^}% E  X% 0 \ PPZ - `B/7 %]PN ڻgg^}% 0 I stmfzt ISt}Ͱȴ? EP}rP Ɏm{ʣͱM0w}rjovuaZ^Q0Cj     uK @~{w|bL+~{z}~z{~~|th{y{6QpslZdlqz ϱe  eT;spyfZmJYѿɨ~^}ox{lb*>9()7˸T; ?(9K^No̽QGEWTMn_slw|F~u}  , m{0$ ȋכ c&d*E@ ^ ,   , m{96 8d*T@ ^ Hv9v , s|qȋ1̧c9 9}' ЬЏ9 *qA \ 6rS}Wkc H M%  5v9 E% rrвв= FS>[T~uw/2ò dshvlQwhvw\wvm  xpF {"|}g|" {g EX^M0/vKZȦCȥ~iE L wn~oh|w"t fROhsizyt@|z}{~yn||@inmok]we~{_n͵dDz} Ul{|@~@ FpC"s gQOhsizyt|z~{~~yo||inmok^wd~~{_n̶vw6 q @J- f@4- @4- I *tS}Wnc!H ]0  |9 e0 zy} XNPdbaxt_hsnjo.{>vw# 0+S  u$ 0T ˼w# 0:B"˼w $ 0SN"# 6  $ )@9#  "  $ )'5# +'  $ D'  # , }{$ ,ovw Ā# ; ga  }{Ā$ ;ovh  # , |!6 }{$ ,o(6 vw Ā# ; f&& }{Ā$ ;ou-&\t# co% \t$ J% vw# 0,& u$ 0& # 0/p! $ 0P!ow^\ .T.N{.._. PQ  K_  oȽvw?M  vwHQ  K_  ? \owы(\ @a@T {.b _h% \lw(Q ez~ppvxwvnlmnvv }{{~~{e_ Z % oȽvw?N& vwHQ  K_  @&oȾvwJ?41! wPQ  K_  &!oȞ́@\  T!@{.$@k Y ́ @Q  K_  %1# p8  $ n8 ʲ#  G0 ʲ $  `40 "roz~~y}ighggh}z|rt}zHҒ  S q 0iX0iXt*mK  O  IWWVJq| O 6zus~li? rK&ЕN 2 1?tgbC2 'Nރts}ki? Ҟ Uii8zaBPf_)}cTC`DQkՋ6W 5԰`jjϱС齟# 6fR ɱϱМ齙$ 6M8é̲# 9>$̲́ $ RP$ޛ 20$T v5 3 0U 2!" v53 "(528G v53 85A ޛ 20%&v5 3 0&v\ <PzzM<|qL}~|z}$z9h;-r9z}}ku0T}9\^s9}$Sw剑9Yasƺw^LvJЎ<ЎJ@{p jjxxuuw堣ihxohiuxsj ?hsr<shwwZww<ruޛ x. 0T  w1 0 T x. !"  w1 /'5 . 4G Џ1 4 i6h. Tn%  i5h1 D% xxy Q1M|#Ye5x{|w rb{xP dw{{huޛ x. 0& w1 0 &u x. 0 q!  w1 8P!ux. H?$ w1 XP$uޛ ;0o  E0# ;0/6 E?9u;(v!wSu9brtB}|{s~ubͩ K 6OEpr|y{~@R;:]RZt`~~y[[   vw C vQwyz0zxnzv+zywpy{ty1ynn}tuwm_ymrzwrtp\*% _)w vwps@( Ҁ) u @@ o Kx Zlvw   ihsyRd2 ~ P]humja?   !gwЋۇ@;!% 9Qsvvtzouu`k!Ԁ u5}jVʐ 8Ih` 5X~|}z{{nf !^[Zq&z mvi|kgf}zy~}zP)k@ /1 kPz}uw<BP^ ĭvw C Hh!ZJXH! ;h JKg ޛ xR } q| O } O oszhe?  >z K w* Ga}oQG}oQpszhe? f vNFU 8^njmyus`nx\g}|~شޛ FU 0sS ޛ Щ> 0S vlab}ajܶ{y|ԔX^[{bC(YweE{{|;O^xX+kZ k ha;.o2 lfJ?ؒ)X_Z3EbvwvAH?^!_RI 7gxy{{t l 0m^ v 0t qIyr<dgwiCcd9:}G~}Vq{xs9qVI8"D S Tn7T7Jvww6< owqԄrvtD=EzD xuHrur}}}-[lon7n787Jvwwm? ǶwrPu|yu~}~#mfvwm?`yttzztLJKsf hԢ8ZD54DE44Dt@OOA@OOA^HreQ3Ѥ}vX{}xmtѢw|dvEq,~BGy_O|vpqw}Ţӣ{_zqEo83:?N3w|g\zovʌw 6 q v9[`DyS{|wJ|{omq{}~~wipo{ztw|nuy{{-Mvݶ<# :F MvȲ <$ SF  .Ke1 _5 G19@ aς u 6=Z$ zBr DB11hx0 0xcc00FMDUSqv23rɋϖƘ֮T\@N adz+ +ykedj,+dFA}z }B3 {4 o{Н{n@HS}Wʀc@@H %gG uonES}Wc@H O|{ omq{}~~wipo{ztw|nuy {{!- 9 W$% Yȋpplw~SCw^ta yq}w|}~N$&2g~IxyZCUg OOKˮH5ɮlKq]hIyurxveGsu{tURof_TJ^m򀗆xxtzpqwvmH>Qw}dvxʚHcdt||tu IGT>pphqnox<xwcy|s|zЩ> n} k{I  = MPHMM ٌ Brr}9Dk| dfVwO}s.xw{~tolufsqkz~-rxrhvNțw@tW @xu wDW  SZ tNDlnrwb=ʫ"H },px㋓{DZep_tz|uovxMŸN%bdyljo:kTwC:NZTY|a\)'Lpntozn=J (nlbcOPPO}`cb^LMML^`}ǙF^^nimqbccbqnmi^^lEF aQUgy`c ;Yx/.Qvu # 1 5 U Y ]  & @   & K q v +  ,c  H[_h{7;>~%@FM`tx/?FNY_ckp #+26;JPcny  &*?DHNU[`s  %19>CHLQ`n| $*06AEPYdjot x ypjhx|qL wg6#gwU=X㊃ɘȍt@ ypw de~s ԓ lG]nx-!}   `g~Ujh   O  IWWVJq| O /r N 2 1?tgbC2  L & uoouuoou }>|u~|~}u~E~V}>|u~|~}u~E~ihvwFub{ih{b_ H i O }m{rLO I stmfzoʋt}Ͱȴ? EP}rP MrjovuaJmkm{ʣͱ2Z^Q0Cj  Z\V:?'-ٮtz mvi|hca $IL ĵuw< l:gbp=:ae -lu mszmbU^@<6HIspw4W`PE}~u}|~V~u|~>E}~u}|~~i jiZ qJO mzr {Q WeVN?CڷqO}{}  x<stn):sb05*)]:z{ my~rj]XJ uepzvtzzfW^NAekld,CC,edՋ֋Njy hvMMvppM ZN }oQx~m|~qn~brwvtxzq6Í d\îw}vxy{s tbqoZ/Xd^khsy: %9%L pplw~SCw^+BwG z^L$ kxybV )"i   stmfzoʋt}Ͱȴ? EP}rP MrjovuaJmkm{ʣͱ2Z^Q0Cj II9xϋ΋wz%W%VC J @@ ihsy@2 ~b @@ $ $% $% %$ %e&&&& o}:7 ml ^xd-zê/g[g<D$  s m eqyvt||Mz~~{ xs|tts|xV ( >!vadwY^^Zwuы롱e r I O .69x[nxrtu|kL\4 VxȃV9PW  nmn~TPa- m~ni)rku"}iffi"@0 |Vq;v\]$'W@x=rs{ x! |{omq{}~~wipo{ztw|nuy{{-rw~wxr Yw YE Zroop}Fu _ V}p 2snz.bwJ|VW::LNl@9${x\_U| emwsrxz7 vw` |qp݋ z~^`ml{ w <   C oGX ud m i F Jv٭ wƊa3Gy~v|zz\i~Hwur3SywhxkHr9KeK2KKz2,\жxд[ ihsyV2 @~@m i FF  lx[дsojiN -hirzL ~BihsyZj@I  } hhh mkerllfq  t!t q|D&>&|# O  uu{s stVVtu _  hvMMvp_'uslk? ;FMDUSqv23rɋϖƘ֮T\@N |[v;[:ˡNv}}p{rLt1bkI*$^MjZdP4vB^|np|`sxh}7f6f}xs`|pQndnd P  i D I~y~t ihtx }o m drqg\`Wʱu{tvwyq aqxHHwur^g ts~ki? 8jFA}z }B3 {4 u x W  Lt@At O }m{rLO  q|mLFV`F+!FVM  ,&8 2=(+gvyqrwzmkDZ=TUR8:VӶtw j  Ϡp T?vlmw[bc[w 4%9% tzk  N @ڻgg Y !w wЎ P7P7kNznP dSwЩ@!ihuwp kU3WWzb^!yswg* ^B   r ȋc Kz}s!F>fwmڹ q} :    ]|xaq}~g]{ f}}fhh fv 2" wsswwssw |w~   {x[dzzzu _xpxp_  vw  W  %W% z~qisz{{wxg P  ALip}j-B  aП 1 " u 3  y45*b{rLO q|  |qM  m i Ëؕ˜zJXGU "#hhh#"hhh" J }r  _ g o  ^  U{{{ \ h{rLO  {h }zz}}z {x  :?9+K<<-I {} {oz [ g ` n u ~ttuirbo~v Gz s|ln|  sr  P[ sL _xoxmb  vӛ  `М o}  fYYfPAAP  O cnt vwv;;wd FmF  д[ zqM    8xg } 5l x{   Н  l ߛ  v  ~wj ~~{ z~ }z KNɹw U  zr v  K kI9TzaoQ ϱk Єv[ v j vJwh ЧZ f u \ h  U ˼wP H w I   n| v[w    !  r  & ,; 8  ,  7 J  0  $ 8 >    + X  &  F X D ,  - :  9 9  ) ( /    ' :  1 , &   3 4  & ,  8  + 8 O u G P  ,  7 8  #  0 5 # 8 > i  1  X #  & 8 > >    + 4 ;  , 5 :   ! , 4   8      *  " 0 6 2  &  &  &  &  &  &  &  &  &  &  &  &  &  &   &  &  &  !  !  &  &   & &  K  &  &  & ;   ; E  &   - WJJJJ  h ( / re ( / ( / ( / ( /  /   re (  \ B B  N {  '  '  ' u " & z : & 0   %  u P  1  1  1  1  1  1  1  1  1  1  1  1  1  1  1   1 8 8  +  1   1    (  1 1 >  3 F@ & ,  & , & , & , & , & ,; / .    +  +      + \O O u O W O r O r O [ O u O u O O u O u O u J J ' 0 O u O O X P G P   ,  *   7  7  7  7  =  &   J==   # " &   \(  0    0  0  0  0  0   8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 > 8 >  $  8 >  8 > 8 ? 8 ? 8 ? 8 ? 8 ? 8 ; 8 > 8 >  8    8 > h j { 8 > 8 > 8 > 0  -  (  & &  >  |        +   +  +  +  +  +  +  \    f f 4 ; 4 ; 4 ; 1 4 ; 4 ; 4 ; $ 8 (    !  !  ! !  ! 8  1   XKK  !                                          9 9 ,   &              !  "  "  "  "   "  "  " 0 6 0 6 0 6 0 6 0  W W W W WJ W W W W W WJ W W te t t te t t t t X X  [ [N x x  t tz x      \O J J   J=    X XK   &   A L  Wo1>t&q8OuGGP98>>Ki[XOu8>!//P,45i,5,/(2 FDFLTcyrl*latn@"* #+"AZE 4CRT FMOL XROM lTRK  $, %- &.  '/!(0)12aalt.aalt6aalt>aaltFaaltNaaltVaalt^aaltfdligndligtdligzdligdligdligdligdligfracfracfracfracfracfracfracfraclnumlnumlnumlnumlnumlnumlnumlnumloclloclonum onumonumonumonum"onum(onum.onum4zero:zero@zeroFzeroLzeroRzeroXzero^zerod"*2:BJ @06x 4 "f9fk)9)k$f9$)9      0389NRdejky  '<' <    0389NRdejk y  Rj 0389NRdejky     5\y0389NRdejk      y DFLTcyrl latn,"AZE *CRT 2MOL :ROM BTRK Jsize2size6size:size>sizeBsizeFsizeJsizeN" d2PK!>!+!+mdc/resources/neurips.sty% partial rewrite of the LaTeX2e package for submissions to the % Conference on Neural Information Processing Systems (NeurIPS): % % - uses more LaTeX conventions % - line numbers at submission time replaced with aligned numbers from % lineno package % - \nipsfinalcopy replaced with [final] package option % - automatically loads times package for authors % - loads natbib automatically; this can be suppressed with the % [nonatbib] package option % - adds foot line to first page identifying the conference % - adds preprint option for submission to e.g. arXiv % - conference acronym modified % % Roman Garnett (garnett@wustl.edu) and the many authors of % nips15submit_e.sty, including MK and drstrip@sandia % % last revision: March 2019 \NeedsTeXFormat{LaTeX2e} \ProvidesPackage{neurips_2019}[2019/03/13 NeurIPS 2019 submission/camera-ready style file] % declare final option, which creates camera-ready copy \newif\if@neuripsfinal\@neuripsfinalfalse \DeclareOption{final}{ \@neuripsfinaltrue } % declare nonatbib option, which does not load natbib in case of % package clash (users can pass options to natbib via % \PassOptionsToPackage) \newif\if@natbib\@natbibtrue \DeclareOption{nonatbib}{ \@natbibfalse } % declare preprint option, which creates a preprint version ready for % upload to, e.g., arXiv \newif\if@preprint\@preprintfalse \DeclareOption{preprint}{ \@preprinttrue } \ProcessOptions\relax % determine whether this is an anonymized submission \newif\if@submission\@submissiontrue \if@neuripsfinal\@submissionfalse\fi \if@preprint\@submissionfalse\fi % fonts \renewcommand{\rmdefault}{ptm} \renewcommand{\sfdefault}{phv} % change this every year for notice string at bottom \newcommand{\@neuripsordinal}{33rd} \newcommand{\@neuripsyear}{2019} \newcommand{\@neuripslocation}{Vancouver, Canada} % handle tweaks for camera-ready copy vs. submission copy \if@preprint \newcommand{\@noticestring}{% Preprint. Under review.% } \else \if@neuripsfinal \newcommand{\@noticestring}{% \@neuripsordinal\/ Conference on Neural Information Processing Systems (NeurIPS \@neuripsyear), \@neuripslocation.% } \else \newcommand{\@noticestring}{% Submitted to \@neuripsordinal\/ Conference on Neural Information Processing Systems (NeurIPS \@neuripsyear). Do not distribute.% } % line numbers for submission \RequirePackage{lineno} \linenumbers % fix incompatibilities between lineno and amsmath, if required, by % transparently wrapping linenomath environments around amsmath % environments \AtBeginDocument{% \@ifpackageloaded{amsmath}{% \newcommand*\patchAmsMathEnvironmentForLineno[1]{% \expandafter\let\csname old#1\expandafter\endcsname\csname #1\endcsname \expandafter\let\csname oldend#1\expandafter\endcsname\csname end#1\endcsname \renewenvironment{#1}% {\linenomath\csname old#1\endcsname}% {\csname oldend#1\endcsname\endlinenomath}% }% \newcommand*\patchBothAmsMathEnvironmentsForLineno[1]{% \patchAmsMathEnvironmentForLineno{#1}% \patchAmsMathEnvironmentForLineno{#1*}% }% \patchBothAmsMathEnvironmentsForLineno{equation}% \patchBothAmsMathEnvironmentsForLineno{align}% \patchBothAmsMathEnvironmentsForLineno{flalign}% \patchBothAmsMathEnvironmentsForLineno{alignat}% \patchBothAmsMathEnvironmentsForLineno{gather}% \patchBothAmsMathEnvironmentsForLineno{multline}% }{} } \fi \fi % load natbib unless told otherwise \if@natbib \RequirePackage{natbib} \fi % set page geometry \usepackage[verbose=true,letterpaper]{geometry} \AtBeginDocument{ \newgeometry{ textheight=9in, textwidth=5.5in, top=1in, headheight=12pt, headsep=25pt, footskip=30pt } \@ifpackageloaded{fullpage} {\PackageWarning{neurips_2019}{fullpage package not allowed! Overwriting formatting.}} {} } \widowpenalty=10000 \clubpenalty=10000 \flushbottom \sloppy % font sizes with reduced leading \renewcommand{\normalsize}{% \@setfontsize\normalsize\@xpt\@xipt \abovedisplayskip 7\p@ \@plus 2\p@ \@minus 5\p@ \abovedisplayshortskip \z@ \@plus 3\p@ \belowdisplayskip \abovedisplayskip \belowdisplayshortskip 4\p@ \@plus 3\p@ \@minus 3\p@ } \normalsize \renewcommand{\small}{% \@setfontsize\small\@ixpt\@xpt \abovedisplayskip 6\p@ \@plus 1.5\p@ \@minus 4\p@ \abovedisplayshortskip \z@ \@plus 2\p@ \belowdisplayskip \abovedisplayskip \belowdisplayshortskip 3\p@ \@plus 2\p@ \@minus 2\p@ } \renewcommand{\footnotesize}{\@setfontsize\footnotesize\@ixpt\@xpt} \renewcommand{\scriptsize}{\@setfontsize\scriptsize\@viipt\@viiipt} \renewcommand{\tiny}{\@setfontsize\tiny\@vipt\@viipt} \renewcommand{\large}{\@setfontsize\large\@xiipt{14}} \renewcommand{\Large}{\@setfontsize\Large\@xivpt{16}} \renewcommand{\LARGE}{\@setfontsize\LARGE\@xviipt{20}} \renewcommand{\huge}{\@setfontsize\huge\@xxpt{23}} \renewcommand{\Huge}{\@setfontsize\Huge\@xxvpt{28}} % sections with less space \providecommand{\section}{} \renewcommand{\section}{% \@startsection{section}{1}{\z@}% {-2.0ex \@plus -0.5ex \@minus -0.2ex}% { 1.5ex \@plus 0.3ex \@minus 0.2ex}% {\large\bf\raggedright}% } \providecommand{\subsection}{} \renewcommand{\subsection}{% \@startsection{subsection}{2}{\z@}% {-1.8ex \@plus -0.5ex \@minus -0.2ex}% { 0.8ex \@plus 0.2ex}% {\normalsize\bf\raggedright}% } \providecommand{\subsubsection}{} \renewcommand{\subsubsection}{% \@startsection{subsubsection}{3}{\z@}% {-1.5ex \@plus -0.5ex \@minus -0.2ex}% { 0.5ex \@plus 0.2ex}% {\normalsize\bf\raggedright}% } \providecommand{\paragraph}{} \renewcommand{\paragraph}{% \@startsection{paragraph}{4}{\z@}% {1.5ex \@plus 0.5ex \@minus 0.2ex}% {-1em}% {\normalsize\bf}% } \providecommand{\subparagraph}{} \renewcommand{\subparagraph}{% \@startsection{subparagraph}{5}{\z@}% {1.5ex \@plus 0.5ex \@minus 0.2ex}% {-1em}% {\normalsize\bf}% } \providecommand{\subsubsubsection}{} \renewcommand{\subsubsubsection}{% \vskip5pt{\noindent\normalsize\rm\raggedright}% } % float placement \renewcommand{\topfraction }{0.85} \renewcommand{\bottomfraction }{0.4} \renewcommand{\textfraction }{0.1} \renewcommand{\floatpagefraction}{0.7} \newlength{\@neuripsabovecaptionskip}\setlength{\@neuripsabovecaptionskip}{7\p@} \newlength{\@neuripsbelowcaptionskip}\setlength{\@neuripsbelowcaptionskip}{\z@} \setlength{\abovecaptionskip}{\@neuripsabovecaptionskip} \setlength{\belowcaptionskip}{\@neuripsbelowcaptionskip} % swap above/belowcaptionskip lengths for tables \renewenvironment{table} {\setlength{\abovecaptionskip}{\@neuripsbelowcaptionskip}% \setlength{\belowcaptionskip}{\@neuripsabovecaptionskip}% \@float{table}} {\end@float} % footnote formatting \setlength{\footnotesep }{6.65\p@} \setlength{\skip\footins}{9\p@ \@plus 4\p@ \@minus 2\p@} \renewcommand{\footnoterule}{\kern-3\p@ \hrule width 12pc \kern 2.6\p@} \setcounter{footnote}{0} % paragraph formatting \setlength{\parindent}{\z@} \setlength{\parskip }{5.5\p@} % list formatting \setlength{\topsep }{4\p@ \@plus 1\p@ \@minus 2\p@} \setlength{\partopsep }{1\p@ \@plus 0.5\p@ \@minus 0.5\p@} \setlength{\itemsep }{2\p@ \@plus 1\p@ \@minus 0.5\p@} \setlength{\parsep }{2\p@ \@plus 1\p@ \@minus 0.5\p@} \setlength{\leftmargin }{3pc} \setlength{\leftmargini }{\leftmargin} \setlength{\leftmarginii }{2em} \setlength{\leftmarginiii}{1.5em} \setlength{\leftmarginiv }{1.0em} \setlength{\leftmarginv }{0.5em} \def\@listi {\leftmargin\leftmargini} \def\@listii {\leftmargin\leftmarginii \labelwidth\leftmarginii \advance\labelwidth-\labelsep \topsep 2\p@ \@plus 1\p@ \@minus 0.5\p@ \parsep 1\p@ \@plus 0.5\p@ \@minus 0.5\p@ \itemsep \parsep} \def\@listiii{\leftmargin\leftmarginiii \labelwidth\leftmarginiii \advance\labelwidth-\labelsep \topsep 1\p@ \@plus 0.5\p@ \@minus 0.5\p@ \parsep \z@ \partopsep 0.5\p@ \@plus 0\p@ \@minus 0.5\p@ \itemsep \topsep} \def\@listiv {\leftmargin\leftmarginiv \labelwidth\leftmarginiv \advance\labelwidth-\labelsep} \def\@listv {\leftmargin\leftmarginv \labelwidth\leftmarginv \advance\labelwidth-\labelsep} \def\@listvi {\leftmargin\leftmarginvi \labelwidth\leftmarginvi \advance\labelwidth-\labelsep} % create title \providecommand{\maketitle}{} \renewcommand{\maketitle}{% \par \begingroup \renewcommand{\thefootnote}{\fnsymbol{footnote}} % for perfect author name centering \renewcommand{\@makefnmark}{\hbox to \z@{$^{\@thefnmark}$\hss}} % The footnote-mark was overlapping the footnote-text, % added the following to fix this problem (MK) \long\def\@makefntext##1{% \parindent 1em\noindent \hbox to 1.8em{\hss $\m@th ^{\@thefnmark}$}##1 } \thispagestyle{empty} \@maketitle \@thanks \@notice \endgroup \let\maketitle\relax \let\thanks\relax } % rules for title box at top of first page \newcommand{\@toptitlebar}{ \hrule height 4\p@ \vskip 0.25in \vskip -\parskip% } \newcommand{\@bottomtitlebar}{ \vskip 0.29in \vskip -\parskip \hrule height 1\p@ \vskip 0.09in% } % create title (includes both anonymized and non-anonymized versions) \providecommand{\@maketitle}{} \renewcommand{\@maketitle}{% \vbox{% \hsize\textwidth \linewidth\hsize \vskip 0.1in \@toptitlebar \centering {\LARGE\bf \@title\par} \@bottomtitlebar \if@submission \begin{tabular}[t]{c}\bf\rule{\z@}{24\p@} Anonymous Author(s) \\ Affiliation \\ Address \\ \texttt{email} \\ \end{tabular}% \else \def\And{% \end{tabular}\hfil\linebreak[0]\hfil% \begin{tabular}[t]{c}\bf\rule{\z@}{24\p@}\ignorespaces% } \def\AND{% \end{tabular}\hfil\linebreak[4]\hfil% \begin{tabular}[t]{c}\bf\rule{\z@}{24\p@}\ignorespaces% } \begin{tabular}[t]{c}\bf\rule{\z@}{24\p@}\@author\end{tabular}% \fi \vskip 0.3in \@minus 0.1in } } % add conference notice to bottom of first page \newcommand{\ftype@noticebox}{8} \newcommand{\@notice}{% % give a bit of extra room back to authors on first page \enlargethispage{2\baselineskip}% \@float{noticebox}[b]% \footnotesize\@noticestring% \end@float% } % abstract styling \renewenvironment{abstract}% {% \vskip 0.075in% \centerline% {\large\bf Abstract}% \vspace{0.5ex}% \begin{quote}% } { \par% \end{quote}% \vskip 1ex% } \endinput PK!mdc/templates/__init__.pyPK!h mdc/templates/icml.tex\RequirePackage{luatex85} \documentclass{article} \usepackage[T1]{fontenc} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{fancyhdr} \usepackage{graphicx} \usepackage{subcaption} \usepackage{dblfloatfix} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} \usepackage$if(submission)$$else$[accepted]$endif${$if(local)$icml$else$resources/icml$endif$} % Pandoc tightlist \providecommand{\tightlist}{% \setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} % Fix tables \makesavenoteenv{longtable} % Place floats at the top of float-only pages \makeatletter \setlength{\@fptop}{0pt} \setlength{\@fpbot}{0pt plus 1fil} \makeatother % Set defaults for figure, table placement \makeatletter \def\fps@figure{!tb} \def\fps@table{!tb} \makeatother % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 $for(include-before)$$include-before$$endfor$ \icmltitlerunning{$if(running-title)$$running-title$$else$$title$$endif$} \begin{document} % Configure basic typography \nowidow[2] \parindent=2.5em \lefthyphenmin=2 \righthyphenmin=3 \twocolumn[ \icmltitle{$title$} \icmlsetsymbol{equal}{*} \begin{icmlauthorlist} $for(author)$ \icmlauthor{$author.name$}{$if(author.equalcontrib)$equal,$endif$$author.affiliation.id$} $endfor$ \end{icmlauthorlist} $for(institute)$ \icmlaffiliation{$institute.id$}{$institute.name$} $endfor$ $for(author)$ $if(author.corresponding)$ \icmlcorrespondingauthor{$author.name$}{$author.email$} $endif$ $endfor$ $if(keyword)$ \icmlkeywords{$for(keyword)$$keyword$$sep$, $endfor$} $endif$ \vskip 0.3in ] $if(skipequal)$\printAffiliationsAndNotice{}$else$\printAffiliationsAndNotice{\icmlEqualContribution}$endif$ \begin{abstract} $abstract$ \end{abstract} $body$ \bibliography{$bibliography$} \bibliographystyle{$if(local)$icml$else$resources/icml$endif$} \end{document} PK!| mdc/templates/neurips.tex\documentclass{article} \PassOptionsToPackage{square,numbers,super,sort&compress}{natbib} \usepackage$if(submission)$$else$[final]$endif${$if(local)$neurips$else$resources/neurips$endif$} \usepackage[utf8]{inputenc} \usepackage[T1]{fontenc} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{url} \usepackage{graphicx} \usepackage{subcaption} \usepackage{dblfloatfix} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} \usepackage{algpseudocode} \usepackage{algorithmicx} % Footnote without marker \newcommand\blfootnote[1]{% \begingroup \renewcommand\thefootnote{}\footnote{#1}% \addtocounter{footnote}{-1}% \endgroup } % Put year in citet \newcommand*{\nolink}[1]{% {\protect\NoHyper#1\protect\endNoHyper}% } \renewcommand{\citet}[1]{\nolink{\citeauthor{#1} (\citeyear{#1})}\citep{#1}} % Pandoc tightlist \providecommand{\tightlist}{% \setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} % Fix tables \makesavenoteenv{longtable} % Place floats at the top of float-only pages \makeatletter \setlength{\@fptop}{0pt} \setlength{\@fpbot}{0pt plus 1fil} \makeatother % Set defaults for figure, table placement \makeatletter \def\fps@figure{!tb} \def\fps@table{!tb} \makeatother % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} $for(include-before)$$include-before$$endfor$ \title{$title$} \author{% $for(author)$% $author.name$$if(author.equalcontrib)$$if(skipequal)$$else$$$^\ast$$$endif$$endif$\\ $author.affiliation.name$\\ \texttt{$author.email$}\\ $sep$\And$endfor$% } \begin{document} \maketitle $if(skipequal)$$else$\blfootnote{\textsuperscript{\ast}Equal contribution.}$endif$ \begin{abstract} $abstract$ \end{abstract} $body$ \small \bibliographystyle{humannat} \bibliography{$bibliography$} \end{document} PK!?OOmdc/templates/note.tex\documentclass[letterpaper]{article} \usepackage[hmargin=1.5in,tmargin=1in,bmargin=1.5in]{geometry} \usepackage[T1]{fontenc} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{cfr-lm} \usepackage[no-math]{fontspec} \usepackage{nowidow} \usepackage{parskip} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{fancyhdr} \usepackage{titlesec} \usepackage{graphicx} \usepackage{subcaption} \usepackage{dblfloatfix} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} % Pandoc tightlist \providecommand{\tightlist}{% \setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} % Fix tables \makesavenoteenv{longtable} % Place floats at the top of float-only pages \makeatletter \setlength{\@fptop}{0pt} \setlength{\@fpbot}{0pt plus 1fil} \makeatother % Set defaults for figure, table placement \makeatletter \def\fps@figure{!tb} \def\fps@table{!tb} \makeatother % Disable page numbers \pagenumbering{gobble} % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} $for(include-before)$$include-before$$endfor$ \title{$title$} \author{$for(author)$$author.name$$sep$\quad $endfor$} \date{} \begin{document} \maketitle $body$ \end{document} PK!.mdc/templates/simple.tex\documentclass[letterpaper,twocolumn]{article} \usepackage[hmargin=46pt,tmargin=1in,bmargin=1.5in,footskip=0.75in]{geometry} \usepackage[T1]{fontenc} \usepackage[no-math]{fontspec} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{cfr-lm} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{fancyhdr} \usepackage[absolute]{textpos} \usepackage{titlesec} \usepackage[square,numbers,super,sort&compress]{natbib} \usepackage{graphicx} \usepackage{subcaption} \usepackage{dblfloatfix} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{mleftright} \usepackage{bm} \usepackage{algpseudocode} \usepackage{algorithmicx} % Set fonts \setmainfont{ebgaramond-regular}[Extension=.ttf, Path=resources/, ItalicFont=ebgaramond-italic] \setmonofont{lmmono-regular}[Extension=.otf, Path=resources/, ItalicFont=lmmono-italic, SmallCapsFont=lmmonocaps-regular] % Put year in citet \newcommand*{\nolink}[1]{{\protect\NoHyper#1\protect\endNoHyper}} \renewcommand{\citet}[1]{\nolink{\citeauthor{#1} (\citeyear{#1})}\citep{#1}} % Pandoc tightlist \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} % Fix tables \makesavenoteenv{longtable} % Place floats at the top of float-only pages \makeatletter \setlength{\@fptop}{0pt} \setlength{\@fpbot}{0pt plus 1fil} \makeatother % Set defaults for figure, table placement \makeatletter \def\fps@figure{!tb} \def\fps@table{!tb} \makeatother % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 % Configure headings \titleformat{\section}[hang]{\raggedright\normalfont\Large}{\thesection}{3\wordsep}{} \titleformat{\subsection}[hang]{\raggedright\normalfont\large}{\thesubsection}{3\wordsep}{} \titleformat{\subsubsection}[hang]{\raggedright\normalfont\normalsize\itshape}{\thesubsubsection}{4\wordsep}{} \titleformat{\paragraph}[runin]{\normalfont\normalsize\scshape}{}{4\wordsep}{} % Set column separation \setlength{\columnsep}{1.6em} % Configure page no. \pagestyle{fancy} \fancyhf{} \renewcommand{\headrulewidth}{0pt} \fancyfoot[R]{\scriptsize\thepage} $for(include-before)$$include-before$$endfor$ \title{% \vspace{-5ex}% \begin{minipage}{\textwidth}% \begin{flushleft}% {\normalfont\Huge $title$}% \end{flushleft}% \end{minipage}% \vspace{-2ex}% } \author{% \begin{minipage}{\textwidth}% \begin{flushleft}% \hspace{-0.5em}% {% \normalfont\large\scshape% $for(author)$$author.name$\textsuperscript{$author.affiliation.id$$if(author.equalcontrib)$$if(skipequal)$$else$,*$endif$$endif$}$sep$\quad $endfor$% }% \end{flushleft}% \end{minipage}% \vspace{4ex}% } \date{} \begin{document} % Configure basic typography \nowidow[2] \parindent=2.5em \lefthyphenmin=2 \righthyphenmin=3 \maketitle \thispagestyle{fancy} \textblockorigin{0in}{11in} \setlength{\TPHorizModule}{1pt} \setlength{\TPVertModule}{1in} \begin{textblock}{400}(46,-0.9) \parindent=0pt \normalfont\scriptsize\raggedright \hrule \hrule \vspace{1.5ex} $if(skipequal)$$else$\textsuperscript{*}Equal contribution.$endif$ $for(institute)$\textsuperscript{$institute.id$}$institute.name$.$endfor$ Email:~$for(author)$\texttt{$author.email$}$sep$, $endfor$. \end{textblock} $if(abstract)$ \section*{Abstract} $abstract$ $endif$ $body$ $if(bibliography)$ \footnotesize \bibliographystyle{humannat} \bibliography{$bibliography$} $endif$ \end{document} PK!]<mdc/templates/standalone.tex\documentclass[preview,varwidth=100in]{standalone} \usepackage[T1]{fontenc} \usepackage[no-math]{fontspec} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{cfr-lm} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{acronym} \usepackage{relsize} \usepackage{mathtools} \usepackage{amssymb} \usepackage{mleftright} \usepackage{bm} \usepackage{algpseudocode} \usepackage{subcaption} \usepackage{pgf} % Set fonts \setmainfont{ebgaramond-regular}[Extension=.ttf, Path=resources/, ItalicFont=ebgaramond-italic] \setmonofont{lmmono-regular}[Extension=.otf, Path=resources/, ItalicFont=lmmono-italic, SmallCapsFont=lmmonocaps-regular] % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} $for(include-before)$$include-before$$endfor$ \begin{document} $body$ \end{document} PK!ܞ|mdc/templates/stylish.tex\documentclass[letterpaper,twocolumn]{article} \usepackage[hmargin=0.75in,vmargin=0.75in,footskip=0.5in]{geometry} \usepackage[T1]{fontenc} \usepackage[no-math]{fontspec} \usepackage[babel=true,protrusion=true,expansion=true]{microtype} \usepackage[american]{babel} \usepackage{cfr-lm} \usepackage{nowidow} \usepackage[unicode=true,hidelinks]{hyperref} \usepackage{fancyhdr} \usepackage{sectsty} \usepackage[square,numbers,super,sort&compress]{natbib} \usepackage{graphicx} \usepackage{caption} \usepackage{subcaption} \usepackage{dblfloatfix} \usepackage{xcolor} \usepackage{tikz} \usepackage{booktabs} \usepackage{longtable} \usepackage{footnote} \usepackage{acronym} \usepackage{relsize} \usepackage{upquote} \usepackage{fancyvrb} \usepackage{etoolbox} \usepackage{mathtools} \usepackage{amssymb} \usepackage{amsthm} \usepackage{amsopn} \usepackage{mleftright} \usepackage{bm} \usepackage{algpseudocode} \usepackage{algorithmicx} % Set fonts \setmainfont{ebgaramond-regular}[Extension=.ttf, Path=resources/, ItalicFont=ebgaramond-italic, ItalicFeatures={Style=Swash}] \setmonofont{lmmono-regular}[Extension=.otf, Path=resources/, ItalicFont=lmmono-italic, SmallCapsFont=lmmonocaps-regular] % Footnote without marker \newcommand\blfootnote[1]{% \begingroup \renewcommand\thefootnote{}\footnote{\raggedright \hspace{-20pt} #1}% \addtocounter{footnote}{-1}% \endgroup } % Put year in citet \newcommand*{\nolink}[1]{{\protect\NoHyper#1\protect\endNoHyper}} \renewcommand{\citet}[1]{\nolink{\citeauthor{#1} (\citeyear{#1})}\citep{#1}} % Pandoc tightlist \providecommand{\tightlist}{\setlength{\itemsep}{0pt}\setlength{\parskip}{0pt}} % Fix tables \makesavenoteenv{longtable} % Place floats at the top of float-only pages \makeatletter \setlength{\@fptop}{0pt} \setlength{\@fpbot}{0pt plus 1fil} \makeatother % Set defaults for figure, table placement \makeatletter \def\fps@figure{!tb} \def\fps@table{!tb} \makeatother % Use mleftright \renewcommand\left\mleft \renewcommand\right\mright % Automatically use \left and \right with parentheses \makeatletter \def\resetMathstrut@{% \setbox\z@\hbox{% \mathchardef\@tempa\mathcode`\[\relax \mathchardef\@tempc\mathcode`\]\relax \def\@tempb##1"##2##3{\the\textfont"##3\char"}% \expandafter\@tempb\meaning\@tempa \relax }% \ht\Mathstrutbox@\ht\z@ \dp\Mathstrutbox@\dp\z@} \makeatother \begingroup \catcode`(\active \xdef({\left\string(} \catcode`)\active \xdef){\right\string)} \endgroup \mathcode`(="8000 \mathcode`)="8000 % Configure acronyms \renewcommand*{\acsfont}[1]{\textsc{\textsmaller{#1}}} % Configure (sub(sub))section fonts \sectionfont{\raggedright\normalfont\fontspec{futura-medium.ttf}[Path=resources/]\fontsize{15}{0}\selectfont} \subsectionfont{\raggedright\normalfont\fontspec{futura-book.ttf}[Path=resources/]\fontsize{13}{0}\selectfont} \subsubsectionfont{\raggedright\normalfont\fontspec{futura-book.ttf}[Path=resources/]\fontsize{9}{0}\selectfont\MakeUppercase} % Configure (sub(sub))section numbers \renewcommand*{\thesection}{\arabic{section}.} \renewcommand*{\thesubsection}{\arabic{section}.\arabic{subsection}} \renewcommand*{\thesubsubsection}{\arabic{section}.\arabic{subsection}.\arabic{subsubsection}} % Configure captions \captionsetup{justification=raggedright,singlelinecheck=true} \renewcommand{\captionfont}{\fontspec{futura-light.ttf}[Path=resources/]} \renewcommand{\captionlabelfont}{\fontspec{futura-medium.ttf}[Path=resources/]} % Set column separation \setlength{\columnsep}{0.3in} % Configure page no. \pagestyle{fancy} \fancyhf{} \renewcommand{\headrulewidth}{0pt} \fancyfoot[R]{\scriptsize{\thepage}} $for(include-before)$$include-before$$endfor$ \title{% \vspace{-3ex}% \begin{minipage}{\textwidth}% \begin{flushleft}% {\fontspec{futura-medium.ttf}[Path=resources/]\fontsize{20}{0}\selectfont $title$}% \end{flushleft}% \end{minipage}% \vspace{-1ex}% } \author{% \begin{minipage}{\textwidth}% \begin{flushleft}% \hspace{-0.5em}% {% \fontspec{futura-book.ttf}[Path=resources/]\fontsize{12}{0}\selectfont% $for(author)$$author.name$\textsuperscript{$author.affiliation.id$$if(author.equalcontrib)$$if(skipequal)$$else$,*$endif$$endif$}$sep$\quad $endfor$% }% \end{flushleft}% \end{minipage}% } \date{\vspace{-3ex}} % Configure basic typography \fussy \pretolerance 400 \emergencystretch 2em \begin{document} \maketitle \thispagestyle{fancy} \blfootnote{% {% \scriptsize\fontspec{futura-light.ttf}[Path=resources/]% $if(skipequal)$$else$\textsuperscript{*}Equal contribution.$endif$% $for(institute)$\mbox{\textsuperscript{$institute.id$}$institute.name$.}\enspace$endfor$% Email:~$for(author)$\mbox{\texttt{$author.email$}}$sep$, $endfor$.% }% } $if(abstract)$ \hrule height 1pt \vspace{0.5em} {\small\bfseries $abstract$} \vspace{0.5em} \hrule height 1pt $endif$ $body$ $if(bibliography)$ \footnotesize \setlength{\bibsep}{0pt plus 0.3ex} \bibliographystyle{humannat} \bibliography{$bibliography$} $endif$ \end{document} PK!H3I88#$)shinymdc-0.2.0.dist-info/entry_points.txtN+I/N.,()MIb= MPK!Hu)GTUshinymdc-0.2.0.dist-info/WHEEL HM K-*ϳR03rOK-J,/R(O-)$qzd&Y)r$UV&UrPK!H!G$ !shinymdc-0.2.0.dist-info/METADATAn@ ),qIJ[K[A{~HlČlHQoNeV<*RhZ]֪8Jyo<m87!UCҮ\qۋbT˽:dU{ɊQQ*oy[R|'4>Xt[R4$Ol w'{A.y3d] ,F1}b;L=0+9 !DbkzVcFe`\;S͸QQ~ԃl01ۨKO毫˛Y]ĞѤ1 9bM~&?^ ;ZGOa؍χϏk d\PK!HFfshinymdc-0.2.0.dist-info/RECORDɒX}? d1^0*L*n$p.(>}megzA]}QTu~2XSGnNR̗*Se%ԛ(8FQAv!:όsf=0odkqnI@Ob#_EbxUZX˻F⬩emo]&oHx[exJ?ʟ3fxl(5#a^}Ora*Oy!FR(&^yVD?kb׉b89dPՈusߔ6 V|B /WyԊAm/(R"yrhi@F8=΄u"bo@lB$⚚ՂC0SB7UQWi'aUX[=q]|u8 #+ܸڇ;E!W).CY50| 'fHe^Də?CJ"fI ҶHF|k~&Œ'gMFAŻS)c9 -hQ<|W}MCSi[ˈg*qBE#6`Y{p\Qֲ}EƓc`$͊oX=^t\ 0^l\xu QW%:q`ĘGw]7ez2qOry̕Rd~tsͻ .ɒIWߺbX:`Ju,. -ˆ~'~ۍ#DzU#«.?@%aաǏ&Es6P(r9`%:69,X;[õYOLqyM6: r+,f3.B1j{Iү3@8O|,eZqYh6/m}0^ }Mq|PK!sFmdc/__init__.pyPK!" Cmdc/mdc.pyPK!8!mdc/resources/__init__.pyPK!p p #o!mdc/resources/ebgaramond-italic.ttfPK!$ ,mdc/resources/ebgaramond-regular.ttfPK!G}$ mdc/resources/futura-book-italic.ttfPK!a88P_ mdc/resources/futura-book.ttfPK!zcE88 mdc/resources/futura-light.ttfPK!b27mdc/resources/futura-medium.ttfPK!D:j j jmdc/resources/icml.bstPK!Lii>mdc/resources/icml.styPK!U``$mdc/resources/lmmono-italic.otfPK! " mdc/resources/lmmono-regular.otfPK!$mdc/resources/lmmonocaps-regular.otfPK!>!+!+mdc/resources/neurips.styPK!Amdc/templates/__init__.pyPK!h xmdc/templates/icml.texPK!| mdc/templates/neurips.texPK!?OOmdc/templates/note.texPK!.I mdc/templates/simple.texPK!]<91mdc/templates/standalone.texPK!ܞ|b7mdc/templates/stylish.texPK!H3I88#$)\Kshinymdc-0.2.0.dist-info/entry_points.txtPK!Hu)GTUKshinymdc-0.2.0.dist-info/WHEELPK!H!G$ !VLshinymdc-0.2.0.dist-info/METADATAPK!HFf